Protein Family IF13127
Metagenome
Isolate
310
Members
252
Samples
135
Scaffolds
192.04
Avg Length
Representative Sequence
- ID
- iso_pr_bacteria|2964859436|2964859857|
- Length
- 218 aa
- Sequence
- AQREGRNPRLHLVASCGKVSLSAPFPDNSMKKIIVGISGASGAIYGIRLLQTLQAVAEVETHLIMSQAARQTLSLETDMSVRDVQALADVNHDARDIAASVSSGSFKTDGMIILPCSIKTLSGIVNSYTDGLLTRAADVVLKERRRLVLCVRETPLHLGHLRLMTQAAELGAIIMPPMPAFYHRPQTLDDVINQTVNRALDQLDITLPADLFTRWPGA
Sample Types
Isolate
56.1%
Metagenome
43.9%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Drosophilidae
15.4%
Unclassified
13.3%
Termitidae
10.4%
Anthocoridae
7.9%
Formicidae
7.1%
Muscidae
5.4%
Curculionidae
4.1%
Kalotermitidae
4.1%
Apidae
3.7%
Aphididae
2.9%
Tenebrionidae
2.9%
Blattidae
2.1%
Culicidae
2.1%
Cerambycidae
1.7%
Calliphoridae
1.7%
Tephritidae
1.7%
Armadillidiidae
1.2%
Coreidae
1.2%
Pentatomidae
0.8%
Scarabaeidae
0.8%
Plutellidae
0.8%
Daphniidae
0.8%
Rhinotermitidae
0.8%
Termopsidae
0.8%
Sarcophagidae
0.8%
Passalidae
0.4%
Triozidae
0.4%
Crambidae
0.4%
Glossinidae
0.4%
Aphalaridae
0.4%
Aleyrodidae
0.4%
Aphrophoridae
0.4%
Thripidae
0.4%
Anthomyiidae
0.4%
Alydidae
0.4%
Pteromalidae
0.4%
Elmidae
0.4%
Ceratophyllidae
0.4%
Taxonomy
Archaea
1
Bacteria
282
Eukaryota
0
Viruses
0
Unclassified
27
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 2 | 2515154034 | Frischella perrara PEB0191 | Isolate | Apidae |
| 3 | 2630968947 | Frischella perrara PEB0191 | Isolate | Apidae |
| 4 | 2687453742 | Burkholderiales bacterium B_Cag20 | Isolate | Unclassified |
| 5 | 2690315820 | Lactiplantibacillus plantarum WJL | Isolate | Drosophilidae |
| 6 | 2756170277 | Enterobacillus tribolii DSM 103736 | Isolate | Unclassified |
| 7 | 2833053935 | Buttiauxella sp. 3AFRM03 | Isolate | Cerambycidae |
| 8 | 2837516909 | Rahnella bruchi DSM 27398 | Isolate | Unclassified |
| 9 | 2841260384 | Providencia alcalifaciens Dmel2 | Isolate | Drosophilidae |
| 10 | 2856954254 | Pseudonocardia sp. Ae505_Ps2 | Isolate | Formicidae |
| 11 | 2878947168 | Serratia marcescens ADJS-2D_White | Isolate | Unclassified |
| 12 | 2885043073 | Erwinia sp. OLSSP12 | Isolate | Anthocoridae |
| 13 | 2892972412 | Sodalis-like symbiont of Bactericera trigonica IL | Isolate | Triozidae |
| 14 | 2896187957 | Providencia stuartii Crippen | Isolate | Calliphoridae |
| 15 | 2937735258 | Serratia marcescens KZ11 | Isolate | Apidae |
| 16 | 2940380068 | Paenibacillus sp. PastH-2 | Isolate | Blattidae |
| 17 | 2961247850 | Serratia sp. OLAL2 | Isolate | Anthocoridae |
| 18 | 2964739456 | Lactiplantibacillus plantarum FlyG10.1.9 | Isolate | Drosophilidae |
| 19 | 2970335472 | Cronobacter muytjensii MOD1-Md1s | Isolate | Muscidae |
| 20 | 2977727922 | Cronobacter sakazakii MOD1-Md33s | Isolate | Muscidae |
| 21 | 2978102237 | Serratia fonticola AeS1 | Isolate | Culicidae |
| 22 | 3300002464 | Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 | Metagenome | Culicidae |
| 23 | 3300007083 | Ant gut microbial communities from Cephalotes persimilis, Brazil | Metagenome | Formicidae |
| 24 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 25 | 3300012819 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG | Metagenome | Armadillidiidae |
| 26 | 3300012858 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG | Metagenome | Armadillidiidae |
| 27 | 648861007 | Candidatus Regiella insecticola LSR1 | Isolate | Aphididae |
| 28 | 8004307473 | Serratia sp. OLIL2 | Isolate | Anthocoridae |
| 29 | 8004571736 | Serratia sp. OLDL1 | Isolate | Anthocoridae |
| 30 | 8021535516 | Klebsiella sp. Kd70 TUC-EEAOC | Isolate | Crambidae |
| 31 | 8100181737 | Kosakonia sp. S58 | Isolate | Curculionidae |
