Protein Family IF13089
Metagenome
Isolate
151
Members
75
Samples
115
Scaffolds
390.49
Avg Length
Representative Sequence
- ID
- iso_pr_bacteria|2940371297|2940373263|
- Length
- 424 aa
- Sequence
- MRFGNIGCCLNKFGAALSFHYIYPRKNLIHNTTRMEKTWRWFGKKDKITLDMLRQIGVEGIVTALHDIPNGEIWPSEAILDLKGYIEKAGLRWSVVESLPVSEAIKYGGEERDQLIENYKISLANLGKAGIKTVCYNFMPVIDWIRTDLNKKNPDGTYTLYFDKIRFAYFDCFILQREGAEKDYTKEEMEDVYALDKVITTAEKEELIHTIIVKTQGFINGNIQEGDKAPVALFNRLLTLYKGIDKMQLRAHMKYFLKQVIPTAEEYGVNLCVHPDDPPFPVLGLPRIVTSAEDIDWFLKAVDSPNNGLTFCAGSLSAGLHNDVPVLAERFAQRTHFVHLRSTDVYENGNFIEASHLGGRGRLIDLIRIFEKENPALPMRVDHGKLMLGDGDKEYNPGYSFLGRMYALAQVDGMMAVVKDELTT
Sample Types
Isolate
23.8%
Metagenome
76.2%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Blattidae
36.0%
Kalotermitidae
17.3%
Termitidae
17.3%
Unclassified
14.7%
Termopsidae
5.3%
Rhinotermitidae
5.3%
Passalidae
2.7%
Hodotermitidae
1.3%
Taxonomy
Archaea
0
Bacteria
148
Eukaryota
0
Viruses
0
Unclassified
3
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820757377 | Unclassified Bacteroidetes Mp193P4bin6 | Isolate | Unclassified |
| 2 | 2940199050 | Parabacteroides sp. PM6-13 | Isolate | Blattidae |
| 3 | 2940371297 | Parabacteroides sp. PM5-20 | Isolate | Blattidae |
| 4 | 2967483437 | Candidatus Ordinivivax streblomastigis St1 | Isolate | Unclassified |
| 5 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 6 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 7 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 8 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 9 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 10 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 11 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 12 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 13 | 2940248789 | Dysgonomonas sp. PF1-16 | Isolate | Blattidae |
| 14 | 2940346213 | Parabacteroides sp. PFB2-12 | Isolate | Blattidae |
| 15 | 2820740053 | Unclassified Bacteroidetes Th196P3bin81 | Isolate | Unclassified |
| 16 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 17 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 18 | 2940209341 | Parabacteroides sp. PFB2-10 | Isolate | Blattidae |
| 19 | 2940298504 | Parabacteroides sp. PF5-13 | Isolate | Blattidae |
| 20 | 2820736622 | Unclassified Bacteroidetes Th196P4bin26 | Isolate | Unclassified |
| 21 | 3004667792 | Bacteroides sp. 519 | Isolate | Blattidae |
| 22 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 23 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 24 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 25 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 26 | 2820759988 | Unclassified Bacteroidetes Mp193P4bin4 | Isolate | Unclassified |
| 27 | 2910959314 | Dysgonomonas sp. 511 | Isolate | Blattidae |
| 28 | 2923982719 | Parabacteroides sp. 52 | Isolate | Blattidae |
| 29 | 2940306115 | Parabacteroides sp. PFB2-22 | Isolate | Blattidae |
