Protein Family IF13075

Metagenome Isolate
121 Members
52 Samples
102 Scaffolds
682.82 Avg Length

🧬 Representative Sequence

ID
iso_pr_bacteria|2940302308|2940302935|
Length
707 aa
Sequence
MLYLRMEKPVIDIDKRSITYLPGVGPKKAEVLKKEADISSFEDLLYYFPYRYVDRSRFYRVAEIHEGMPYIQLKGRILSFETLGEGRTRRLVARFTDGSGTIELVWFKGIAYVKDKYVIGKEYIVFGKPTAFGHTCNIAHPDIDSVDQAGQVSGGLTPYYNTTEKMKKSFLNSRTIQGLQYTLLSMLNWELPETLPADVLQKTKLVSRSEAIRNIHFPESAAALKQAQLRLKFEELFYIQLNILQTAAYRKLKLKGLVFSTVGEHFNTFYKDYLPFELTDAQKRVVREVRGDMGSGRQMNRLLQGDVGSGKTLVALLAMLLAIDNNYQACMMAPTEILANQHLVTVMEFLKDMNVRVALLTGSTKKKERDKILPAIAAGEIDIVIGTHALIEETVVFKSLGLAIVDEQHRFGVEQRAQLWKKNTTIPHVLVMTATPIPRTLAMTLYGDLDVSVIDQLPPGRKPVLTLHRYDNKKKELYEFLRKEIVLGRQVYVVYPLIEGSEKLDYKNLEEGFDVFKEVFPEYTVCMVHGRMKAAEKDAEMQKFISGEAQILMATTVIEVGVNVPNASVMVIESAERFGLSQLHQLRGRVGRGAEQSYCILVSSYKLSNETRKRLEIMVQTSNGFEIAEADLKMRGHGDLEGTRQSGIGIDLKIASLSSDGQILQYARDVAQDVLNLDPNLSECSHAILRKRLSVLFEKKTNWGMIS

📊 Sample Types

Isolate 15.7%
Metagenome 84.3%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Blattidae 37.3%
Kalotermitidae 27.5%
Termitidae 11.8%
Passalidae 5.9%
Unclassified 5.9%
Termopsidae 5.9%
Rhinotermitidae 3.9%
Hodotermitidae 2.0%