| 32 | 2189573031 | Gamma-1 phylotype from Apis mellifera gut collected at the Carl Hayden Bee Research Center, Tucson, AZ. | Metagenome | Apidae |
| 33 | 2547132042 | Pseudonocardia sp. P2 | Isolate | Formicidae |
| 34 | 2588253732 | Klebsiella pneumoniae pneumoniae KP5-1 | Isolate | Pentatomidae |
| 35 | 2597490293 | Lactiplantibacillus plantarum DmCS_001 | Isolate | Drosophilidae |
| 36 | 2718218475 | Lactiplantibacillus plantarum KP | Isolate | Drosophilidae |
| 37 | 2791355481 | Bacillus sp. ZY-1-1 | Isolate | Scarabaeidae |
| 38 | 2847708326 | Serratia liquefaciens P2ACOL2 | Isolate | Cerambycidae |
| 39 | 2856068565 | Cronobacter sakazakii MOD1-Md35s | Isolate | Muscidae |
| 40 | 2856960404 | Pseudonocardia sp. Ae706_Ps2 | Isolate | Formicidae |
| 41 | 2856973192 | Pseudonocardia sp. Ae331_Ps2 | Isolate | Formicidae |
| 42 | 2859970369 | Pseudonocardia sp. Ae717_Ps2 | Isolate | Formicidae |
| 43 | 2874504452 | Serratia marcescens ADJS-2C_Purple | Isolate | Unclassified |
| 44 | 2885058212 | Erwinia sp. OLTSP20 | Isolate | Anthocoridae |
| 45 | 2901296437 | Erwinia dacicola Oroville | Isolate | Tephritidae |
| 46 | 2964778705 | Lactiplantibacillus plantarum DietG20.2.2_EE | Isolate | Unclassified |
| 47 | 2967924226 | Cronobacter malonaticus MOD1-Md25g | Isolate | Muscidae |
| 48 | 2970225615 | Lactiplantibacillus plantarum FlyG8.1.1 | Isolate | Drosophilidae |
| 49 | 2970322301 | Cronobacter sakazakii MOD1-Md33g | Isolate | Muscidae |
| 50 | 2977628635 | Lactiplantibacillus plantarum FlyG3.1.8 | Isolate | Drosophilidae |
| 51 | 2977653127 | Lactiplantibacillus plantarum FlyG10.1.5 | Isolate | Drosophilidae |
| 52 | 2996406003 | Serratia sp. OLJL1 | Isolate | Anthocoridae |
| 53 | 3001462594 | Tatumella sp. JGM91 | Isolate | Drosophilidae |
| 54 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 55 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 56 | 3300007188 | Ant gut microbial communities from Cephalotes rohweri, Arizona, USA | Metagenome | Formicidae |
| 57 | 3300009460 | Microbial communities of aphids from Pistacia texana in Langtry, TX, USA - Geopemphigus sp. seqcov | Metagenome | |
| 58 | 3300010217 | Sitobion avenae (English Grain Aphid) hemolymph microbial communities from Henan Dengzhou, China - Region2 | Metagenome | Aphididae |
| 59 | 3300035363 | Gut microbial communities from Plutella xylostella in Fujian, Fuzhou, China - pupa gut | Metagenome | Plutellidae |
| 60 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 61 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 62 | 637000270 | Sodalis glossinidius morsitans | Isolate | Glossinidae |
| 63 | 637000338 | Wigglesworthia glossinidia | Isolate | Unclassified |
| 64 | 8074288691 | Tatumella sp. JGM82 | Isolate | Drosophilidae |
| 65 | 8101683685 | Providencia sp. JGM181 | Isolate | Drosophilidae |
| 66 | 2209111004 | Macrotermes natalensis queen gut microbiome | Metagenome | Termitidae |
| 67 | 2509601000 | Secondary endosymbiont of Ctenarytaina eucalypti Thao2000 | Isolate | Aphalaridae |
| 68 | 2548876931 | Candidatus Hamiltonella defensa MED (Bemisia tabaci) | Isolate | Aleyrodidae |
| 69 | 2556921669 | Shinella sp. DD12 | Isolate | Daphniidae |
| 70 | 2574179716 | Serratia sp. DD3 | Isolate | Daphniidae |
| 71 | 2576861670 | Lactiplantibacillus plantarum WJL | Isolate | Drosophilidae |
| 72 | 2585428135 | Sodalis-like symbiont of Philaenus spumarius PSPU | Isolate | Aphrophoridae |
| 73 | 2590828839 | Clostridium sp. 1 | Isolate | Termitidae |
| 74 | 2597489903 | Providencia sneebia DSM 19967 | Isolate | Drosophilidae |
| 75 | 2684622921 | Frischella perrara Fp_167 | Isolate | Unclassified |
| 76 | 2718217944 | Serratia marcescens AS1 | Isolate | Culicidae |