| 30 | 2940309933 | Parabacteroides sp. PH5-13 | Isolate | Blattidae |
| 31 | 2940328985 | Parabacteroides sp. PH5-46 | Isolate | Blattidae |
| 32 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 33 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 34 | 8100157865 | Dysgonomonas sp. GY617 | Isolate | Rhinotermitidae |
| 35 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 36 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 37 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 38 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 39 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 40 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 41 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 42 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 43 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 44 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 45 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 46 | 2940205530 | Parabacteroides sp. PH5-33 | Isolate | Blattidae |
| 47 | 2940317558 | Parabacteroides sp. PH5-26 | Isolate | Blattidae |
| 48 | 2940325180 | Parabacteroides sp. PH5-41 | Isolate | Blattidae |
| 49 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 50 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 51 | 2922326829 | Bacteroides sp. 224 | Isolate | Blattidae |
| 52 | 2940253009 | Dysgonomonas sp. PF1-23 | Isolate | Blattidae |
| 53 | 2940257232 | Dysgonomonas sp. PFB1-18 | Isolate | Blattidae |
| 54 | 2940313741 | Parabacteroides sp. PH5-17 | Isolate | Blattidae |
| 55 | 2695420317 | Dysgonomonas sp. HGC4 | Isolate | Unclassified |
| 56 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 57 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 58 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 59 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 60 | 2820778767 | Unclassified Bacteroidetes Emb289P4bin10 | Isolate | Unclassified |
| 61 | 2910930387 | Dysgonomonas sp. 216 | Isolate | Blattidae |
| 62 | 2910942425 | Dysgonomonas sp. 521 | Isolate | Blattidae |
| 63 | 2940212447 | Parabacteroides sp. PH5-16 | Isolate | Blattidae |
| 64 | 2940244548 | Dysgonomonas sp. PF1-14 | Isolate | Blattidae |
| 65 | 2940302308 | Parabacteroides sp. PF5-5 | Isolate | Blattidae |
| 66 | 2940321370 | Parabacteroides sp. PH5-39 | Isolate | Blattidae |
| 67 | 2940332795 | Parabacteroides sp. PH5-8 | Isolate | Blattidae |
| 68 | 3004672520 | Bacteroides sp. 51 | Isolate | Blattidae |
| 69 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 70 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 71 | 643348524 | Candidatus Azobacteroides pseudotrichonymphae gv. CFP2 | Isolate | Unclassified |
| 72 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 73 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 74 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 75 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_021460 | 3300042612 | Bacteria | 3296 |