🌳 Taxonomy

Archaea 0
Bacteria 120
Eukaryota 0
Viruses 0
Unclassified 1

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2940199050 Parabacteroides sp. PM6-13 Isolate Blattidae
2 2940202316 Parabacteroides sp. PF5-9 Isolate Blattidae
3 2940371297 Parabacteroides sp. PM5-20 Isolate Blattidae
4 3300024582 Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 Metagenome
5 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
6 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
7 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
8 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
9 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
10 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
11 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
12 2923982719 Parabacteroides sp. 52 Isolate Blattidae
13 2940306115 Parabacteroides sp. PFB2-22 Isolate Blattidae
14 2940309933 Parabacteroides sp. PH5-13 Isolate Blattidae
15 2940328985 Parabacteroides sp. PH5-46 Isolate Blattidae
16 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
17 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
18 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
19 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
20 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
21 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
22 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
23 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
24 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
25 2225789003 Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) Metagenome Passalidae
26 2940212447 Parabacteroides sp. PH5-16 Isolate Blattidae
27 2940302308 Parabacteroides sp. PF5-5 Isolate Blattidae
28 2940321370 Parabacteroides sp. PH5-39 Isolate Blattidae
29 2940332795 Parabacteroides sp. PH5-8 Isolate Blattidae
30 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
31 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
32 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
33 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
34 2940313741 Parabacteroides sp. PH5-17 Isolate Blattidae
35 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
36 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
37 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
38 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
39 2940195863 Parabacteroides sp. PF5-6 Isolate Blattidae
40 2940209341 Parabacteroides sp. PFB2-10 Isolate Blattidae
41 2940298504 Parabacteroides sp. PF5-13 Isolate Blattidae
42 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
43 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
44 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
45 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
46 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
47 2940346213 Parabacteroides sp. PFB2-12 Isolate Blattidae
48 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
49 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
50 2940205530 Parabacteroides sp. PH5-33 Isolate Blattidae
51 2940317558 Parabacteroides sp. PH5-26 Isolate Blattidae
52 2940325180 Parabacteroides sp. PH5-41 Isolate Blattidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466733_000712 3300042659 Bacteria 18066
2 Ga0466708_314705 3300042652 Bacteria 32048
3 Ga0466711_366859 3300042615 Bacteria 14957
4 Ga0466715_016154 3300042616 Bacteria 10007
5 IMNBL1DRAFT_c0000425 3300000062 Bacteria 35440
6 JGI24702J35022_10003876 3300002462 Bacteria 8973
7 JGI24702J35022_10008441 3300002462 Bacteria 5828
8 Ga0466657_017251 3300042582 Bacteria 33226
9 Ga0466692_095605 3300042591 Bacteria 21856
10 Ga0466696_345491 3300042596 Bacteria 31360
11 Ga0466696_364335 3300042596 Bacteria 6381
12 Ga0466716_438073 3300042605 Bacteria 28886
13 Ga0466722_013414 3300042609 Bacteria 34349
14 Ga0466705_033838 3300042612 Bacteria 10009
15 Ga0466735_026871 3300042624 Bacteria 47904
16 Ga0466703_197495 3300042636 Bacteria 27336