| 77 | 2765235945 | Kosakonia cowanii Esp_Z | Isolate | Culicidae |
| 78 | 2833532623 | Frischella perrara ESL0167 | Isolate | Apidae |
| 79 | 2856882415 | Pseudonocardia sp. Ae406_Ps2 | Isolate | Formicidae |
| 80 | 2874434233 | Serratia marcescens ADJS-2C_Red | Isolate | Unclassified |
| 81 | 2937236879 | Lactiplantibacillus plantarum MHO2.4 | Isolate | |
| 82 | 2960772748 | Lactiplantibacillus plantarum MHO2.9 | Isolate | |
| 83 | 2961232173 | Serratia sp. OLLOLW30 | Isolate | Anthocoridae |
| 84 | 2964765680 | Lactiplantibacillus plantarum MHO2.5 | Isolate | |
| 85 | 2967825073 | Lactiplantibacillus plantarum FlyG9.1.4 | Isolate | Drosophilidae |
| 86 | 2970254690 | Lactiplantibacillus plantarum FlyG9.2.5 | Isolate | Drosophilidae |
| 87 | 2970791725 | Serratia sp. OLBL1 | Isolate | Anthocoridae |
| 88 | 2977596371 | Lactiplantibacillus plantarum FlyG11.2.6 | Isolate | Drosophilidae |
| 89 | 2977622177 | Lactiplantibacillus plantarum FlyG20.2.6 | Isolate | Drosophilidae |
| 90 | 2977691992 | Cronobacter malonaticus MOD1-Md27g | Isolate | Muscidae |
| 91 | 2977745872 | Cronobacter sakazakii MOD1-Md1g | Isolate | Muscidae |
| 92 | 2996467878 | Serratia sp. OLFL2 | Isolate | Anthocoridae |
| 93 | 3300002732 | Whitefly associated endosymbiont microbial communities from Neve Yaar, Israel Sample - Wolbechia Contigs | Metagenome | |
| 94 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 95 | 3300002934 | Ant worker gut metagenome for colony PL005 | Metagenome | Formicidae |
| 96 | 3300007052 | Ant gut microbial communities from Cephalotes eduarduli, Brazil | Metagenome | Formicidae |
| 97 | 3300007192 | Ant gut microbial communities from Cephalotes persimplex, Brazil | Metagenome | Formicidae |
| 98 | 3300009453 | Microbial communities of aphids from Cornus sp. in New Haven, CT, USA - Anoecia fulviabdominalis seqcov | Metagenome | |
| 99 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 100 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 101 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 102 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 103 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 104 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 105 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 106 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 107 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 108 | 3300056814 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) | Metagenome | Tenebrionidae |
| 109 | 3300057007 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) | Metagenome | Tenebrionidae |
| 110 | 8100176769 | Kosakonia sp. S57 | Isolate | Curculionidae |
| 111 | 8102014801 | Caballeronia sp. ATUFL_M2_KS44 | Isolate | Coreidae |
| 112 | 2599185261 | Thorsellia anophelis DSM 18579 | Isolate | Unclassified |
| 113 | 2728369362 | Lactiplantibacillus plantarum DF | Isolate | Drosophilidae |
| 114 | 2871760914 | Pantoea ananatis PANS 01-2 | Isolate | Thripidae |
| 115 | 2921816052 | Cronobacter sakazakii MOD1-Anth48g | Isolate | Anthomyiidae |
| 116 | 2922113941 | Serratia sp. OLEL1 | Isolate | Anthocoridae |
| 117 | 2937427229 | Cronobacter malonaticus MOD1-Md99g | Isolate | Muscidae |
| 118 | 2937751072 | Serratia sp. OLMTLW26 | Isolate | Anthocoridae |
| 119 | 2940406939 | Paenibacillus sp. PastM-3 | Isolate | Blattidae |
| 120 | 2958255616 | Serratia marcescens TM | Isolate | |
| 121 | 2964749277 | Lactiplantibacillus plantarum FlyG20.1.4 | Isolate | Drosophilidae |
| 122 | 2964775400 | Lactiplantibacillus plantarum FlyG2.1.8 | Isolate | Unclassified |
| 123 | 2965197371 | Serratia sp. OLCL1 | Isolate | Anthocoridae |