| 2 | JGI24699J35502_11134220 | 3300002509 | Bacteria | 66991 |
| 3 | Ga0123357_10002435 | 3300009784 | Bacteria | 20755 |
| 4 | Ga0466735_212764 | 3300042624 | Bacteria | 10218 |
| 5 | Ga0466703_016865 | 3300042636 | Bacteria | 1572 |
| 6 | Ga0466708_005632 | 3300042652 | Bacteria | 3320 |
| 7 | Ga0466728_304435 | 3300042620 | Bacteria | 29742 |
| 8 | Ga0466690_169144 | 3300042590 | Bacteria | 7027 |
| 9 | Ga0466695_009046 | 3300042595 | Bacteria | 2641 |
| 10 | Ga0466701_040912 | 3300042598 | Bacteria | 7277 |
| 11 | Ga0466706_133883 | 3300042599 | Bacteria | 39086 |
| 12 | Ga0466700_395184 | 3300042600 | Bacteria | 3056 |
| 13 | Ga0466713_029853 | 3300042602 | Bacteria | 6416 |
| 14 | Ga0466716_131519 | 3300042605 | Bacteria | 4274 |
| 15 | Ga0466716_219652 | 3300042605 | Bacteria | 15271 |
| 16 | IMNBL1DRAFT_c0006729 | 3300000062 | Bacteria | 6219 |
| 17 | JGI24702J35022_10001817 | 3300002462 | Bacteria | 13141 |
| 18 | JGI24696J40584_12959432 | 3300002834 | Bacteria | 5115 |
| 19 | Ga0466735_033476 | 3300042624 | Bacteria | 3513 |
| 20 | Ga0466735_082363 | 3300042624 | Bacteria | 5286 |
| 21 | Ga0466703_078920 | 3300042636 | Bacteria | 4861 |
| 22 | Ga0466704_049130 | 3300042643 | Bacteria | 3940 |
| 23 | Ga0466711_044951 | 3300042615 | Bacteria | 14666 |
| 24 | Ga0466715_621075 | 3300042616 | Bacteria | 61945 |
| 25 | Ga0466690_051249 | 3300042590 | Bacteria | 12685 |
| 26 | Ga0466690_051806 | 3300042590 | Bacteria | 3984 |
| 27 | Ga0466691_080653 | 3300042593 | Bacteria | 3448 |
| 28 | Ga0466696_372942 | 3300042596 | Bacteria | 2743 |
| 29 | Ga0466706_044418 | 3300042599 | Bacteria | 19614 |
| 30 | Ga0466707_276019 | 3300042601 | Bacteria | 6460 |
| 31 | Ga0466713_040492 | 3300042602 | Unclassified | 7027 |
| 32 | Ga0466716_243469 | 3300042605 | Bacteria | 3602 |
| 33 | Ga0466722_020309 | 3300042609 | Bacteria | 4420 |
| 34 | Ga0466722_205061 | 3300042609 | Bacteria | 22162 |
| 35 | Ga0466697_096879 | 3300042611 | Bacteria | 330838 |
| 36 | Ga0466705_311279 | 3300042612 | Bacteria | 23151 |
| 37 | Ga0466703_105441 | 3300042636 | Bacteria | 5474 |
| 38 | Ga0466704_333463 | 3300042643 | Bacteria | 15938 |
| 39 | Ga0466709_032551 | 3300042648 | Bacteria | 8337 |
| 40 | Ga0466708_195474 | 3300042652 | Bacteria | 6461 |
| 41 | Ga0466692_145660 | 3300042591 | Bacteria | 2359 |
| 42 | Ga0466691_035208 | 3300042593 | Bacteria | 19307 |
| 43 | Ga0466691_189486 | 3300042593 | Bacteria | 2096 |
| 44 | Ga0466691_214494 | 3300042593 | Bacteria | 20188 |
| 45 | Ga0466706_272316 | 3300042599 | Bacteria | 5024 |
| 46 | Ga0466722_085264 | 3300042609 | Bacteria | 7063 |
| 47 | 2227275242 | 2225789004 | Bacteria | 6871 |
| 48 | 2227594078 | 2225789004 | Bacteria | 12781 |
| 49 | Ga0466729_233782 | 3300042621 | Bacteria | 4573 |
| 50 | Ga0466708_010142 | 3300042652 | Bacteria | 7423 |
