Protein Family IF13092

Metagenome Isolate
222 Members
147 Samples
119 Scaffolds
381.37 Avg Length

🧬 Representative Sequence

ID
iso_pr_bacteria|2940400224|2940404965|
Length
409 aa
Sequence
LRAVHFGAGNIGRGFIGPMLSNSGYRVCFVGRNTNKITQLQGRGQYSITFANENRDSYIVDNVTAVNLGDTAEVAKEIAKAEIVTTAVGITALKDIASTLARGIELRLSNGEQSKPLHVFACENGMKSSQQLKEAVYRHLKHSCKELADRFVAFPNVMVDRIVPVQKNKDPLEILVEPFSEWVIPRSDMIGDYNEIKGAHYVDSLDPYLERKLFTVNTGHCSAAYFGYMEGYHSIQEAMSDPGIRSRVQGVLRETGSLLIHQYGFDPEVHEKYIQKMMGRFSNPNFTDTVNRVARSPLRKLSPSERLVKPAMLANELGLETTYLVLAISNALFFDDNKDQEAVVLQEAIRNQGVSEVIRTKLGIPLEHPLHFQIVRGYNKLCLQYPHMSSSGFQSMFLRIRESAPKKFS

📊 Sample Types

Isolate 46.4%
Metagenome 53.6%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 18.7%
Drosophilidae 16.4%
Kalotermitidae 9.7%
Termitidae 8.2%
Blattidae 6.7%
Scarabaeidae 6.7%
Tenebrionidae 6.0%
Apidae 5.2%
Elmidae 3.0%
Armadillidiidae 3.0%
Culicidae 2.2%
Rhinotermitidae 2.2%
Termopsidae 2.2%
Curculionidae 1.5%
Formicidae 1.5%
Passalidae 0.7%
Penaeidae 0.7%
Gomphidae 0.7%
Nephropidae 0.7%
Noctuidae 0.7%
Euphausiidae 0.7%
Calliphoridae 0.7%
Bombycidae 0.7%
Libellulidae 0.7%

🌳 Taxonomy

Archaea 0
Bacteria 201
Eukaryota 0
Viruses 0
Unclassified 21

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2523231078 Paenibacillus larvae larvae 4-309, DSM 25430 Isolate Apidae
2 2630968413 Bombilactobacillus mellifer Bin4 Isolate Unclassified
3 2940386776 Paenibacillus sp. PastF-1 Isolate Blattidae
4 2970199020 Lactiplantibacillus plantarum FlyG8.1.2 Isolate Drosophilidae
5 2977635137 Lactiplantibacillus plantarum DietG20.1.2 Isolate Unclassified
6 3300056790 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) Metagenome Tenebrionidae
7 3300056856 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) Metagenome Tenebrionidae
8 646311952 Sebaldella termitidis ATCC 33386 Isolate Unclassified
9 647533136 Enterococcus faecalis Fly1 Isolate Drosophilidae
10 8007220153 Enterococcus sp. BWB1-3 Isolate Scarabaeidae
11 8069511479 Arthrobacter ipsi IA7 Isolate Curculionidae
12 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
13 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
14 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
15 8114537524 Enterococcus sp. 12C11_DIV0727 12C11_DIV0727 Isolate
16 2684622914 Lactobacillus helsinborgensis Lb_183 Isolate Unclassified
17 2758568512 Lactobacillus helsingborgensis ESL0262 Isolate Unclassified
18 2850695442 Lactococcus allomyrinae 1JSPR-7 Isolate Scarabaeidae
19 2864909992 Bacillus velezensis S00166 Isolate Elmidae
20 2905310146 Ligilactobacillus salivarius A3iob Isolate Apidae
21 2940400224 Paenibacillus sp. PastM-2 Isolate Blattidae
22 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
23 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
24 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
25 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
26 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
27 8007215774 Enterococcus sp. BWR-S5 Isolate Scarabaeidae
28 8018794549 Enterococcus sp. 6D12_DIV0197 6D12_DIV0197 Isolate
29 8018798118 Enterococcus sp. 7D2_DIV0200 7D2_DIV0200 Isolate
30 8067987626 Agromyces larvae CFWR-12 Isolate Unclassified
31 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
32 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
33 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
34 8114555646 Enterococcus sp. DIV1094 Isolate
35 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
36 2690315820 Lactiplantibacillus plantarum WJL Isolate Drosophilidae
37 2775507073 Enterococcus sp. CR-Ec1 Isolate Unclassified
38 2836667214 Paenibacillus larvae larvae B-3650 Isolate Apidae
