Protein Family IF13089

Metagenome Isolate
151 Members
75 Samples
115 Scaffolds
390.49 Avg Length

🧬 Representative Sequence

ID
iso_pr_bacteria|2940371297|2940373263|
Length
424 aa
Sequence
MRFGNIGCCLNKFGAALSFHYIYPRKNLIHNTTRMEKTWRWFGKKDKITLDMLRQIGVEGIVTALHDIPNGEIWPSEAILDLKGYIEKAGLRWSVVESLPVSEAIKYGGEERDQLIENYKISLANLGKAGIKTVCYNFMPVIDWIRTDLNKKNPDGTYTLYFDKIRFAYFDCFILQREGAEKDYTKEEMEDVYALDKVITTAEKEELIHTIIVKTQGFINGNIQEGDKAPVALFNRLLTLYKGIDKMQLRAHMKYFLKQVIPTAEEYGVNLCVHPDDPPFPVLGLPRIVTSAEDIDWFLKAVDSPNNGLTFCAGSLSAGLHNDVPVLAERFAQRTHFVHLRSTDVYENGNFIEASHLGGRGRLIDLIRIFEKENPALPMRVDHGKLMLGDGDKEYNPGYSFLGRMYALAQVDGMMAVVKDELTT

📊 Sample Types

Isolate 23.8%
Metagenome 76.2%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Blattidae 36.0%
Kalotermitidae 17.3%
Termitidae 17.3%
Unclassified 14.7%
Termopsidae 5.3%
Rhinotermitidae 5.3%
Passalidae 2.7%
Hodotermitidae 1.3%