17 Ga0466704_108124 3300042643 Bacteria 8750
18 Ga0466704_131513 3300042643 Bacteria 17215
19 Ga0466704_152291 3300042643 Bacteria 6219
20 Ga0466704_236764 3300042643 Bacteria 4009
21 Ga0466709_083357 3300042648 Bacteria 39489
22 Ga0466708_377243 3300042652 Bacteria 7944
23 Ga0466711_346410 3300042615 Bacteria 12906
24 Ga0466715_432426 3300042616 Bacteria 8169
25 Ga0466723_298572 3300042618 Bacteria 9528
26 Ga0466728_282666 3300042620 Bacteria 52404
27 2226980363 2225789003 Bacteria 39299
28 Ga0466706_105640 3300042599 Bacteria 39915
29 Ga0466713_098989 3300042602 Bacteria 18122
30 Ga0466716_236307 3300042605 Bacteria 13040
31 Ga0466716_374444 3300042605 Bacteria 10373
32 Ga0466716_429212 3300042605 Bacteria 5595
33 Ga0466703_143736 3300042636 Bacteria 14178
34 Ga0466709_341052 3300042648 Bacteria 7543
35 Ga0466708_253997 3300042652 Bacteria 12551
36 Ga0466727_328786 3300042655 Bacteria 4323
37 Ga0466711_262846 3300042615 Bacteria 4229
38 Ga0466690_237804 3300042590 Bacteria 15962
39 Ga0466696_222239 3300042596 Bacteria 6041
40 Ga0466719_017423 3300042606 Bacteria 18388
41 Ga0466719_566263 3300042606 Bacteria 3412
42 Ga0466703_135301 3300042636 Bacteria 13728
43 Ga0466703_405482 3300042636 Bacteria 7929
44 Ga0466704_306332 3300042643 Bacteria 8556
45 Ga0466704_348459 3300042643 Bacteria 12550
46 Ga0466708_110381 3300042652 Unclassified 5212
47 IMNBL1DRAFT_c0003075 3300000062 Bacteria 11018
48 IMNBL1DRAFT_c0007071 3300000062 Bacteria 5975
49 Ga0466690_038157 3300042590 Bacteria 30366
50 Ga0466691_060982 3300042593 Bacteria 10960
51 Ga0466733_036439 3300042659 Bacteria 2884
52 Ga0466733_180514 3300042659 Bacteria 51608
53 Ga0466704_251609 3300042643 Bacteria 45182
54 Ga0466704_466683 3300042643 Bacteria 20367
55 Ga0466715_170709 3300042616 Bacteria 31822
56 Ga0466723_199549 3300042618 Bacteria 29083
57 Ga0466728_200547 3300042620 Bacteria 11228
58 Ga0466690_195206 3300042590 Bacteria 8881
59 Ga0466690_402356 3300042590 Bacteria 64397
60 Ga0466719_058000 3300042606 Bacteria 9226
61 Ga0466722_117304 3300042609 Bacteria 122884
62 Ga0466722_131065 3300042609 Bacteria 14179
63 Ga0123353_10016860 3300010167 Bacteria 10700
64 Ga0466703_348271 3300042636 Bacteria 2948
65 Ga0466704_437179 3300042643 Bacteria 6863
66 Ga0466708_047593 3300042652 Bacteria 5569
67 Ga0466711_074773 3300042615 Bacteria 6626
68 Ga0466715_056991 3300042616 Bacteria 24202
69 Ga0466715_162456 3300042616 Bacteria 4920
70 Ga0466715_215776 3300042616 Bacteria 39785
71 Ga0466726_274599 3300042619 Bacteria 2859
72 Ga0466728_030496 3300042620 Bacteria 10948
73 JGI24702J35022_10026021 3300002462 Bacteria 3154
74 Ga0466690_122659 3300042590 Bacteria 11163
75 Ga0466706_094705 3300042599 Bacteria 26280
76 Ga0466713_070515 3300042602 Bacteria 21153
77 Ga0466716_306257 3300042605 Bacteria 14675
78 Ga0466732_394096 3300042656 Bacteria 12185
79 Ga0466727_032457 3300042655 Bacteria 13166
80 Ga0466715_050477 3300042616 Bacteria 53095
81 2227619058 2225789004 Bacteria 45134
82 Ga0068305_10048715 3300005083 Bacteria 4192
83 Ga0466696_010344 3300042596 Bacteria 7486
84 Ga0466707_048902 3300042601 Bacteria 3199
85 Ga0466707_377418 3300042601 Bacteria 7096
86 Ga0466722_058847 3300042609 Bacteria 5707
87 Ga0466705_287750 3300042612 Bacteria 7024
88 Ga0466705_347674 3300042612 Bacteria 29568
89 Ga0466709_275063 3300042648 Bacteria 136526
90 Ga0466711_029243 3300042615 Bacteria 21118
91 Ga0466711_268980 3300042615 Bacteria 10316
92 Ga0466711_467682 3300042615 Bacteria 24337
93 Ga0466715_100800 3300042616 Bacteria 5189
94 Ga0466715_529663 3300042616 Bacteria 3186
95 2227494083 2225789004 Bacteria 20109
96 IMNBL1DRAFT_c0000206 3300000062 Bacteria 51916
97 Ga0265387_1001066 3300024582 Bacteria 4081
98 Ga0466691_070237 3300042593 Bacteria 13056
99 Ga0466696_001911 3300042596 Bacteria 82336
100 Ga0466713_002896 3300042602 Bacteria 13006
101 Ga0466713_029067 3300042602 Bacteria 9786
102 Ga0123356_10034749 3300010049 Bacteria 4711