39 2849099867 Paenibacillus larvae larvae ERIC_I Isolate Unclassified
40 2864816158 Priestia aryabhattai S00060 Isolate Elmidae
41 2940380068 Paenibacillus sp. PastH-2 Isolate Blattidae
42 2940413413 Paenibacillus sp. PastH-3 Isolate Blattidae
43 2964739456 Lactiplantibacillus plantarum FlyG10.1.9 Isolate Drosophilidae
44 3300012858 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG Metagenome Armadillidiidae
45 8064008355 Heyndrickxia oleronia Isolate Unclassified
46 8082023105 Niallia sp. Man26 Isolate Penaeidae
47 2645727721 Lactobacillus helsingborgensis Bma5 Isolate Unclassified
48 2728369362 Lactiplantibacillus plantarum DF Isolate Drosophilidae
49 2731957677 Alkalihalobacillus trypoxylicola NBRC 102646 Isolate Scarabaeidae
50 2820518089 Unclassified Firmicutes Lab288P1bin27 Isolate Unclassified
51 2837204985 Lysinimonas sp. 2DFWR-13 Isolate Scarabaeidae
52 2878857142 Lactococcus lactis DmW198 Isolate Drosophilidae
53 2940406939 Paenibacillus sp. PastM-3 Isolate Blattidae
54 2964749277 Lactiplantibacillus plantarum FlyG20.1.4 Isolate Drosophilidae
55 2964775400 Lactiplantibacillus plantarum FlyG2.1.8 Isolate Unclassified
56 2997944163 Streptococcus penaeicida CAIM 1838 Isolate Unclassified
57 3300012846 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG Metagenome Armadillidiidae
58 3300012857 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG Metagenome Culicidae
59 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
60 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
61 641736255 Paenibacillus larvae larvae BRL-230010 Isolate Unclassified
62 8007223943 Enterococcus sp. MSG2901 Isolate
63 8018750880 Enterococcus sp. 12E11_DIV0728 12E11_DIV0728 Isolate
64 8018802046 Enterococcus sp. 7E2_DIV0204 7E2_DIV0204 Isolate Gomphidae
65 8043041867 Bacillus pumilus Ha06YP001 Isolate Nephropidae
66 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
67 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
68 2551306396 Paenibacillus sp. ICGEB2008 Isolate Noctuidae
69 2574180310 Bacillus licheniformis CG-B52 Isolate Unclassified
70 2576861701 Paenibacillus sp. JCM 10914 Isolate Termitidae
71 2740892556 Enterococcus sp. JR029-101 Isolate Unclassified
72 2770939318 Lactiplantibacillus plantarum plantarum LP2 Isolate Apidae
73 2900804455 Listeria sp. PSOL-1 Marseille-P4284 Isolate Unclassified
74 3300002501 Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 Metagenome Termitidae
75 3300007767 Drosophila gut microbial communities from New York, USA - Drosophila suzukii male 6 gut Metagenome Drosophilidae
76 3300012805 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG Metagenome
77 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
78 8002519755 Planococcus sp. MSAK28401 Isolate Euphausiidae
79 8103002986 Erwinia sp. S38 Isolate Curculionidae
80 8108568626 Enterococcus sp. DIV1094 Isolate
81 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
82 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
83 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
84 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
85 2636416028 Pelosinus propionicus DSM 13327 Isolate Unclassified
86 2820236043 Unclassified Firmicutes Th196P3bin97 Isolate Unclassified
87 2850744690 Paenibacillus larvae larvae DSM 25430 Isolate Apidae
88 2864801025 Bacillus aerius S00042 Isolate Elmidae
89 2940393498 Paenibacillus sp. PastF-2 Isolate Blattidae
90 2957623355 Lactiplantibacillus plantarum FlyG11.1.2 Isolate Drosophilidae
91 2967802344 Lactiplantibacillus plantarum FlyG11.1.6 Isolate Drosophilidae
92 2977592972 Lactiplantibacillus plantarum FlyG7.1.6 Isolate Drosophilidae