🌳 Taxonomy

Archaea 0
Bacteria 148
Eukaryota 0
Viruses 0
Unclassified 3

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820757377 Unclassified Bacteroidetes Mp193P4bin6 Isolate Unclassified
2 2940199050 Parabacteroides sp. PM6-13 Isolate Blattidae
3 2940371297 Parabacteroides sp. PM5-20 Isolate Blattidae
4 2967483437 Candidatus Ordinivivax streblomastigis St1 Isolate Unclassified
5 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
6 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
7 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
8 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
9 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
10 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
11 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
12 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
13 2940248789 Dysgonomonas sp. PF1-16 Isolate Blattidae
14 2940346213 Parabacteroides sp. PFB2-12 Isolate Blattidae
15 2820740053 Unclassified Bacteroidetes Th196P3bin81 Isolate Unclassified
16 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
17 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
18 2940209341 Parabacteroides sp. PFB2-10 Isolate Blattidae
19 2940298504 Parabacteroides sp. PF5-13 Isolate Blattidae
20 2820736622 Unclassified Bacteroidetes Th196P4bin26 Isolate Unclassified
21 3004667792 Bacteroides sp. 519 Isolate Blattidae
22 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
23 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
24 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
25 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
26 2820759988 Unclassified Bacteroidetes Mp193P4bin4 Isolate Unclassified
27 2910959314 Dysgonomonas sp. 511 Isolate Blattidae
28 2923982719 Parabacteroides sp. 52 Isolate Blattidae
29 2940306115 Parabacteroides sp. PFB2-22 Isolate Blattidae
30 2940309933 Parabacteroides sp. PH5-13 Isolate Blattidae
31 2940328985 Parabacteroides sp. PH5-46 Isolate Blattidae
32 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
33 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
34 8100157865 Dysgonomonas sp. GY617 Isolate Rhinotermitidae
35 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
36 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
37 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
38 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
39 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
40 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
41 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
42 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
43 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
44 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
45 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
46 2940205530 Parabacteroides sp. PH5-33 Isolate Blattidae
47 2940317558 Parabacteroides sp. PH5-26 Isolate Blattidae
48 2940325180 Parabacteroides sp. PH5-41 Isolate Blattidae
49 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
50 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
51 2922326829 Bacteroides sp. 224 Isolate Blattidae
52 2940253009 Dysgonomonas sp. PF1-23 Isolate Blattidae
53 2940257232 Dysgonomonas sp. PFB1-18 Isolate Blattidae
54 2940313741 Parabacteroides sp. PH5-17 Isolate Blattidae
55 2695420317 Dysgonomonas sp. HGC4 Isolate Unclassified
56 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
57 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
58 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
59 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
60 2820778767 Unclassified Bacteroidetes Emb289P4bin10 Isolate Unclassified
61 2910930387 Dysgonomonas sp. 216 Isolate Blattidae
62 2910942425 Dysgonomonas sp. 521 Isolate Blattidae
63 2940212447 Parabacteroides sp. PH5-16 Isolate Blattidae
64 2940244548 Dysgonomonas sp. PF1-14 Isolate Blattidae
65 2940302308 Parabacteroides sp. PF5-5 Isolate Blattidae
66 2940321370 Parabacteroides sp. PH5-39 Isolate Blattidae
67 2940332795 Parabacteroides sp. PH5-8 Isolate Blattidae
68 3004672520 Bacteroides sp. 51 Isolate Blattidae
69 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
70 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
71 643348524 Candidatus Azobacteroides pseudotrichonymphae gv. CFP2 Isolate Unclassified
72 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
73 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
74 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
75 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_021460 3300042612 Bacteria 3296
2 JGI24699J35502_11134220 3300002509 Bacteria 66991
3 Ga0123357_10002435 3300009784 Bacteria 20755
4 Ga0466735_212764 3300042624 Bacteria 10218
5 Ga0466703_016865 3300042636 Bacteria 1572
6 Ga0466708_005632 3300042652 Bacteria 3320
7 Ga0466728_304435 3300042620 Bacteria 29742
8 Ga0466690_169144 3300042590 Bacteria 7027