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042606 Ga0466719_566263 Ga0466719_566263_1682_3391 546
2 3300042620 Ga0466728_200547 Ga0466728_200547_2361_4145 594
3 3300042636 Ga0466703_405482 Ga0466703_405482_58_1980 621
4 2225789003 2226980363 2227324510 658
5 3300042624 Ga0466735_026871 Ga0466735_026871_30532_32643 658
6 3300042652 Ga0466708_110381 Ga0466708_110381_2214_4310 660
7 3300024582 Ga0265387_1001066 Ga0265387_10010665 662
8 3300042609 Ga0466722_117304 Ga0466722_117304_10249_12348 662
9 2225789004 2227619058 2228196293 663
10 3300042602 Ga0466713_070515 Ga0466713_070515_16569_18563 664
11 3300042616 Ga0466715_056991 Ga0466715_056991_5739_7793 664
12 3300042590 Ga0466690_038157 Ga0466690_038157_6470_8539 666
13 3300042616 Ga0466715_100800 Ga0466715_100800_82_2085 667
14 3300042619 Ga0466726_274599 Ga0466726_274599_552_2618 669
15 3300042643 Ga0466704_437179 Ga0466704_437179_3797_5866 669
16 3300042659 Ga0466733_180514 Ga0466733_180514_5106_7175 669
17 3300042596 Ga0466696_010344 Ga0466696_010344_4964_7033 671
18 3300042655 Ga0466727_328786 Ga0466727_328786_1428_3497 671
19 3300042605 Ga0466716_374444 Ga0466716_374444_1066_3135 672
20 3300042612 Ga0466705_287750 Ga0466705_287750_879_2948 672
21 3300002462 JGI24702J35022_10008441 JGI24702J35022_100084415 673
22 3300042596 Ga0466696_345491 Ga0466696_345491_14476_16638 673
23 3300042593 Ga0466691_070237 Ga0466691_070237_2108_4204 674
24 3300042599 Ga0466706_094705 Ga0466706_094705_11687_13783 674
25 3300042599 Ga0466706_105640 Ga0466706_105640_28558_30654 674
26 3300042615 Ga0466711_467682 Ga0466711_467682_19669_21765 674
27 3300042616 Ga0466715_215776 Ga0466715_215776_18078_20174 674
28 3300042620 Ga0466728_282666 Ga0466728_282666_41950_44046 674
29 3300042648 Ga0466709_083357 Ga0466709_083357_29646_31742 674
30 3300042601 Ga0466707_048902 Ga0466707_048902_671_2770 675
31 3300042615 Ga0466711_268980 Ga0466711_268980_1177_3276 675
32 3300042636 Ga0466703_135301 Ga0466703_135301_5627_7723 675
33 3300042609 Ga0466722_131065 Ga0466722_131065_11003_13072 676
34 3300000062 IMNBL1DRAFT_c0000425 IMNBL1DRAFT_000042524 677
35 3300005083 Ga0068305_10048715 Ga0068305_100487152 677
36 3300042582 Ga0466657_017251 Ga0466657_017251_26732_28831 677
37 3300042605 Ga0466716_429212 Ga0466716_429212_1853_3949 677
38 2225789004 2227494083 2227969509 678
39 3300042590 Ga0466690_402356 Ga0466690_402356_17261_19357 678
40 3300042596 Ga0466696_001911 Ga0466696_001911_60893_62989 678
41 3300042602 Ga0466713_029067 Ga0466713_029067_6768_8858 678
42 3300042612 Ga0466705_347674 Ga0466705_347674_23843_25939 678
43 3300042615 Ga0466711_366859 Ga0466711_366859_4367_6436 678
44 3300042616 Ga0466715_170709 Ga0466715_170709_2748_4844 678
45 3300042618 Ga0466723_298572 Ga0466723_298572_5061_7154 678
46 3300042620 Ga0466728_030496 Ga0466728_030496_1783_3879 678
47 3300042643 Ga0466704_108124 Ga0466704_108124_4950_7046 678
48 3300042643 Ga0466704_131513 Ga0466704_131513_9539_11635 678
49 3300042659 Ga0466733_000712 Ga0466733_000712_7211_9310 678
50 3300000062 IMNBL1DRAFT_c0003075 IMNBL1DRAFT_00030756 679
51 3300042590 Ga0466690_195206 Ga0466690_195206_746_2842 679
52 3300042605 Ga0466716_236307 Ga0466716_236307_4579_6675 679
53 3300042605 Ga0466716_306257 Ga0466716_306257_9813_11909 679
54 3300042615 Ga0466711_029243 Ga0466711_029243_11903_13999 679
55 3300042615 Ga0466711_346410 Ga0466711_346410_3709_5805 679
56 3300042616 Ga0466715_162456 Ga0466715_162456_1120_3216 679
57 3300042618 Ga0466723_199549 Ga0466723_199549_1000_3096 679
58 3300042636 Ga0466703_143736 Ga0466703_143736_6674_8770 679
59 3300042652 Ga0466708_253997 Ga0466708_253997_4791_6887 679
60 3300000062 IMNBL1DRAFT_c0000206 IMNBL1DRAFT_00002065 680
61 3300042593 Ga0466691_060982 Ga0466691_060982_5745_7841 680
62 3300002462 JGI24702J35022_10003876 JGI24702J35022_100038766 681
63 3300042612 Ga0466705_033838 Ga0466705_033838_957_3026 681
64 3300042616 Ga0466715_016154 Ga0466715_016154_1587_3686 681