| 124 | 3001459110 | Tatumella sp. JGM118 | Isolate | Drosophilidae |
| 125 | 3300009478 | Microbial communities of aphids from honeysuckle in Ottawa, Ontario, CA - Hyadaphis tataricae CNC#HEM071793 seqcov | Metagenome | |
| 126 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 127 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 128 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 129 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 130 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 131 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 132 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 133 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 134 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 135 | 8001059720 | Tenebrionicola larvae YMB-R22 | Isolate | Tenebrionidae |
| 136 | 8062647588 | Nissabacter archeti JGM97 | Isolate | Drosophilidae |
| 137 | 8102081745 | Caballeronia sp. GAWG1-5s-s | Isolate | Coreidae |
| 138 | 8102982778 | Erwinia sp. S63 | Isolate | Curculionidae |
| 139 | 2519899623 | Enterobacter sp. Ag1 | Isolate | Culicidae |
| 140 | 2597489944 | Caballeronia insecticola RPE64 | Isolate | Alydidae |
| 141 | 2648501209 | Winslowiella iniecta B149 | Isolate | Aphididae |
| 142 | 2703719239 | Serratia marcescens ano1 | Isolate | Unclassified |
| 143 | 2820356982 | Unclassified Firmicutes Nt197P3bin19 | Isolate | Unclassified |
| 144 | 2820823448 | Unclassified Actinobacteria Nt197P3bin113 | Isolate | Unclassified |
| 145 | 2835335304 | Rahnella sp. Larv3_ips | Isolate | Curculionidae |
| 146 | 2859315706 | Serratia sp. 3ACOL1 | Isolate | Cerambycidae |
| 147 | 2876334352 | Cronobacter sakazakii MOD1-Md6g | Isolate | Muscidae |
| 148 | 2885050628 | Erwinia sp. OLMTSP26 | Isolate | Anthocoridae |
| 149 | 2885061987 | Erwinia sp. OLFS4 | Isolate | Anthocoridae |
| 150 | 2885065815 | Erwinia sp. OAMSP11 | Isolate | Anthocoridae |
| 151 | 2940393498 | Paenibacillus sp. PastF-2 | Isolate | Blattidae |
| 152 | 2957623355 | Lactiplantibacillus plantarum FlyG11.1.2 | Isolate | Drosophilidae |
| 153 | 2961206375 | Serratia sp. OMLW3 | Isolate | Anthocoridae |
| 154 | 2967802344 | Lactiplantibacillus plantarum FlyG11.1.6 | Isolate | Drosophilidae |
| 155 | 2977592972 | Lactiplantibacillus plantarum FlyG7.1.6 | Isolate | Drosophilidae |
| 156 | 2986970932 | Candidatus Fukatsuia symbiotica 5D | Isolate | Unclassified |
| 157 | 2989309576 | Sporomusa termitida DSM 4440 | Isolate | Unclassified |
| 158 | 3300002932 | Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 | Metagenome | Formicidae |
| 159 | 3300005318 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 2 gut | Metagenome | Drosophilidae |
| 160 | 3300012820 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E6 MG | Metagenome | Armadillidiidae |
| 161 | 3300012825 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG | Metagenome | |
| 162 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 163 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 164 | 8004285568 | Serratia sp. OLHL2 | Isolate | Anthocoridae |
| 165 | 8004541719 | Serratia marcescens KZ19 | Isolate | Apidae |
| 166 | 8004582426 | Serratia sp. OSPLW9 | Isolate | Anthocoridae |
| 167 | 8024044713 | Caballeronia sp. Sq4a | Isolate | Coreidae |
| 168 | 2574180310 | Bacillus licheniformis CG-B52 | Isolate | Unclassified |
| 169 | 2597489902 | Providencia rettgeri Dmel1 | Isolate | Drosophilidae |
| 170 | 2603880170 | Burkholderiales A2 | Isolate | Unclassified |
| 171 | 2756170266 | Frischella perrara DSM 104328 | Isolate | Unclassified |
| 172 | 2820094617 | Unclassified Proteobacteria Lab288P3bin216 | Isolate | Unclassified |