9 Ga0466695_009046 3300042595 Bacteria 2641
10 Ga0466701_040912 3300042598 Bacteria 7277
11 Ga0466706_133883 3300042599 Bacteria 39086
12 Ga0466700_395184 3300042600 Bacteria 3056
13 Ga0466713_029853 3300042602 Bacteria 6416
14 Ga0466716_131519 3300042605 Bacteria 4274
15 Ga0466716_219652 3300042605 Bacteria 15271
16 IMNBL1DRAFT_c0006729 3300000062 Bacteria 6219
17 JGI24702J35022_10001817 3300002462 Bacteria 13141
18 JGI24696J40584_12959432 3300002834 Bacteria 5115
19 Ga0466735_033476 3300042624 Bacteria 3513
20 Ga0466735_082363 3300042624 Bacteria 5286
21 Ga0466703_078920 3300042636 Bacteria 4861
22 Ga0466704_049130 3300042643 Bacteria 3940
23 Ga0466711_044951 3300042615 Bacteria 14666
24 Ga0466715_621075 3300042616 Bacteria 61945
25 Ga0466690_051249 3300042590 Bacteria 12685
26 Ga0466690_051806 3300042590 Bacteria 3984
27 Ga0466691_080653 3300042593 Bacteria 3448
28 Ga0466696_372942 3300042596 Bacteria 2743
29 Ga0466706_044418 3300042599 Bacteria 19614
30 Ga0466707_276019 3300042601 Bacteria 6460
31 Ga0466713_040492 3300042602 Unclassified 7027
32 Ga0466716_243469 3300042605 Bacteria 3602
33 Ga0466722_020309 3300042609 Bacteria 4420
34 Ga0466722_205061 3300042609 Bacteria 22162
35 Ga0466697_096879 3300042611 Bacteria 330838
36 Ga0466705_311279 3300042612 Bacteria 23151
37 Ga0466703_105441 3300042636 Bacteria 5474
38 Ga0466704_333463 3300042643 Bacteria 15938
39 Ga0466709_032551 3300042648 Bacteria 8337
40 Ga0466708_195474 3300042652 Bacteria 6461
41 Ga0466692_145660 3300042591 Bacteria 2359
42 Ga0466691_035208 3300042593 Bacteria 19307
43 Ga0466691_189486 3300042593 Bacteria 2096
44 Ga0466691_214494 3300042593 Bacteria 20188
45 Ga0466706_272316 3300042599 Bacteria 5024
46 Ga0466722_085264 3300042609 Bacteria 7063
47 2227275242 2225789004 Bacteria 6871
48 2227594078 2225789004 Bacteria 12781
49 Ga0466729_233782 3300042621 Bacteria 4573
50 Ga0466708_010142 3300042652 Bacteria 7423
51 Ga0466727_251466 3300042655 Bacteria 5240
52 Ga0466705_422990 3300042612 Bacteria 7547
53 Ga0466711_148972 3300042615 Unclassified 6988
54 Ga0466715_248146 3300042616 Bacteria 4762
55 Ga0466696_062766 3300042596 Bacteria 9636
56 Ga0466713_150871 3300042602 Bacteria 11473
57 Ga0466716_064981 3300042605 Bacteria 3975
58 Ga0466733_077751 3300042659 Bacteria 11807
59 JGI24699J35502_11133958 3300002509 Bacteria 21435
60 Ga0068305_10010843 3300005083 Bacteria 37341
61 Ga0466735_040286 3300042624 Bacteria 3122
62 Ga0466730_012275 3300042625 Bacteria 4091
63 Ga0466709_101990 3300042648 Bacteria 9490
64 Ga0466709_218965 3300042648 Bacteria 23200
65 Ga0466723_115010 3300042618 Bacteria 22712
66 Ga0466690_417854 3300042590 Bacteria 3638
67 Ga0466691_091578 3300042593 Bacteria 3908
68 Ga0466707_017405 3300042601 Bacteria 21356
69 Ga0466714_072010 3300042603 Bacteria 7159
70 Ga0466722_190707 3300042609 Bacteria 3803
71 Ga0466733_071155 3300042659 Bacteria 2103
72 IMNBL1DRAFT_c0002178 3300000062 Bacteria 13832
73 JGI24699J35502_11134189 3300002509 Bacteria 48688
74 Ga0466727_160380 3300042655 Bacteria 2839
75 Ga0466715_163861 3300042616 Bacteria 20977
76 Ga0466726_068442 3300042619 Bacteria 18874
77 Ga0466690_019619 3300042590 Bacteria 7516
78 Ga0466692_041271 3300042591 Bacteria 9591
79 Ga0466691_079070 3300042593 Bacteria 13993
80 Ga0466696_168376 3300042596 Bacteria 9811
81 Ga0466707_229623 3300042601 Bacteria 4128
82 Ga0466713_063524 3300042602 Bacteria 8482
83 Ga0466713_085471 3300042602 Bacteria 4905
84 Ga0466713_113095 3300042602 Bacteria 77786
85 Ga0466705_176841 3300042612 Bacteria 4778
86 Ga0068302_10095431 3300005071 Bacteria 1521
87 Ga0466735_176846 3300042624 Bacteria 2292
88 Ga0466703_223895 3300042636 Bacteria 5749
89 Ga0466727_106490 3300042655 Bacteria 2204
90 Ga0466710_269805 3300042613 Bacteria 7402
91 Ga0466723_088640 3300042618 Bacteria 27215
92 Ga0466723_089568 3300042618 Bacteria 54083
93 Ga0466728_014387 3300042620 Bacteria 2099
94 Ga0466657_296869 3300042582 Bacteria 46620
95 Ga0466690_256751 3300042590 Bacteria 42016
96 Ga0466706_016460 3300042599 Bacteria 6714
97 Ga0466706_039675 3300042599 Bacteria 8021
98 Ga0466714_035661 3300042603 Bacteria 32382
99 Ga0466714_146968 3300042603 Bacteria 2336
100 Ga0466705_174137 3300042612 Bacteria 2443
101 Ga0068305_10000339 3300005083 Bacteria 123240
102 Ga0466729_240625 3300042621 Unclassified 1434
103 Ga0466735_025103 3300042624 Bacteria 5661
104 Ga0466704_055417 3300042643 Bacteria 5967
105 Ga0466704_216241 3300042643 Bacteria 8554
106 Ga0466709_288179 3300042648 Bacteria 1928
107 Ga0466709_390589 3300042648 Bacteria 49108
108 Ga0466708_246063 3300042652 Bacteria 25365
109 Ga0466727_092062 3300042655 Bacteria 3230
110 Ga0466727_297134 3300042655 Bacteria 3408
111 Ga0466726_449160 3300042619 Bacteria 3911
112 Ga0466728_399687 3300042620 Bacteria 50681
113 Ga0466706_084622 3300042599 Bacteria 28514
114 Ga0466707_217907 3300042601 Bacteria 23324
115 Ga0466722_200128 3300042609 Bacteria 4612