65 3300042643 Ga0466704_251609 Ga0466704_251609_32545_34614 681
66 3300042590 Ga0466690_122659 Ga0466690_122659_7088_9184 682
67 3300042652 Ga0466708_047593 Ga0466708_047593_769_2865 682
68 3300042591 Ga0466692_095605 Ga0466692_095605_249_2345 684
69 3300042655 Ga0466727_032457 Ga0466727_032457_10143_12212 684
70 3300042605 Ga0466716_438073 Ga0466716_438073_6743_8839 686
71 3300042601 Ga0466707_377418 Ga0466707_377418_2234_4327 688
72 3300042609 Ga0466722_013414 Ga0466722_013414_22795_24891 688
73 3300042643 Ga0466704_152291 Ga0466704_152291_1122_3218 688
74 3300042652 Ga0466708_314705 Ga0466708_314705_5310_7376 688
75 3300010049 Ga0123356_10034749 Ga0123356_100347496 689
76 3300042615 Ga0466711_074773 Ga0466711_074773_2372_4441 689
77 3300042616 Ga0466715_529663 Ga0466715_529663_428_2497 689
78 3300042636 Ga0466703_348271 Ga0466703_348271_866_2935 689
79 3300042643 Ga0466704_236764 Ga0466704_236764_908_2977 689
80 3300042643 Ga0466704_306332 Ga0466704_306332_1947_4016 689
81 3300042643 Ga0466704_466683 Ga0466704_466683_15865_17934 689
82 3300042606 Ga0466719_017423 Ga0466719_017423_11450_13528 692
83 3300042648 Ga0466709_341052 Ga0466709_341052_5057_7195 696
84 3300042596 Ga0466696_364335 Ga0466696_364335_416_2509 697
85 3300042609 Ga0466722_058847 Ga0466722_058847_3239_5332 697
86 3300042616 Ga0466715_432426 Ga0466715_432426_5201_7294 697
87 3300042643 Ga0466704_348459 Ga0466704_348459_3105_5198 697
88 3300002462 JGI24702J35022_10026021 JGI24702J35022_100260211 698
89 3300042636 Ga0466703_197495 Ga0466703_197495_457_2553 698
90 iso_pr_bacteria 2940199050 2940199221 698
91 iso_pr_bacteria 2940202316 2940202928 698
92 iso_pr_bacteria 2940209341 2940210287 698
93 iso_pr_bacteria 2940346213 2940346283 698
94 3300000062 IMNBL1DRAFT_c0007071 IMNBL1DRAFT_00070711 699
95 3300042602 Ga0466713_002896 Ga0466713_002896_7028_9127 699
96 3300042602 Ga0466713_098989 Ga0466713_098989_14770_16869 699
97 3300042615 Ga0466711_262846 Ga0466711_262846_1007_3106 699
98 iso_pr_bacteria 2923982719 2923983348 699
99 iso_pr_bacteria 2940195863 2940197086 699
100 iso_pr_bacteria 2940371297 2940372644 699
101 3300010167 Ga0123353_10016860 Ga0123353_100168602 701
102 3300042656 Ga0466732_394096 Ga0466732_394096_3332_5437 701
103 3300042652 Ga0466708_377243 Ga0466708_377243_4433_6595 702
104 3300042590 Ga0466690_237804 Ga0466690_237804_6819_8930 703
105 3300042596 Ga0466696_222239 Ga0466696_222239_3591_5702 703
106 3300042616 Ga0466715_050477 Ga0466715_050477_28434_30545 703
107 3300042648 Ga0466709_275063 Ga0466709_275063_40124_42235 703
108 3300042659 Ga0466733_036439 Ga0466733_036439_707_2818 703
109 3300042606 Ga0466719_058000 Ga0466719_058000_277_2400 707
110 iso_pr_bacteria 2940205530 2940206021 707
111 iso_pr_bacteria 2940212447 2940212936 707
112 iso_pr_bacteria 2940298504 2940298993 707
113 iso_pr_bacteria 2940302308 2940302935 707
114 iso_pr_bacteria 2940306115 2940306345 707
115 iso_pr_bacteria 2940309933 2940310024 707
116 iso_pr_bacteria 2940313741 2940313832 707
117 iso_pr_bacteria 2940317558 2940317786 707
118 iso_pr_bacteria 2940321370 2940321461 707
119 iso_pr_bacteria 2940325180 2940325807 707
120 iso_pr_bacteria 2940328985 2940329613 707
121 iso_pr_bacteria 2940332795 2940333025 707

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF19833 RecG_dom3_C ATP-dependent DNA helicase RecG, domain 3, C-terminal 621 707 0.99
PF17191 RecG_wedge RecG wedge domain 18 169 0.9
PF01336 tRNA_anti-codon OB-fold nucleic acid binding domain 72 143 0.89
PF00176 SNF2-rel_dom SNF2-related domain 298 441 0.84
PF00271 Helicase_C Helicase conserved C-terminal domain 476 592 0.83
PF00270 DEAD DEAD/DEAH box helicase 280 442 0.83
PF04851 ResIII Type III restriction enzyme, res subunit 276 436 0.82

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF01336 GO:0003676 nucleic acid binding MF

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.71 0.72 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.