| 173 | 2846386538 | Rahnella sp. AN3-3W3 | Isolate | Pentatomidae |
| 174 | 2876358570 | Cronobacter sakazakii MOD1-Ls15g | Isolate | Calliphoridae |
| 175 | 2937387794 | Cronobacter turicensis MOD1-Sh41g | Isolate | Sarcophagidae |
| 176 | 2971189173 | Yersinia pestis A-1249 | Isolate | Unclassified |
| 177 | 3300000462 | Honey bee gut microbial communities from West Haven, Conneticut, USA - Frischia SCG AB-598-I22 | Metagenome | Apidae |
| 178 | 3300002501 | Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 | Metagenome | Termitidae |
| 179 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 180 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 181 | 3300007150 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 3 gut | Metagenome | Drosophilidae |
| 182 | 3300030930 | Ant gut bacterial community from Pseudomyrmex nigropilosus larvae, the Area de Conservacion Guanacaste, Costa Rica - colony BER0554 | Metagenome | Formicidae |
| 183 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 184 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 185 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 186 | 8065462725 | Tatumella sp. JGM100 | Isolate | Drosophilidae |
| 187 | 8065466226 | Tatumella sp. JGM130 | Isolate | Drosophilidae |
| 188 | 8065469765 | Tatumella sp. JGM16 | Isolate | Drosophilidae |
| 189 | 8100171289 | Kosakonia sp. S42 | Isolate | Curculionidae |
| 190 | 8101680043 | Providencia sp. JGM178 | Isolate | Drosophilidae |
| 191 | 8103002986 | Erwinia sp. S38 | Isolate | Curculionidae |
| 192 | 8103008710 | Erwinia sp. S43 | Isolate | Curculionidae |
| 193 | 2035918003 | Mountain Pine Beetle microbial communities from McBride, British Columbia, Canada - Lodgepole pine | Metagenome | Curculionidae |
| 194 | 2619619082 | Pantoea agglomerans SL1_M5 | Isolate | Unclassified |
| 195 | 2687453753 | Burkholderiales bacterium B_Cag25 | Isolate | Unclassified |
| 196 | 2751185823 | Erwinia haradaeae 3056 | Isolate | Aphididae |
| 197 | 2822856742 | Enterobacter cancerogenus CR-Eb1 | Isolate | Unclassified |
| 198 | 2850131454 | Providencia rettgeri NVIT03 | Isolate | Pteromalidae |
| 199 | 2898975184 | Erwinia dacicola IL | Isolate | Tephritidae |
| 200 | 2940386776 | Paenibacillus sp. PastF-1 | Isolate | Blattidae |
| 201 | 2964846109 | Cronobacter sakazakii MOD1-Md5g | Isolate | Muscidae |
| 202 | 2964859436 | Cronobacter sakazakii MOD1-Md40g | Isolate | Muscidae |
| 203 | 2970199020 | Lactiplantibacillus plantarum FlyG8.1.2 | Isolate | Drosophilidae |
| 204 | 2977635137 | Lactiplantibacillus plantarum DietG20.1.2 | Isolate | Unclassified |
| 205 | 2978161719 | Serratia marcescens KZ2 | Isolate | Apidae |
| 206 | 3000861951 | Budvicia diplopodorum D9 | Isolate | |
| 207 | 3004364956 | Cronobacter sakazakii MOD1-Md5s | Isolate | Muscidae |
| 208 | 3006468911 | Streptomyces sp. RB17 | Isolate | Termitidae |
| 209 | 3300002938 | Larval gut metagenome for colony PL005 | Metagenome | Formicidae |
| 210 | 3300003973 | Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle | Metagenome | Curculionidae |
| 211 | 3300005316 | Drosophila gut microbial communities from New York, USA - Drosophila falleni male 2 gut | Metagenome | Drosophilidae |
| 212 | 3300035364 | Gut microbial communities from Plutella xylostella in Fujian, Fuzhou, China - adult gut | Metagenome | Plutellidae |
| 213 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 214 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 215 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 216 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 217 | 3300056790 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) | Metagenome | Tenebrionidae |