| 51 | Ga0466727_251466 | 3300042655 | Bacteria | 5240 |
| 52 | Ga0466705_422990 | 3300042612 | Bacteria | 7547 |
| 53 | Ga0466711_148972 | 3300042615 | Unclassified | 6988 |
| 54 | Ga0466715_248146 | 3300042616 | Bacteria | 4762 |
| 55 | Ga0466696_062766 | 3300042596 | Bacteria | 9636 |
| 56 | Ga0466713_150871 | 3300042602 | Bacteria | 11473 |
| 57 | Ga0466716_064981 | 3300042605 | Bacteria | 3975 |
| 58 | Ga0466733_077751 | 3300042659 | Bacteria | 11807 |
| 59 | JGI24699J35502_11133958 | 3300002509 | Bacteria | 21435 |
| 60 | Ga0068305_10010843 | 3300005083 | Bacteria | 37341 |
| 61 | Ga0466735_040286 | 3300042624 | Bacteria | 3122 |
| 62 | Ga0466730_012275 | 3300042625 | Bacteria | 4091 |
| 63 | Ga0466709_101990 | 3300042648 | Bacteria | 9490 |
| 64 | Ga0466709_218965 | 3300042648 | Bacteria | 23200 |
| 65 | Ga0466723_115010 | 3300042618 | Bacteria | 22712 |
| 66 | Ga0466690_417854 | 3300042590 | Bacteria | 3638 |
| 67 | Ga0466691_091578 | 3300042593 | Bacteria | 3908 |
| 68 | Ga0466707_017405 | 3300042601 | Bacteria | 21356 |
| 69 | Ga0466714_072010 | 3300042603 | Bacteria | 7159 |
| 70 | Ga0466722_190707 | 3300042609 | Bacteria | 3803 |
| 71 | Ga0466733_071155 | 3300042659 | Bacteria | 2103 |
| 72 | IMNBL1DRAFT_c0002178 | 3300000062 | Bacteria | 13832 |
| 73 | JGI24699J35502_11134189 | 3300002509 | Bacteria | 48688 |
| 74 | Ga0466727_160380 | 3300042655 | Bacteria | 2839 |
| 75 | Ga0466715_163861 | 3300042616 | Bacteria | 20977 |
| 76 | Ga0466726_068442 | 3300042619 | Bacteria | 18874 |
| 77 | Ga0466690_019619 | 3300042590 | Bacteria | 7516 |
| 78 | Ga0466692_041271 | 3300042591 | Bacteria | 9591 |
| 79 | Ga0466691_079070 | 3300042593 | Bacteria | 13993 |
| 80 | Ga0466696_168376 | 3300042596 | Bacteria | 9811 |
| 81 | Ga0466707_229623 | 3300042601 | Bacteria | 4128 |
| 82 | Ga0466713_063524 | 3300042602 | Bacteria | 8482 |
| 83 | Ga0466713_085471 | 3300042602 | Bacteria | 4905 |
| 84 | Ga0466713_113095 | 3300042602 | Bacteria | 77786 |
| 85 | Ga0466705_176841 | 3300042612 | Bacteria | 4778 |
| 86 | Ga0068302_10095431 | 3300005071 | Bacteria | 1521 |
| 87 | Ga0466735_176846 | 3300042624 | Bacteria | 2292 |
| 88 | Ga0466703_223895 | 3300042636 | Bacteria | 5749 |
| 89 | Ga0466727_106490 | 3300042655 | Bacteria | 2204 |
| 90 | Ga0466710_269805 | 3300042613 | Bacteria | 7402 |
| 91 | Ga0466723_088640 | 3300042618 | Bacteria | 27215 |
| 92 | Ga0466723_089568 | 3300042618 | Bacteria | 54083 |
| 93 | Ga0466728_014387 | 3300042620 | Bacteria | 2099 |
| 94 | Ga0466657_296869 | 3300042582 | Bacteria | 46620 |
| 95 | Ga0466690_256751 | 3300042590 | Bacteria | 42016 |
| 96 | Ga0466706_016460 | 3300042599 | Bacteria | 6714 |
| 97 | Ga0466706_039675 | 3300042599 | Bacteria | 8021 |
| 98 | Ga0466714_035661 | 3300042603 | Bacteria | 32382 |
| 99 | Ga0466714_146968 | 3300042603 | Bacteria | 2336 |
| 100 | Ga0466705_174137 | 3300042612 | Bacteria | 2443 |