93 3300002932 Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 Metagenome Formicidae
94 3300012820 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E6 MG Metagenome Armadillidiidae
95 3300012861 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG Metagenome Culicidae
96 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
97 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
98 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
99 8002299145 Vagococcus allomyrinae BWB3-3 Isolate Scarabaeidae
100 8012942269 Mammaliicoccus lentus UD i2 Isolate Tenebrionidae
101 8077780672 Enterococcus sp. PLM3 Isolate Formicidae
102 8114544644 Enterococcus sp. 9E7_DIV0242 9E7_DIV0242 Isolate
103 2209111004 Macrotermes natalensis queen gut microbiome Metagenome Termitidae
104 2576861670 Lactiplantibacillus plantarum WJL Isolate Drosophilidae
105 2849104611 Paenibacillus larvae larvae Eric_IV Isolate Apidae
106 2851410423 Lactobacillus helsingborgensis ESL0183 Isolate Apidae
107 2852431164 Brevibacillus laterosporus BON707 Isolate Calliphoridae
108 2884613238 Agromyces intestinalis KACC 19306 Isolate Scarabaeidae
109 2940419646 Paenibacillus sp. PastF-4 Isolate Blattidae
110 2960772748 Lactiplantibacillus plantarum MHO2.9 Isolate
111 2964765680 Lactiplantibacillus plantarum MHO2.5 Isolate
112 2937236879 Lactiplantibacillus plantarum MHO2.4 Isolate
113 2967825073 Lactiplantibacillus plantarum FlyG9.1.4 Isolate Drosophilidae
114 2970254690 Lactiplantibacillus plantarum FlyG9.2.5 Isolate Drosophilidae
115 2977596371 Lactiplantibacillus plantarum FlyG11.2.6 Isolate Drosophilidae
116 2977622177 Lactiplantibacillus plantarum FlyG20.2.6 Isolate Drosophilidae
117 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
118 3300056564 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) Metagenome Tenebrionidae
119 3300056814 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) Metagenome Tenebrionidae
120 3300056857 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) Metagenome Tenebrionidae
121 3300057007 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) Metagenome Tenebrionidae
122 8018754795 Enterococcus sp. 12F9_DIV0723 12F9_DIV0723 Isolate
123 8038268975 Enterococcus mundtii EM01 Isolate Bombycidae
124 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
125 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
126 8114541043 Enterococcus sp. 7F3_DIV0205 7F3_DIV0205 Isolate Libellulidae
127 2597490293 Lactiplantibacillus plantarum DmCS_001 Isolate Drosophilidae
128 2718218475 Lactiplantibacillus plantarum KP Isolate Drosophilidae
129 2791355481 Bacillus sp. ZY-1-1 Isolate Scarabaeidae
130 2834951433 Brochothrix thermosphacta CD 337 Isolate Unclassified
131 2864895409 Bacillus aerius S00152 Isolate Elmidae
132 2902668162 Lacticaseibacillus paracasei DmW_181 Isolate Drosophilidae
133 2916858470 Heyndrickxia oleronia Isolate Unclassified
134 2940221333 Paenibacillus sp. PastF-3 Isolate Blattidae
135 2940425923 Paenibacillus sp. PastH-4 Isolate Blattidae
136 2964778705 Lactiplantibacillus plantarum DietG20.2.2_EE Isolate Unclassified
137 2970225615 Lactiplantibacillus plantarum FlyG8.1.1 Isolate Drosophilidae
138 2977628635 Lactiplantibacillus plantarum FlyG3.1.8 Isolate Drosophilidae
139 2977653127 Lactiplantibacillus plantarum FlyG10.1.5 Isolate Drosophilidae
140 2983866074 Paenibacillus polymyxa A18 Isolate Unclassified
141 3300002508 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 Metagenome Termitidae
142 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
143 3300012837 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG Metagenome Armadillidiidae