| 218 | 3300056856 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) | Metagenome | Tenebrionidae |
| 219 | 8018312681 | Enterobacter sp. OLF | Isolate | Tephritidae |
| 220 | 8021540981 | Klebsiella sp. Kpp | Isolate | Tephritidae |
| 221 | 8028002147 | Enterobacter sp. 10-1 | Isolate | Cerambycidae |
| 222 | 8099192374 | Erwinia typographi IC4 | Isolate | Curculionidae |
| 223 | 8110023836 | Enterobacterales bacterium BIT-L3 | Isolate | Tenebrionidae |
| 224 | 2507262005 | Candidatus Regiella insecticola R5.15 | Isolate | Aphididae |
| 225 | 2515154100 | Streptomyces sp. MspMP-M5 | Isolate | Unclassified |
| 226 | 2529292851 | Providencia burhodogranariea DSM 19968 | Isolate | Drosophilidae |
| 227 | 2645727860 | Winslowiella iniecta B120 | Isolate | Aphididae |
| 228 | 2651870110 | Izhakiella capsodis N6PO6 | Isolate | Unclassified |
| 229 | 2703719240 | Serratia marcescens ano2 | Isolate | Unclassified |
| 230 | 2864909992 | Bacillus velezensis S00166 | Isolate | Elmidae |
| 231 | 2885046828 | Erwinia sp. OLCASP19 | Isolate | Anthocoridae |
| 232 | 2921842437 | Cronobacter sakazakii MOD1-Lc10s | Isolate | Calliphoridae |
| 233 | 2940400224 | Paenibacillus sp. PastM-2 | Isolate | Blattidae |
| 234 | 2957730672 | Cronobacter sakazakii MOD1-Md70g | Isolate | Muscidae |
| 235 | 2967915117 | Cronobacter sakazakii MOD1-Lc10g | Isolate | Calliphoridae |
| 236 | 2979682021 | Cronobacter turicensis MOD1-Sh41s | Isolate | Sarcophagidae |
| 237 | 3300000333 | Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony | Metagenome | Apidae |
| 238 | 3300007142 | Ant gut microbial communities from Cephalotes grandinosus, Brazil | Metagenome | Formicidae |
| 239 | 3300007149 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 4 gut | Metagenome | Drosophilidae |
| 240 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 241 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 242 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 243 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 244 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 245 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 246 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 247 | 644736334 | Candidatus Hamiltonella defensa 5AT | Isolate | Aphididae |
| 248 | 648276708 | Pantoea sp. aB | Isolate | Unclassified |
| 249 | 8001394582 | Limnobaculum allomyrinae BWR-B9 | Isolate | Scarabaeidae |
| 250 | 8006199443 | Yersinia pestis M-1763 | Isolate | Ceratophyllidae |
| 251 | 8074292191 | Tatumella sp. JGM94 | Isolate | Drosophilidae |
| 252 | 8101676404 | Providencia sp. JGM172 | Isolate | Drosophilidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0136159_1000020 | 3300010217 | Bacteria | 104555 |
| 2 | Ga0123354_10365750 | 3300010882 | Bacteria | 1265 |
| 3 | Ga0123354_10463618 | 3300010882 | Unclassified | 1015 |
| 4 | Ga0160441_105078 | 3300012825 | Bacteria | 1989 |
| 5 | Ga0265387_1000027 | 3300024582 | Bacteria | 58359 |
| 6 | Ga0247289_1569 | 3300035363 | Unclassified | 1996 |
| 7 | Ga0415639_112439 | 3300038395 | Unclassified | 4218 |
| 8 | Ga0466657_262426 | 3300042582 | Bacteria | 6201 |
| 9 | Ga0466705_501321 | 3300042612 | Unclassified | 3441 |
| 10 | gam1t_NODE_465351_length=9225_GC=33_0_Contigs=1 | 2189573031 | Unclassified | 9225 |
| 11 | 2227080778 | 2225789004 | Bacteria | 173705 |
| 12 | JGI24705J35276_12202480 | 3300002504 | Bacteria | 1638 |
| 13 | Ga0104040_1142003 | 3300007149 | Bacteria | 6100 |
| 14 | Ga0103264_1000316 | 3300007188 | Unclassified | 26505 |
| 15 | Ga0466713_148723 | 3300042602 | Bacteria | 2418 |