| 101 | Ga0068305_10000339 | 3300005083 | Bacteria | 123240 |
| 102 | Ga0466729_240625 | 3300042621 | Unclassified | 1434 |
| 103 | Ga0466735_025103 | 3300042624 | Bacteria | 5661 |
| 104 | Ga0466704_055417 | 3300042643 | Bacteria | 5967 |
| 105 | Ga0466704_216241 | 3300042643 | Bacteria | 8554 |
| 106 | Ga0466709_288179 | 3300042648 | Bacteria | 1928 |
| 107 | Ga0466709_390589 | 3300042648 | Bacteria | 49108 |
| 108 | Ga0466708_246063 | 3300042652 | Bacteria | 25365 |
| 109 | Ga0466727_092062 | 3300042655 | Bacteria | 3230 |
| 110 | Ga0466727_297134 | 3300042655 | Bacteria | 3408 |
| 111 | Ga0466726_449160 | 3300042619 | Bacteria | 3911 |
| 112 | Ga0466728_399687 | 3300042620 | Bacteria | 50681 |
| 113 | Ga0466706_084622 | 3300042599 | Bacteria | 28514 |
| 114 | Ga0466707_217907 | 3300042601 | Bacteria | 23324 |
| 115 | Ga0466722_200128 | 3300042609 | Bacteria | 4612 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042593 | Ga0466691_080653 | Ga0466691_080653_2345_3436 | 363 |
| 2 | 3300042599 | Ga0466706_133883 | Ga0466706_133883_35462_36583 | 364 |
| 3 | 3300042599 | Ga0466706_084622 | Ga0466706_084622_6493_7677 | 372 |
| 4 | 3300042648 | Ga0466709_390589 | Ga0466709_390589_13882_15000 | 372 |
| 5 | 3300042601 | Ga0466707_217907 | Ga0466707_217907_11096_12217 | 373 |
| 6 | 3300042591 | Ga0466692_145660 | Ga0466692_145660_31_1155 | 374 |
| 7 | 3300042612 | Ga0466705_176841 | Ga0466705_176841_3509_4633 | 374 |
| 8 | 3300042643 | Ga0466704_049130 | Ga0466704_049130_2780_3907 | 375 |
| 9 | 3300042612 | Ga0466705_021460 | Ga0466705_021460_1707_2894 | 377 |
| 10 | 3300042593 | Ga0466691_214494 | Ga0466691_214494_1709_2893 | 382 |
| 11 | 3300042596 | Ga0466696_168376 | Ga0466696_168376_3388_4539 | 383 |
| 12 | 3300042618 | Ga0466723_088640 | Ga0466723_088640_1164_2315 | 383 |
| 13 | 3300042652 | Ga0466708_005632 | Ga0466708_005632_421_1626 | 383 |
| 14 | 3300042590 | Ga0466690_169144 | Ga0466690_169144_5112_6269 | 385 |
| 15 | 3300042624 | Ga0466735_212764 | Ga0466735_212764_4659_5816 | 385 |
| 16 | 3300042591 | Ga0466692_041271 | Ga0466692_041271_1256_2416 | 386 |
| 17 | 3300042620 | Ga0466728_304435 | Ga0466728_304435_21693_22853 | 386 |
| 18 | 3300042624 | Ga0466735_040286 | Ga0466735_040286_528_1688 | 386 |
| 19 | 3300042624 | Ga0466735_082363 | Ga0466735_082363_3658_4818 | 386 |
| 20 | iso_pr_bacteria | 2967483437 | 2967484635 | 386 |
| 21 | iso_pr_bacteria | 3004667792 | 3004671075 | 386 |
| 22 | 3300042598 | Ga0466701_040912 | Ga0466701_040912_4188_5351 | 387 |
| 23 | 3300042601 | Ga0466707_017405 | Ga0466707_017405_1765_2928 | 387 |
| 24 | 3300042621 | Ga0466729_233782 | Ga0466729_233782_3112_4275 | 387 |
| 25 | 3300042621 | Ga0466729_240625 | Ga0466729_240625_102_1265 | 387 |
| 26 | 3300042648 | Ga0466709_218965 | Ga0466709_218965_777_1940 | 387 |
| 27 | 3300042590 | Ga0466690_019619 | Ga0466690_019619_5342_6508 | 388 |
| 28 | 3300042590 | Ga0466690_051806 | Ga0466690_051806_1232_2398 | 388 |