144 3300012849 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG Metagenome Culicidae
145 8007211731 Enterococcus larvae BWM-S5 Isolate Scarabaeidae
146 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
147 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0530661_004057 3300056564 Bacteria 4586
2 Ga0562377_0036 3300056842 Bacteria 678424
3 Ga0562374_2251 3300057007 Bacteria 17822
4 Ga0466735_044551 3300042624 Bacteria 5318
5 Ga0466704_174434 3300042643 Bacteria 2455
6 Ga0466704_604067 3300042643 Bacteria 2777
7 Ga0466700_123601 3300042600 Bacteria 6890
8 Ga0466713_093323 3300042602 Unclassified 34741
9 Ga0466723_091406 3300042618 Bacteria 3161
10 Ga0466723_176770 3300042618 Bacteria 5741
11 Ga0466691_069497 3300042593 Bacteria 12623
12 2211830569 2209111004 Bacteria 13650
13 JGI24703J35330_11652747 3300002501 Bacteria 1608
14 Ga0466733_188876 3300042659 Bacteria 10934
15 Ga0562379_0171 3300056790 Bacteria 192504
16 Ga0562379_3403 3300056790 Unclassified 10541
17 Ga0562379_3812 3300056790 Bacteria 9021
18 Ga0562377_0114 3300056842 Unclassified 258244
19 Ga0466731_409311 3300042622 Bacteria 8920
20 Ga0466703_103652 3300042636 Bacteria 1666
21 Ga0466726_196423 3300042619 Bacteria 10516
22 Ga0160456_103803 3300012820 Bacteria 2164
23 Ga0160435_1010944 3300012857 Unclassified 1865
24 Ga0466696_020457 3300042596 Bacteria 3395
25 Ga0466696_176667 3300042596 Bacteria 2375
26 Ga0466733_125516 3300042659 Bacteria 41402
27 Ga0562378_0032 3300056814 Bacteria 502759
28 Ga0562377_0078 3300056842 Bacteria 380003
29 Ga0562377_1255 3300056842 Unclassified 28362
30 Ga0562376_0219 3300056857 Bacteria 115439
31 Ga0562374_0014 3300057007 Bacteria 1241908
32 Ga0562374_0018 3300057007 Bacteria 1182001
33 Ga0466730_050878 3300042625 Bacteria 31540
34 Ga0466727_257150 3300042655 Bacteria 2536
35 Ga0466716_101571 3300042605 Bacteria 5353
36 Ga0466711_153149 3300042615 Bacteria 4567
37 Ga0456237_0005595 3300041968 Unclassified 1988
38 Ga0466690_100897 3300042590 Bacteria 7404
39 Ga0466696_191314 3300042596 Bacteria 1416
40 Ga0466733_194812 3300042659 Bacteria 9077
41 Ga0562376_0005 3300056857 Bacteria 2173693
42 Ga0562374_0107 3300057007 Bacteria 221596
43 Ga0562374_0903 3300057007 Unclassified 41174
44 Ga0466704_185539 3300042643 Bacteria 10589
45 Ga0466704_319240 3300042643 Bacteria 6492
46 Ga0466704_493946 3300042643 Bacteria 4735
47 Ga0466716_116772 3300042605 Bacteria 5315
48 Ga0466716_309051 3300042605 Bacteria 4374
49 Ga0466726_346119 3300042619 Bacteria 3652
50 Ga0160457_1001769 3300012858 Bacteria 5387
51 Ga0466696_029384 3300042596 Bacteria 7706
52 JGI24703J35330_11748070 3300002501 Bacteria 10392
53 Ga0068305_10003003 3300005083 Bacteria 8118
54 Ga0466705_101400 3300042612 Unclassified 1906
55 Ga0530661_000396 3300056564 Bacteria 32681
56 Ga0562377_0117 3300056842 Unclassified 248603
57 Ga0562377_0245 3300056842 Bacteria 125870
58 Ga0466734_063529 3300042623 Bacteria 2316
59 Ga0466730_068269 3300042625 Unclassified 4100
60 Ga0466700_205252 3300042600 Bacteria 5858
61 Ga0466711_121655 3300042615 Unclassified 4615
62 Ga0160455_102507 3300012837 Bacteria 3730
63 Ga0466690_059040 3300042590 Bacteria 3648
64 Ga0466691_039775 3300042593 Bacteria 18301
65 Ga0466696_265296 3300042596 Bacteria 2352
66 Ga0530661_000139 3300056564 Bacteria 64402
67 Ga0562379_0005 3300056790 Bacteria 2649770
68 Ga0562379_1867 3300056790 Bacteria 20780
69 Ga0562377_0641 3300056842 Bacteria 52294
70 Ga0562375_0047 3300056856 Bacteria 487855
71 Ga0562374_0006 3300057007 Bacteria 2178283
72 Ga0562374_0185 3300057007 Bacteria 135768
73 Ga0562374_0861 3300057007 Unclassified 42570