| 16 | Ga0466729_219015 | 3300042621 | Bacteria | 1555 |
| 17 | Ga0466735_065690 | 3300042624 | Unclassified | 1597 |
| 18 | Ga0466709_323422 | 3300042648 | Bacteria | 2823 |
| 19 | Ga0466708_121284 | 3300042652 | Bacteria | 4205 |
| 20 | Ga0466708_249944 | 3300042652 | Bacteria | 22489 |
| 21 | Ga0562379_0001 | 3300056790 | Bacteria | 4904077 |
| 22 | Ga0562374_0023 | 3300057007 | Bacteria | 1031437 |
| 23 | Ga0123353_10137890 | 3300010167 | Bacteria | 3911 |
| 24 | Ga0123353_10301284 | 3300010167 | Bacteria | 2447 |
| 25 | Ga0123354_10035599 | 3300010882 | Bacteria | 7773 |
| 26 | Ga0466710_111311 | 3300042613 | Bacteria | 5897 |
| 27 | SCG598I22_12270 | 3300000462 | Unclassified | 7568 |
| 28 | Ga0063521_1000229 | 3300003973 | Bacteria | 38732 |
| 29 | Ga0072940_1387556 | 3300005200 | Unclassified | 783 |
| 30 | Ga0103268_1018963 | 3300007192 | Bacteria | 1537 |
| 31 | Ga0127649_124997 | 3300009460 | Bacteria | 6850 |
| 32 | Ga0466719_446933 | 3300042606 | Bacteria | 1849 |
| 33 | Ga0466730_013032 | 3300042625 | Bacteria | 25136 |
| 34 | Ga0466724_52310 | 3300042649 | Bacteria | 5246 |
| 35 | Ga0562377_0037 | 3300056842 | Bacteria | 656123 |
| 36 | Ga0123353_10008760 | 3300010167 | Bacteria | 13858 |
| 37 | Ga0160457_1018182 | 3300012858 | Bacteria | 988 |
| 38 | Ga0316159_11466 | 3300030930 | Bacteria | 5516 |
| 39 | Ga0466711_207803 | 3300042615 | Bacteria | 8837 |
| 40 | CVPL005W_1000170 | 3300002934 | Bacteria | 28600 |
| 41 | CVPL005W_1007165 | 3300002934 | Unclassified | 1835 |
| 42 | Ga0068305_10053376 | 3300005083 | Bacteria | 1176 |
| 43 | Ga0466707_055425 | 3300042601 | Bacteria | 4996 |
| 44 | Ga0466713_130456 | 3300042602 | Bacteria | 105855 |
| 45 | Ga0466703_104690 | 3300042636 | Bacteria | 1019 |
| 46 | Ga0466724_45862 | 3300042649 | Unclassified | 7000 |
| 47 | Ga0466724_66289 | 3300042649 | Bacteria | 14060 |
| 48 | Ga0466705_279476 | 3300042612 | Bacteria | 26158 |
| 49 | Ga0466733_115242 | 3300042659 | Bacteria | 220013 |
| 50 | Ga0562378_0168 | 3300056814 | Bacteria | 163739 |
| 51 | Ga0160468_109029 | 3300012819 | Bacteria | 999 |
| 52 | Ga0160456_103878 | 3300012820 | Bacteria | 2116 |
| 53 | Ga0466693_003453 | 3300042592 | Bacteria | 30734 |
| 54 | Ga0466728_049548 | 3300042620 | Unclassified | 2152 |
| 55 | Ga0466729_060874 | 3300042621 | Bacteria | 5415 |
| 56 | DPOL_contig12646 | 2035918003 | Bacteria | 137161 |
| 57 | JGI24705J35276_12235733 | 3300002504 | Bacteria | 6909 |
| 58 | CVPL005W_1000180 | 3300002934 | Bacteria | 47086 |
| 59 | Ga0127656_100968 | 3300009453 | Bacteria | 23282 |
| 60 | Ga0466714_148757 | 3300042603 | Bacteria | 1745 |
| 61 | Ga0466717_058951 | 3300042604 | Bacteria | 9412 |
| 62 | Ga0466730_008747 | 3300042625 | Unclassified | 1107 |
| 63 | Ga0466730_044148 | 3300042625 | Unclassified | 29630 |
| 64 | Ga0466730_046898 | 3300042625 | Bacteria | 15167 |
| 65 | Ga0466730_059296 | 3300042625 | Bacteria | 3580 |
| 66 | Ga0466703_388021 | 3300042636 | Unclassified | 1426 |
| 67 | Ga0466704_132214 | 3300042643 | Bacteria | 1383 |
| 68 | Ga0466725_223871 | 3300042654 | Bacteria | 60893 |
| 69 | Ga0466705_234812 | 3300042612 | Bacteria | 9032 |
| 70 | Ga0466705_310155 | 3300042612 | Bacteria | 1735 |
| 71 | Ga0123353_10304535 | 3300010167 | Unclassified | 2430 |
| 72 | Ga0123353_10710947 | 3300010167 | Bacteria | 1408 |
| 73 | Ga0247290_01370 | 3300035364 | Unclassified | 2820 |
| 74 | Ga0415639_010440 | 3300038395 | Bacteria | 9959 |
| 75 | Ga0415639_076391 | 3300038395 | Unclassified | 3974 |
| 76 | Ga0466690_139022 | 3300042590 | Bacteria | 4788 |
| 77 | Ga0466695_287418 | 3300042595 | Bacteria | 15797 |