| 29 | 3300042590 | Ga0466690_417854 | Ga0466690_417854_972_2138 | 388 |
| 30 | 3300042605 | Ga0466716_064981 | Ga0466716_064981_1661_2827 | 388 |
| 31 | 3300042611 | Ga0466697_096879 | Ga0466697_096879_181508_182674 | 388 |
| 32 | 3300042618 | Ga0466723_115010 | Ga0466723_115010_5487_6653 | 388 |
| 33 | 3300042648 | Ga0466709_032551 | Ga0466709_032551_5889_7055 | 388 |
| 34 | iso_pr_bacteria | 2820778767 | 2820780152 | 388 |
| 35 | 3300009784 | Ga0123357_10002435 | Ga0123357_1000243516 | 389 |
| 36 | 3300042590 | Ga0466690_051249 | Ga0466690_051249_3714_4883 | 389 |
| 37 | 3300042593 | Ga0466691_035208 | Ga0466691_035208_7629_8798 | 389 |
| 38 | 3300042593 | Ga0466691_091578 | Ga0466691_091578_1979_3148 | 389 |
| 39 | 3300042602 | Ga0466713_040492 | Ga0466713_040492_4351_5520 | 389 |
| 40 | 3300042605 | Ga0466716_131519 | Ga0466716_131519_2970_4139 | 389 |
| 41 | 3300042605 | Ga0466716_243469 | Ga0466716_243469_1910_3079 | 389 |
| 42 | 3300042609 | Ga0466722_190707 | Ga0466722_190707_752_1921 | 389 |
| 43 | 3300042624 | Ga0466735_033476 | Ga0466735_033476_1464_2633 | 389 |
| 44 | 3300042624 | Ga0466735_176846 | Ga0466735_176846_262_1431 | 389 |
| 45 | 3300042636 | Ga0466703_223895 | Ga0466703_223895_2039_3208 | 389 |
| 46 | 3300042596 | Ga0466696_062766 | Ga0466696_062766_773_1945 | 390 |
| 47 | 3300042599 | Ga0466706_272316 | Ga0466706_272316_1566_2738 | 390 |
| 48 | 3300042602 | Ga0466713_029853 | Ga0466713_029853_758_1930 | 390 |
| 49 | 3300042609 | Ga0466722_085264 | Ga0466722_085264_987_2159 | 390 |
| 50 | 3300042609 | Ga0466722_200128 | Ga0466722_200128_3147_4319 | 390 |
| 51 | 3300042615 | Ga0466711_044951 | Ga0466711_044951_4147_5319 | 390 |
| 52 | 3300042615 | Ga0466711_148972 | Ga0466711_148972_4671_5843 | 390 |
| 53 | 3300042616 | Ga0466715_248146 | Ga0466715_248146_787_1959 | 390 |
| 54 | 3300042619 | Ga0466726_449160 | Ga0466726_449160_2585_3757 | 390 |
| 55 | 3300042652 | Ga0466708_195474 | Ga0466708_195474_4067_5239 | 390 |
| 56 | iso_pr_bacteria | 2820736622 | 2820737253 | 390 |
| 57 | iso_pr_bacteria | 2820740053 | 2820740339 | 390 |
| 58 | iso_pr_bacteria | 2922326829 | 2922330436 | 390 |
| 59 | iso_pr_bacteria | 2923982719 | 2923983044 | 390 |
| 60 | iso_pr_bacteria | 3004672520 | 3004677155 | 390 |
| 61 | iso_pr_bacteria | 643348524 | 643422815 | 390 |
| 62 | 2225789004 | 2227594078 | 2228155574 | 391 |
| 63 | 3300000062 | IMNBL1DRAFT_c0006729 | IMNBL1DRAFT_00067294 | 391 |
| 64 | 3300002462 | JGI24702J35022_10001817 | JGI24702J35022_100018172 | 391 |
| 65 | 3300042602 | Ga0466713_085471 | Ga0466713_085471_1482_2657 | 391 |
| 66 | 3300042603 | Ga0466714_146968 | Ga0466714_146968_166_1341 | 391 |
| 67 | 3300042605 | Ga0466716_219652 | Ga0466716_219652_7857_9032 | 391 |
| 68 | 3300042612 | Ga0466705_311279 | Ga0466705_311279_7274_8449 | 391 |
| 69 | 3300042624 | Ga0466735_025103 | Ga0466735_025103_2825_4000 | 391 |