74 Ga0466704_448360 3300042643 Bacteria 2421
75 Ga0466724_46451 3300042649 Bacteria 19110
76 Ga0466719_172481 3300042606 Bacteria 1865
77 Ga0466722_156221 3300042609 Bacteria 7381
78 Ga0466705_404958 3300042612 Unclassified 4633
79 Ga0466723_253564 3300042618 Bacteria 4785
80 Ga0160455_102118 3300012837 Bacteria 4536
81 Ga0160433_104867 3300012846 Bacteria 2096
82 Ga0160436_1000942 3300012861 Bacteria 8858
83 Ga0466690_169267 3300042590 Bacteria 1996
84 2227294681 2225789004 Unclassified 6667
85 CVPL010L_1000026 3300002932 Unclassified 70666
86 CVPL010L_1000060 3300002932 Unclassified 124006
87 Ga0105553_1198926 3300007767 Bacteria 2490
88 Ga0562375_0014 3300056856 Bacteria 1185783
89 Ga0562375_0048 3300056856 Bacteria 473654
90 Ga0466702_115861 3300042635 Bacteria 32387
91 Ga0466703_173650 3300042636 Bacteria 11061
92 Ga0466704_305982 3300042643 Bacteria 11763
93 Ga0466709_086341 3300042648 Bacteria 317133
94 Ga0466727_015733 3300042655 Bacteria 7079
95 Ga0466719_108632 3300042606 Bacteria 6011
96 Ga0160464_100450 3300012805 Bacteria 30731
97 Ga0466726_096186 3300042619 Bacteria 1557
98 Ga0466726_210991 3300042619 Bacteria 1476
99 Ga0466728_317213 3300042620 Bacteria 15205
100 Ga0160447_116190 3300012849 Bacteria 1349
101 Ga0466690_084901 3300042590 Bacteria 3129
102 Ga0466690_102806 3300042590 Bacteria 5570
103 Ga0466692_026770 3300042591 Unclassified 14133
104 Ga0466692_165243 3300042591 Bacteria 12927
105 Ga0466691_098987 3300042593 Bacteria 12660
106 JGI24700J35501_10912853 3300002508 Unclassified 3714
107 Ga0466705_296380 3300042612 Bacteria 8439
108 Ga0562379_0474 3300056790 Unclassified 82932
109 Ga0562379_1439 3300056790 Unclassified 27197
110 Ga0562379_2122 3300056790 Unclassified 17955
111 Ga0562377_0005 3300056842 Bacteria 3519381
112 Ga0562375_0025 3300056856 Bacteria 749171
113 Ga0466704_088464 3300042643 Bacteria 2610
114 Ga0466727_100661 3300042655 Bacteria 2349
115 Ga0466719_124282 3300042606 Bacteria 55942
116 Ga0466715_011806 3300042616 Bacteria 6398
117 Ga0456237_0002057 3300041968 Bacteria 3246
118 Ga0466690_351443 3300042590 Bacteria 2129
119 Ga0068305_10470918 3300005083 Bacteria 3423

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042618 Ga0466723_091406 Ga0466723_091406_1544_2704 343
2 3300012858 Ga0160457_1001769 Ga0160457_10017693 350
3 3300042609 Ga0466722_156221 Ga0466722_156221_1758_2921 351
4 3300042605 Ga0466716_309051 Ga0466716_309051_2144_3307 352
5 3300042612 Ga0466705_404958 Ga0466705_404958_800_1978 352
6 3300042615 Ga0466711_121655 Ga0466711_121655_2616_3773 353
7 3300042615 Ga0466711_153149 Ga0466711_153149_3036_4184 356
8 3300056790 Ga0562379_0474 Ga0562379_0474_9170_10318 357
9 3300056790 Ga0562379_3403 Ga0562379_3403_3337_4485 357
10 3300056790 Ga0562379_3812 Ga0562379_3812_1818_2966 357
11 3300042590 Ga0466690_100897 Ga0466690_100897_3502_4671 358
12 3300042636 Ga0466703_173650 Ga0466703_173650_4634_5800 358
13 3300012805 Ga0160464_100450 Ga0160464_10045028 363
14 3300042612 Ga0466705_296380 Ga0466705_296380_2638_3813 364
15 3300012857 Ga0160435_1010944 Ga0160435_10109441 367
16 3300012861 Ga0160436_1000942 Ga0160436_10009426 367
17 3300042643 Ga0466704_319240 Ga0466704_319240_2692_3858 367
18 3300042593 Ga0466691_069497 Ga0466691_069497_8324_9493 368
19 3300056790 Ga0562379_1867 Ga0562379_1867_4041_5147 368
20 3300042605 Ga0466716_101571 Ga0466716_101571_1190_2362 371
21 3300005083 Ga0068305_10003003 Ga0068305_100030036 372
22 3300042619 Ga0466726_346119 Ga0466726_346119_2210_3343 372
23 3300056814 Ga0562378_0032 Ga0562378_0032_134900_136018 372
24 iso_pr_bacteria 8012942269 8012945116 372
25 2209111004 2211830569 2211865900 373