| 78 | Ga0466699_138157 | 3300042597 | Bacteria | 3617 |
| 79 | Ga0466726_246405 | 3300042619 | Bacteria | 2667 |
| 80 | WW0001_100248 | 3300002732 | Bacteria | 167261 |
| 81 | CVPL010W_10000482 | 3300002931 | Unclassified | 42008 |
| 82 | CVPL010L_1000111 | 3300002932 | Bacteria | 91591 |
| 83 | Ga0466701_018552 | 3300042598 | Bacteria | 1692 |
| 84 | Ga0466735_069531 | 3300042624 | Bacteria | 1071 |
| 85 | Ga0466704_387188 | 3300042643 | Bacteria | 1378 |
| 86 | Ga0466708_292103 | 3300042652 | Bacteria | 13018 |
| 87 | Ga0265387_1001548 | 3300024582 | Bacteria | 3362 |
| 88 | Ga0466710_060392 | 3300042613 | Bacteria | 1325 |
| 89 | Ga0466726_472460 | 3300042619 | Bacteria | 1301 |
| 90 | HBC_ctgsDRAFT_1000678 | 3300000333 | Bacteria | 7564 |
| 91 | Meta3P_1003485 | 3300002464 | Bacteria | 2712 |
| 92 | Ga0063521_1000002 | 3300003973 | Bacteria | 391466 |
| 93 | Ga0063521_1000026 | 3300003973 | Bacteria | 128736 |
| 94 | Ga0063521_1007435 | 3300003973 | Unclassified | 2604 |
| 95 | Ga0063521_1007441 | 3300003973 | Bacteria | 2603 |
| 96 | Ga0104019_1013853 | 3300007150 | Unclassified | 1091 |
| 97 | Ga0127524_118794 | 3300009478 | Unclassified | 4835 |
| 98 | Ga0466704_541097 | 3300042643 | Bacteria | 4405 |
| 99 | Ga0466709_055035 | 3300042648 | Bacteria | 13797 |
| 100 | Ga0466709_208812 | 3300042648 | Unclassified | 4486 |
| 101 | Ga0466725_391883 | 3300042654 | Bacteria | 7986 |
| 102 | Ga0466705_182173 | 3300042612 | Bacteria | 5863 |
| 103 | Ga0123356_10046732 | 3300010049 | Bacteria | 4028 |
| 104 | Ga0123353_10268492 | 3300010167 | Unclassified | 2630 |
| 105 | Ga0123353_10722788 | 3300010167 | Bacteria | 1392 |
| 106 | Ga0466692_185360 | 3300042591 | Bacteria | 7744 |
| 107 | Ga0466715_387906 | 3300042616 | Unclassified | 3413 |
| 108 | DPOL_contig17022 | 2035918003 | Bacteria | 14858 |
| 109 | JGI24703J35330_11748420 | 3300002501 | Bacteria | 15891 |
| 110 | CVPL005L_10001844 | 3300002938 | Bacteria | 72417 |
| 111 | Ga0074188_1000313 | 3300005318 | Bacteria | 52641 |
| 112 | Ga0102734_1001642 | 3300007129 | Bacteria | 5505 |
| 113 | Ga0103264_1000085 | 3300007188 | Bacteria | 60514 |
| 114 | Ga0466700_296636 | 3300042600 | Archaea | 2009 |
| 115 | Ga0466731_189209 | 3300042622 | Bacteria | 1327 |
| 116 | Ga0466730_030814 | 3300042625 | Bacteria | 5793 |
| 117 | Ga0466724_23023 | 3300042649 | Bacteria | 116535 |
| 118 | Ga0466708_121155 | 3300042652 | Bacteria | 3928 |
| 119 | Ga0562375_0243 | 3300056856 | Unclassified | 147453 |
| 120 | Ga0123357_10409051 | 3300009784 | Bacteria | 1225 |
| 121 | Ga0123353_10218629 | 3300010167 | Bacteria | 2982 |
| 122 | Ga0123354_10245414 | 3300010882 | Bacteria | 1830 |
| 123 | Ga0466726_023664 | 3300042619 | Bacteria | 1367 |
| 124 | 2211830576 | 2209111004 | Bacteria | 24643 |
| 125 | Ga0074302_1138527 | 3300005316 | Bacteria | 1329 |
| 126 | Ga0102736_1007223 | 3300007052 | Bacteria | 1335 |
| 127 | Ga0103261_1001859 | 3300007083 | Bacteria | 6035 |
| 128 | Ga0102737_1000806 | 3300007142 | Unclassified | 9680 |
| 129 | Ga0103264_1000855 | 3300007188 | Bacteria | 45110 |
| 130 | Ga0103264_1026142 | 3300007188 | Bacteria | 2757 |
| 131 | Ga0466707_108070 | 3300042601 | Bacteria | 2691 |
| 132 | Ga0466707_140984 | 3300042601 | Bacteria | 2370 |
| 133 | Ga0466707_162096 | 3300042601 | Bacteria | 2124 |
| 134 | Ga0466707_284362 | 3300042601 | Bacteria | 185230 |
| 135 | Ga0466704_531229 | 3300042643 | Bacteria | 5584 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF02441 | Flavoprotein | Flavoprotein | 31 | 202 | 0.88 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF02441 | GO:0003824 | catalytic activity | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.