| 70 | 3300042643 | Ga0466704_055417 | Ga0466704_055417_744_1919 | 391 |
| 71 | 3300042655 | Ga0466727_297134 | Ga0466727_297134_438_1613 | 391 |
| 72 | iso_pr_bacteria | 2695420317 | 2695486782 | 391 |
| 73 | iso_pr_bacteria | 2910942425 | 2910944738 | 391 |
| 74 | iso_pr_bacteria | 2940199050 | 2940201346 | 391 |
| 75 | iso_pr_bacteria | 2940209341 | 2940210002 | 391 |
| 76 | iso_pr_bacteria | 2940346213 | 2940349238 | 391 |
| 77 | iso_pr_bacteria | 8100157865 | 8100159760 | 391 |
| 78 | 3300000062 | IMNBL1DRAFT_c0002178 | IMNBL1DRAFT_00021787 | 392 |
| 79 | 3300042593 | Ga0466691_189486 | Ga0466691_189486_612_1790 | 392 |
| 80 | 3300042599 | Ga0466706_016460 | Ga0466706_016460_3567_4745 | 392 |
| 81 | 3300042599 | Ga0466706_044418 | Ga0466706_044418_17382_18560 | 392 |
| 82 | 3300042609 | Ga0466722_020309 | Ga0466722_020309_1365_2543 | 392 |
| 83 | iso_pr_bacteria | 2910959314 | 2910961699 | 392 |
| 84 | iso_pr_bacteria | 2940205530 | 2940206983 | 392 |
| 85 | iso_pr_bacteria | 2940212447 | 2940213860 | 392 |
| 86 | iso_pr_bacteria | 2940298504 | 2940299952 | 392 |
| 87 | iso_pr_bacteria | 2940302308 | 2940303722 | 392 |
| 88 | iso_pr_bacteria | 2940306115 | 2940307196 | 392 |
| 89 | iso_pr_bacteria | 2940309933 | 2940311313 | 392 |
| 90 | iso_pr_bacteria | 2940313741 | 2940315087 | 392 |
| 91 | iso_pr_bacteria | 2940317558 | 2940318941 | 392 |
| 92 | iso_pr_bacteria | 2940321370 | 2940322713 | 392 |
| 93 | iso_pr_bacteria | 2940325180 | 2940326632 | 392 |
| 94 | iso_pr_bacteria | 2940328985 | 2940330399 | 392 |
| 95 | iso_pr_bacteria | 2940332795 | 2940334178 | 392 |
| 96 | 3300005071 | Ga0068302_10095431 | Ga0068302_100954312 | 393 |
| 97 | 3300005083 | Ga0068305_10010843 | Ga0068305_1001084320 | 393 |
| 98 | 3300042582 | Ga0466657_296869 | Ga0466657_296869_4022_5203 | 393 |
| 99 | 3300042590 | Ga0466690_256751 | Ga0466690_256751_38366_39547 | 393 |
| 100 | 3300042593 | Ga0466691_079070 | Ga0466691_079070_11319_12500 | 393 |
| 101 | 3300042595 | Ga0466695_009046 | Ga0466695_009046_288_1469 | 393 |
| 102 | 3300042596 | Ga0466696_372942 | Ga0466696_372942_771_1952 | 393 |
| 103 | 3300042600 | Ga0466700_395184 | Ga0466700_395184_80_1261 | 393 |
| 104 | 3300042601 | Ga0466707_229623 | Ga0466707_229623_2521_3702 | 393 |
| 105 | 3300042603 | Ga0466714_035661 | Ga0466714_035661_2273_3454 | 393 |
| 106 | 3300042603 | Ga0466714_072010 | Ga0466714_072010_1820_3001 | 393 |
| 107 | 3300042612 | Ga0466705_174137 | Ga0466705_174137_1192_2373 | 393 |
| 108 | 3300042613 | Ga0466710_269805 | Ga0466710_269805_4557_5738 | 393 |
| 109 | 3300042616 | Ga0466715_163861 | Ga0466715_163861_2384_3565 | 393 |
| 110 | 3300042620 | Ga0466728_014387 | Ga0466728_014387_205_1386 | 393 |
| 111 | 3300042620 | Ga0466728_399687 | Ga0466728_399687_439_1620 | 393 |
| 112 | 3300042636 | Ga0466703_016865 | Ga0466703_016865_89_1270 | 393 |