26 3300042620 Ga0466728_317213 Ga0466728_317213_252_1373 373
27 iso_pr_bacteria 2791355481 2794422661 373
28 iso_pr_bacteria 2864801025 2864804249 373
29 iso_pr_bacteria 2864895409 2864898631 373
30 iso_pr_bacteria 2864909992 2864913614 373
31 iso_pr_bacteria 8043041867 8043044947 373
32 iso_pr_bacteria 2834951433 2834954051 375
33 3300042596 Ga0466696_265296 Ga0466696_265296_586_1734 376
34 3300042655 Ga0466727_257150 Ga0466727_257150_214_1344 376
35 3300042643 Ga0466704_185539 Ga0466704_185539_3849_5021 377
36 3300042655 Ga0466727_100661 Ga0466727_100661_317_1450 377
37 iso_pr_bacteria 2837204985 2837205373 377
38 3300042600 Ga0466700_123601 Ga0466700_123601_5212_6363 378
39 3300012820 Ga0160456_103803 Ga0160456_1038032 379
40 3300042606 Ga0466719_172481 Ga0466719_172481_541_1719 379
41 3300042619 Ga0466726_096186 Ga0466726_096186_319_1458 379
42 3300042619 Ga0466726_210991 Ga0466726_210991_238_1377 379
43 3300042635 Ga0466702_115861 Ga0466702_115861_25909_27048 379
44 3300056564 Ga0530661_000396 Ga0530661_000396_31388_32527 379
45 3300056564 Ga0530661_004057 Ga0530661_004057_920_2059 379
46 3300056790 Ga0562379_1439 Ga0562379_1439_6760_7899 379
47 3300056790 Ga0562379_2122 Ga0562379_2122_3590_4729 379
48 3300056842 Ga0562377_0036 Ga0562377_0036_345729_346868 379
49 3300056842 Ga0562377_0114 Ga0562377_0114_210212_211351 379
50 3300056842 Ga0562377_0117 Ga0562377_0117_145365_146504 379
51 3300056842 Ga0562377_0641 Ga0562377_0641_2101_3240 379
52 3300056856 Ga0562375_0014 Ga0562375_0014_361460_362599 379
53 3300057007 Ga0562374_0018 Ga0562374_0018_93721_94860 379
54 iso_pr_bacteria 2574180310 2576359838 379
55 iso_pr_bacteria 8018750880 8018751215 379
56 iso_pr_bacteria 8018754795 8018757158 379
57 3300012837 Ga0160455_102507 Ga0160455_1025072 380
58 3300041968 Ga0456237_0005595 Ga0456237_0005595_223_1365 380
59 3300042591 Ga0466692_165243 Ga0466692_165243_10933_12075 380
60 3300056564 Ga0530661_000139 Ga0530661_000139_45867_47009 380
61 3300056856 Ga0562375_0047 Ga0562375_0047_60723_61865 380
62 3300056856 Ga0562375_0048 Ga0562375_0048_56422_57564 380
63 3300057007 Ga0562374_0861 Ga0562374_0861_30553_31695 380
64 3300057007 Ga0562374_0903 Ga0562374_0903_5077_6219 380
65 iso_pr_bacteria 2864816158 2864822162 380
66 iso_pr_bacteria 2900804455 2900806037 380
67 iso_pr_bacteria 2916858470 2916859350 380
68 iso_pr_bacteria 8064008355 8064013220 380
69 3300002501 JGI24703J35330_11652747 JGI24703J35330_116527472 381
70 3300012846 Ga0160433_104867 Ga0160433_1048671 381
71 3300042619 Ga0466726_196423 Ga0466726_196423_2865_4010 381
72 3300042643 Ga0466704_604067 Ga0466704_604067_1574_2719 381
73 3300042655 Ga0466727_015733 Ga0466727_015733_992_2137 381
74 3300056842 Ga0562377_0078 Ga0562377_0078_164721_165866 381
75 3300057007 Ga0562374_0014 Ga0562374_0014_324008_325153 381
76 iso_pr_bacteria 2551306396 2552921412 381
77 iso_pr_bacteria 2731957677 2732688202 381
78 iso_pr_bacteria 2940380068 2940382700 381
79 iso_pr_bacteria 2940386776 2940389412 381
80 iso_pr_bacteria 2940393498 2940396128 381
81 iso_pr_bacteria 2940400224 2940402940 381
82 iso_pr_bacteria 2940406939 2940409387 381
83 iso_pr_bacteria 2983866074 2983867458 381
84 iso_pr_bacteria 646311952 646430442 381
85 3300042590 Ga0466690_169267 Ga0466690_169267_199_1347 382
86 3300042596 Ga0466696_029384 Ga0466696_029384_2845_3993 382
87 3300042618 Ga0466723_176770 Ga0466723_176770_1517_2665 382
88 3300042623 Ga0466734_063529 Ga0466734_063529_430_1578 382
89 3300042643 Ga0466704_088464 Ga0466704_088464_1073_2221 382
90 3300042643 Ga0466704_174434 Ga0466704_174434_512_1660 382
91 3300042643 Ga0466704_493946 Ga0466704_493946_1605_2753 382