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042593 Ga0466691_080653 Ga0466691_080653_2345_3436 363
2 3300042599 Ga0466706_133883 Ga0466706_133883_35462_36583 364
3 3300042599 Ga0466706_084622 Ga0466706_084622_6493_7677 372
4 3300042648 Ga0466709_390589 Ga0466709_390589_13882_15000 372
5 3300042601 Ga0466707_217907 Ga0466707_217907_11096_12217 373
6 3300042591 Ga0466692_145660 Ga0466692_145660_31_1155 374
7 3300042612 Ga0466705_176841 Ga0466705_176841_3509_4633 374
8 3300042643 Ga0466704_049130 Ga0466704_049130_2780_3907 375
9 3300042612 Ga0466705_021460 Ga0466705_021460_1707_2894 377
10 3300042593 Ga0466691_214494 Ga0466691_214494_1709_2893 382
11 3300042596 Ga0466696_168376 Ga0466696_168376_3388_4539 383
12 3300042618 Ga0466723_088640 Ga0466723_088640_1164_2315 383
13 3300042652 Ga0466708_005632 Ga0466708_005632_421_1626 383
14 3300042590 Ga0466690_169144 Ga0466690_169144_5112_6269 385
15 3300042624 Ga0466735_212764 Ga0466735_212764_4659_5816 385
16 3300042591 Ga0466692_041271 Ga0466692_041271_1256_2416 386
17 3300042620 Ga0466728_304435 Ga0466728_304435_21693_22853 386
18 3300042624 Ga0466735_040286 Ga0466735_040286_528_1688 386
19 3300042624 Ga0466735_082363 Ga0466735_082363_3658_4818 386
20 iso_pr_bacteria 2967483437 2967484635 386
21 iso_pr_bacteria 3004667792 3004671075 386
22 3300042598 Ga0466701_040912 Ga0466701_040912_4188_5351 387
23 3300042601 Ga0466707_017405 Ga0466707_017405_1765_2928 387
24 3300042621 Ga0466729_233782 Ga0466729_233782_3112_4275 387
25 3300042621 Ga0466729_240625 Ga0466729_240625_102_1265 387
26 3300042648 Ga0466709_218965 Ga0466709_218965_777_1940 387
27 3300042590 Ga0466690_019619 Ga0466690_019619_5342_6508 388
28 3300042590 Ga0466690_051806 Ga0466690_051806_1232_2398 388
29 3300042590 Ga0466690_417854 Ga0466690_417854_972_2138 388
30 3300042605 Ga0466716_064981 Ga0466716_064981_1661_2827 388
31 3300042611 Ga0466697_096879 Ga0466697_096879_181508_182674 388
32 3300042618 Ga0466723_115010 Ga0466723_115010_5487_6653 388
33 3300042648 Ga0466709_032551 Ga0466709_032551_5889_7055 388
34 iso_pr_bacteria 2820778767 2820780152 388
35 3300009784 Ga0123357_10002435 Ga0123357_1000243516 389
36 3300042590 Ga0466690_051249 Ga0466690_051249_3714_4883 389
37 3300042593 Ga0466691_035208 Ga0466691_035208_7629_8798 389
38 3300042593 Ga0466691_091578 Ga0466691_091578_1979_3148 389
39 3300042602 Ga0466713_040492 Ga0466713_040492_4351_5520 389
40 3300042605 Ga0466716_131519 Ga0466716_131519_2970_4139 389
41 3300042605 Ga0466716_243469 Ga0466716_243469_1910_3079 389
42 3300042609 Ga0466722_190707 Ga0466722_190707_752_1921 389
43 3300042624 Ga0466735_033476 Ga0466735_033476_1464_2633 389
44 3300042624 Ga0466735_176846 Ga0466735_176846_262_1431 389
45 3300042636 Ga0466703_223895 Ga0466703_223895_2039_3208 389
46 3300042596 Ga0466696_062766 Ga0466696_062766_773_1945 390
47 3300042599 Ga0466706_272316 Ga0466706_272316_1566_2738 390
48 3300042602 Ga0466713_029853 Ga0466713_029853_758_1930 390
49 3300042609 Ga0466722_085264 Ga0466722_085264_987_2159 390