| 113 | 3300042636 | Ga0466703_078920 | Ga0466703_078920_2808_3989 | 393 |
| 114 | 3300042648 | Ga0466709_288179 | Ga0466709_288179_563_1744 | 393 |
| 115 | 3300042652 | Ga0466708_010142 | Ga0466708_010142_4947_6128 | 393 |
| 116 | 3300042655 | Ga0466727_160380 | Ga0466727_160380_483_1664 | 393 |
| 117 | 3300042659 | Ga0466733_071155 | Ga0466733_071155_144_1325 | 393 |
| 118 | iso_pr_bacteria | 2820759988 | 2820761353 | 393 |
| 119 | iso_pr_bacteria | 2910930387 | 2910933008 | 393 |
| 120 | iso_pr_bacteria | 2940244548 | 2940247633 | 393 |
| 121 | iso_pr_bacteria | 2940248789 | 2940252036 | 393 |
| 122 | iso_pr_bacteria | 2940253009 | 2940256130 | 393 |
| 123 | iso_pr_bacteria | 2940257232 | 2940260263 | 393 |
| 124 | 3300002509 | JGI24699J35502_11133958 | JGI24699J35502_1113395814 | 394 |
| 125 | 3300002834 | JGI24696J40584_12959432 | JGI24696J40584_129594322 | 394 |
| 126 | 3300042599 | Ga0466706_039675 | Ga0466706_039675_5660_6844 | 394 |
| 127 | 3300042601 | Ga0466707_276019 | Ga0466707_276019_303_1487 | 394 |
| 128 | 3300042602 | Ga0466713_063524 | Ga0466713_063524_6950_8134 | 394 |
| 129 | 3300042612 | Ga0466705_422990 | Ga0466705_422990_2086_3270 | 394 |
| 130 | 3300042655 | Ga0466727_106490 | Ga0466727_106490_712_1896 | 394 |
| 131 | 3300002509 | JGI24699J35502_11134189 | JGI24699J35502_1113418911 | 395 |
| 132 | 3300002509 | JGI24699J35502_11134220 | JGI24699J35502_111342206 | 395 |
| 133 | 3300005083 | Ga0068305_10000339 | Ga0068305_1000033957 | 395 |
| 134 | 3300042602 | Ga0466713_150871 | Ga0466713_150871_4057_5244 | 395 |
| 135 | 3300042636 | Ga0466703_105441 | Ga0466703_105441_1196_2383 | 395 |
| 136 | 3300042643 | Ga0466704_333463 | Ga0466704_333463_9896_11083 | 395 |
| 137 | 3300042648 | Ga0466709_101990 | Ga0466709_101990_7440_8627 | 395 |
| 138 | 3300042655 | Ga0466727_092062 | Ga0466727_092062_1131_2318 | 395 |
| 139 | iso_pr_bacteria | 2820757377 | 2820759626 | 395 |
| 140 | 2225789004 | 2227275242 | 2227726121 | 396 |
| 141 | 3300042619 | Ga0466726_068442 | Ga0466726_068442_1422_2612 | 396 |
| 142 | 3300042652 | Ga0466708_246063 | Ga0466708_246063_16127_17317 | 396 |
| 143 | 3300042602 | Ga0466713_113095 | Ga0466713_113095_17777_18970 | 397 |
| 144 | 3300042643 | Ga0466704_216241 | Ga0466704_216241_103_1296 | 397 |
| 145 | 3300042609 | Ga0466722_205061 | Ga0466722_205061_10139_11335 | 398 |
| 146 | 3300042618 | Ga0466723_089568 | Ga0466723_089568_18178_19374 | 398 |
| 147 | 3300042655 | Ga0466727_251466 | Ga0466727_251466_3619_4815 | 398 |
| 148 | 3300042625 | Ga0466730_012275 | Ga0466730_012275_1786_3003 | 405 |
| 149 | 3300042659 | Ga0466733_077751 | Ga0466733_077751_10490_11707 | 405 |
| 150 | 3300042616 | Ga0466715_621075 | Ga0466715_621075_60130_61350 | 406 |
| 151 | iso_pr_bacteria | 2940371297 | 2940373263 | 424 |
Functional Annotation
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.88 | 0.92 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.