92 3300056790 Ga0562379_0005 Ga0562379_0005_1887439_1888587 382
93 3300057007 Ga0562374_0107 Ga0562374_0107_179565_180713 382
94 iso_pr_bacteria 2523231078 2523496813 382
95 iso_pr_bacteria 2645727721 2646683811 382
96 iso_pr_bacteria 2684622914 2686078573 382
97 iso_pr_bacteria 2758568512 2760263256 382
98 iso_pr_bacteria 2775507073 2777019334 382
99 iso_pr_bacteria 2820518089 2820518587 382
100 iso_pr_bacteria 2836667214 2836671935 382
101 iso_pr_bacteria 2849099867 2849104050 382
102 iso_pr_bacteria 2849104611 2849105190 382
103 iso_pr_bacteria 2851410423 2851410746 382
104 iso_pr_bacteria 2852431164 2852431839 382
105 iso_pr_bacteria 2905310146 2905310552 382
106 iso_pr_bacteria 2940221333 2940224652 382
107 iso_pr_bacteria 2997944163 2997945053 382
108 iso_pr_bacteria 641736255 641740989 382
109 iso_pr_bacteria 8007211731 8007215660 382
110 iso_pr_bacteria 8007215774 8007219593 382
111 iso_pr_bacteria 8018794549 8018794656 382
112 iso_pr_bacteria 8082023105 8082023390 382
113 iso_pr_bacteria 8114544644 8114548643 382
114 3300012837 Ga0160455_102118 Ga0160455_1021183 383
115 3300042590 Ga0466690_351443 Ga0466690_351443_386_1555 383
116 3300042600 Ga0466700_205252 Ga0466700_205252_3182_4333 383
117 3300042612 Ga0466705_101400 Ga0466705_101400_338_1489 383
118 3300042625 Ga0466730_068269 Ga0466730_068269_26_1177 383
119 3300042636 Ga0466703_103652 Ga0466703_103652_185_1336 383
120 3300042643 Ga0466704_448360 Ga0466704_448360_257_1408 383
121 3300042649 Ga0466724_46451 Ga0466724_46451_4111_5262 383
122 3300056842 Ga0562377_0005 Ga0562377_0005_2497993_2499144 383
123 3300056857 Ga0562376_0005 Ga0562376_0005_1197240_1198391 383
124 3300056857 Ga0562376_0219 Ga0562376_0219_13918_15069 383
125 3300057007 Ga0562374_0006 Ga0562374_0006_2013544_2014695 383
126 3300057007 Ga0562374_0185 Ga0562374_0185_54505_55656 383
127 iso_pr_bacteria 8002299145 8002302658 383
128 iso_pr_bacteria 8007223943 8007225924 383
129 iso_pr_bacteria 8018798118 8018799636 383
130 iso_pr_bacteria 8018802046 8018804439 383
131 iso_pr_bacteria 8038268975 8038271948 383
132 iso_pr_bacteria 8103002986 8103005762 383
133 iso_pr_bacteria 8108568626 8108569228 383
134 iso_pr_bacteria 8114537524 8114538691 383
135 iso_pr_bacteria 8114541043 8114544596 383
136 iso_pr_bacteria 8114555646 8114556248 383
137 3300002501 JGI24703J35330_11748070 JGI24703J35330_117480705 384
138 3300007767 Ga0105553_1198926 Ga0105553_11989261 384
139 3300056790 Ga0562379_0171 Ga0562379_0171_90366_91520 384
140 3300056856 Ga0562375_0025 Ga0562375_0025_479160_480314 384
141 iso_pr_bacteria 2740892556 2743949402 384
142 iso_pr_bacteria 2820236043 2820237995 384
143 iso_pr_bacteria 2850695442 2850697610 384
144 iso_pr_bacteria 2902668162 2902669815 384
145 iso_pr_bacteria 647533136 647746313 384
146 iso_pr_bacteria 8007220153 8007222785 384
147 iso_pr_bacteria 8077780672 8077781053 384
148 2225789004 2227294681 2227745200 385
149 3300002508 JGI24700J35501_10912853 JGI24700J35501_109128531 385
150 3300002932 CVPL010L_1000026 CVPL010L_100002629 385
151 3300042602 Ga0466713_093323 Ga0466713_093323_302_1459 385
152 3300042625 Ga0466730_050878 Ga0466730_050878_10457_11614 385
153 3300042648 Ga0466709_086341 Ga0466709_086341_32450_33607 385
154 3300042659 Ga0466733_125516 Ga0466733_125516_10622_11779 385
155 3300056842 Ga0562377_0245 Ga0562377_0245_119451_120608 385
156 3300056842 Ga0562377_1255 Ga0562377_1255_9867_11024 385
157 3300057007 Ga0562374_2251 Ga0562374_2251_2974_4131 385
158 iso_pr_bacteria 2576861670 2579167359 385
159 iso_pr_bacteria 2597490293 2598964648 385
160 iso_pr_bacteria 2630968413 2631703780 385