50 3300042609 Ga0466722_200128 Ga0466722_200128_3147_4319 390
51 3300042615 Ga0466711_044951 Ga0466711_044951_4147_5319 390
52 3300042615 Ga0466711_148972 Ga0466711_148972_4671_5843 390
53 3300042616 Ga0466715_248146 Ga0466715_248146_787_1959 390
54 3300042619 Ga0466726_449160 Ga0466726_449160_2585_3757 390
55 3300042652 Ga0466708_195474 Ga0466708_195474_4067_5239 390
56 iso_pr_bacteria 2820736622 2820737253 390
57 iso_pr_bacteria 2820740053 2820740339 390
58 iso_pr_bacteria 2922326829 2922330436 390
59 iso_pr_bacteria 2923982719 2923983044 390
60 iso_pr_bacteria 3004672520 3004677155 390
61 iso_pr_bacteria 643348524 643422815 390
62 2225789004 2227594078 2228155574 391
63 3300000062 IMNBL1DRAFT_c0006729 IMNBL1DRAFT_00067294 391
64 3300002462 JGI24702J35022_10001817 JGI24702J35022_100018172 391
65 3300042602 Ga0466713_085471 Ga0466713_085471_1482_2657 391
66 3300042603 Ga0466714_146968 Ga0466714_146968_166_1341 391
67 3300042605 Ga0466716_219652 Ga0466716_219652_7857_9032 391
68 3300042612 Ga0466705_311279 Ga0466705_311279_7274_8449 391
69 3300042624 Ga0466735_025103 Ga0466735_025103_2825_4000 391
70 3300042643 Ga0466704_055417 Ga0466704_055417_744_1919 391
71 3300042655 Ga0466727_297134 Ga0466727_297134_438_1613 391
72 iso_pr_bacteria 2695420317 2695486782 391
73 iso_pr_bacteria 2910942425 2910944738 391
74 iso_pr_bacteria 2940199050 2940201346 391
75 iso_pr_bacteria 2940209341 2940210002 391
76 iso_pr_bacteria 2940346213 2940349238 391
77 iso_pr_bacteria 8100157865 8100159760 391
78 3300000062 IMNBL1DRAFT_c0002178 IMNBL1DRAFT_00021787 392
79 3300042593 Ga0466691_189486 Ga0466691_189486_612_1790 392
80 3300042599 Ga0466706_016460 Ga0466706_016460_3567_4745 392
81 3300042599 Ga0466706_044418 Ga0466706_044418_17382_18560 392
82 3300042609 Ga0466722_020309 Ga0466722_020309_1365_2543 392
83 iso_pr_bacteria 2910959314 2910961699 392
84 iso_pr_bacteria 2940205530 2940206983 392
85 iso_pr_bacteria 2940212447 2940213860 392
86 iso_pr_bacteria 2940298504 2940299952 392
87 iso_pr_bacteria 2940302308 2940303722 392
88 iso_pr_bacteria 2940306115 2940307196 392
89 iso_pr_bacteria 2940309933 2940311313 392
90 iso_pr_bacteria 2940313741 2940315087 392
91 iso_pr_bacteria 2940317558 2940318941 392
92 iso_pr_bacteria 2940321370 2940322713 392
93 iso_pr_bacteria 2940325180 2940326632 392
94 iso_pr_bacteria 2940328985 2940330399 392
95 iso_pr_bacteria 2940332795 2940334178 392
96 3300005071 Ga0068302_10095431 Ga0068302_100954312 393
97 3300005083 Ga0068305_10010843 Ga0068305_1001084320 393
98 3300042582 Ga0466657_296869 Ga0466657_296869_4022_5203 393
99 3300042590 Ga0466690_256751 Ga0466690_256751_38366_39547 393
100 3300042593 Ga0466691_079070 Ga0466691_079070_11319_12500 393
101 3300042595 Ga0466695_009046 Ga0466695_009046_288_1469 393
102 3300042596 Ga0466696_372942 Ga0466696_372942_771_1952 393
103 3300042600 Ga0466700_395184 Ga0466700_395184_80_1261 393
104 3300042601 Ga0466707_229623 Ga0466707_229623_2521_3702 393
105 3300042603 Ga0466714_035661 Ga0466714_035661_2273_3454 393