161 iso_pr_bacteria 2690315820 2691199811 385
162 iso_pr_bacteria 2718218475 2721606596 385
163 iso_pr_bacteria 2728369362 2730149456 385
164 iso_pr_bacteria 2770939318 2771019305 385
165 iso_pr_bacteria 2850744690 2850748504 385
166 iso_pr_bacteria 2878857142 2878857620 385
167 iso_pr_bacteria 2884613238 2884615793 385
168 iso_pr_bacteria 2937236879 2937239207 385
169 iso_pr_bacteria 2957623355 2957624844 385
170 iso_pr_bacteria 2960772748 2960773507 385
171 iso_pr_bacteria 2964739456 2964740942 385
172 iso_pr_bacteria 2964749277 2964751280 385
173 iso_pr_bacteria 2964765680 2964768395 385
174 iso_pr_bacteria 2964775400 2964776719 385
175 iso_pr_bacteria 2964778705 2964780048 385
176 iso_pr_bacteria 2967802344 2967803993 385
177 iso_pr_bacteria 2967825073 2967827313 385
178 iso_pr_bacteria 2970199020 2970200507 385
179 iso_pr_bacteria 2970225615 2970227143 385
180 iso_pr_bacteria 2970254690 2970256161 385
181 iso_pr_bacteria 2977592972 2977594505 385
182 iso_pr_bacteria 2977596371 2977598199 385
183 iso_pr_bacteria 2977622177 2977622674 385
184 iso_pr_bacteria 2977628635 2977630020 385
185 iso_pr_bacteria 2977635137 2977636581 385
186 iso_pr_bacteria 2977653127 2977653249 385
187 3300002932 CVPL010L_1000060 CVPL010L_1000060124 386
188 3300041968 Ga0456237_0002057 Ga0456237_0002057_15_1175 386
189 3300042591 Ga0466692_026770 Ga0466692_026770_4050_5210 386
190 3300042596 Ga0466696_020457 Ga0466696_020457_1197_2357 386
191 3300042606 Ga0466719_124282 Ga0466719_124282_24446_25606 386
192 3300042624 Ga0466735_044551 Ga0466735_044551_268_1428 386
193 iso_pr_bacteria 8067987626 8067989726 386
194 3300042590 Ga0466690_102806 Ga0466690_102806_2014_3177 387
195 3300042593 Ga0466691_039775 Ga0466691_039775_13756_14919 387
196 iso_pr_bacteria 2636416028 2638992620 387
197 iso_pr_bacteria 8069511479 8069512246 387
198 3300012849 Ga0160447_116190 Ga0160447_1161902 388
199 3300042593 Ga0466691_098987 Ga0466691_098987_1744_2910 388
200 3300042606 Ga0466719_108632 Ga0466719_108632_4689_5855 388
201 3300042618 Ga0466723_253564 Ga0466723_253564_769_1935 388
202 3300042590 Ga0466690_059040 Ga0466690_059040_1679_2848 389
203 3300042622 Ga0466731_409311 Ga0466731_409311_3815_4984 389
204 iso_pr_bacteria 2576861701 2579270044 389
205 3300042590 Ga0466690_084901 Ga0466690_084901_1543_2715 390
206 3300042605 Ga0466716_116772 Ga0466716_116772_2125_3297 390
207 3300042616 Ga0466715_011806 Ga0466715_011806_2660_3832 390
208 3300042659 Ga0466733_194812 Ga0466733_194812_520_1692 390
209 3300042643 Ga0466704_305982 Ga0466704_305982_7471_8646 391
210 3300005083 Ga0068305_10470918 Ga0068305_104709183 393
211 3300042659 Ga0466733_188876 Ga0466733_188876_860_2041 393
212 3300042596 Ga0466696_176667 Ga0466696_176667_1141_2325 394
213 3300042596 Ga0466696_191314 Ga0466696_191314_141_1337 398
214 iso_pr_bacteria 2940413413 2940414404 401
215 iso_pr_bacteria 2940419646 2940420804 401
216 iso_pr_bacteria 2940425923 2940427076 401
217 iso_pr_bacteria 8002519755 8002522439 401
218 iso_pr_bacteria 2940380068 2940384815 409
219 iso_pr_bacteria 2940386776 2940391460 409
220 iso_pr_bacteria 2940393498 2940398233 409
221 iso_pr_bacteria 2940400224 2940404965 409
222 iso_pr_bacteria 2940406939 2940411486 409

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01232 Mannitol_dh Mannitol dehydrogenase Rossmann domain 2 192 0.95
PF08125 Mannitol_dh_C Mannitol dehydrogenase C-terminal domain 205 346 0.93

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF01232 GO:0016491 oxidoreductase activity MF

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.89 0.91 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.