106 3300042603 Ga0466714_072010 Ga0466714_072010_1820_3001 393
107 3300042612 Ga0466705_174137 Ga0466705_174137_1192_2373 393
108 3300042613 Ga0466710_269805 Ga0466710_269805_4557_5738 393
109 3300042616 Ga0466715_163861 Ga0466715_163861_2384_3565 393
110 3300042620 Ga0466728_014387 Ga0466728_014387_205_1386 393
111 3300042620 Ga0466728_399687 Ga0466728_399687_439_1620 393
112 3300042636 Ga0466703_016865 Ga0466703_016865_89_1270 393
113 3300042636 Ga0466703_078920 Ga0466703_078920_2808_3989 393
114 3300042648 Ga0466709_288179 Ga0466709_288179_563_1744 393
115 3300042652 Ga0466708_010142 Ga0466708_010142_4947_6128 393
116 3300042655 Ga0466727_160380 Ga0466727_160380_483_1664 393
117 3300042659 Ga0466733_071155 Ga0466733_071155_144_1325 393
118 iso_pr_bacteria 2820759988 2820761353 393
119 iso_pr_bacteria 2910930387 2910933008 393
120 iso_pr_bacteria 2940244548 2940247633 393
121 iso_pr_bacteria 2940248789 2940252036 393
122 iso_pr_bacteria 2940253009 2940256130 393
123 iso_pr_bacteria 2940257232 2940260263 393
124 3300002509 JGI24699J35502_11133958 JGI24699J35502_1113395814 394
125 3300002834 JGI24696J40584_12959432 JGI24696J40584_129594322 394
126 3300042599 Ga0466706_039675 Ga0466706_039675_5660_6844 394
127 3300042601 Ga0466707_276019 Ga0466707_276019_303_1487 394
128 3300042602 Ga0466713_063524 Ga0466713_063524_6950_8134 394
129 3300042612 Ga0466705_422990 Ga0466705_422990_2086_3270 394
130 3300042655 Ga0466727_106490 Ga0466727_106490_712_1896 394
131 3300002509 JGI24699J35502_11134189 JGI24699J35502_1113418911 395
132 3300002509 JGI24699J35502_11134220 JGI24699J35502_111342206 395
133 3300005083 Ga0068305_10000339 Ga0068305_1000033957 395
134 3300042602 Ga0466713_150871 Ga0466713_150871_4057_5244 395
135 3300042636 Ga0466703_105441 Ga0466703_105441_1196_2383 395
136 3300042643 Ga0466704_333463 Ga0466704_333463_9896_11083 395
137 3300042648 Ga0466709_101990 Ga0466709_101990_7440_8627 395
138 3300042655 Ga0466727_092062 Ga0466727_092062_1131_2318 395
139 iso_pr_bacteria 2820757377 2820759626 395
140 2225789004 2227275242 2227726121 396
141 3300042619 Ga0466726_068442 Ga0466726_068442_1422_2612 396
142 3300042652 Ga0466708_246063 Ga0466708_246063_16127_17317 396
143 3300042602 Ga0466713_113095 Ga0466713_113095_17777_18970 397
144 3300042643 Ga0466704_216241 Ga0466704_216241_103_1296 397
145 3300042609 Ga0466722_205061 Ga0466722_205061_10139_11335 398
146 3300042618 Ga0466723_089568 Ga0466723_089568_18178_19374 398
147 3300042655 Ga0466727_251466 Ga0466727_251466_3619_4815 398
148 3300042625 Ga0466730_012275 Ga0466730_012275_1786_3003 405
149 3300042659 Ga0466733_077751 Ga0466733_077751_10490_11707 405
150 3300042616 Ga0466715_621075 Ga0466715_621075_60130_61350 406
151 iso_pr_bacteria 2940371297 2940373263 424

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF03786 UxuA D-mannonate dehydratase (UxuA) 35 418 0.97
PF01261 AP_endonuc_2 Xylose isomerase-like TIM barrel 249 371 0.83

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.88 0.92 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.