Protein Family IF13060

Metagenome Isolate
157 Members
73 Samples
123 Scaffolds
265.92 Avg Length

🧬 Representative Sequence

ID
iso_pr_bacteria|2940202316|2940202322|
Length
306 aa
Sequence
MILIAVISLGSIGAVGALLLYAASKKFEVYEDPRIAQVQDALPAANCGGCGFPGCAGFASACVKADSLDHLYCPVGGTEVMSKVAAILGKEAGTADPMVAVVRCNGTCAARPKTNQYDGAQTCAIASALYGGETGCTYGCLGFGDCVTVCDFDAIHINPETGLPEVIEDKCTSCGACVKACPKSIIELRKKGPKSRRVFVSCINKDKGALARKACANACIGCGKCVKECPFEAITLENNLAYIDYDKCRVCRKCVPVCPTGAIWEVNFPPRKEKEAVQSNPEEGKTPSSEQTPGTDGTTEKIIQHK

📊 Sample Types

Isolate 21.7%
Metagenome 78.3%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Blattidae 36.1%
Kalotermitidae 19.4%
Termitidae 18.1%
Unclassified 13.9%
Rhinotermitidae 4.2%
Termopsidae 4.2%
Passalidae 2.8%
Hodotermitidae 1.4%

🌳 Taxonomy

Archaea 0
Bacteria 153
Eukaryota 0
Viruses 0
Unclassified 4

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820757377 Unclassified Bacteroidetes Mp193P4bin6 Isolate Unclassified
2 2820788205 Unclassified Bacteroidetes Emb289P1bin57 Isolate Unclassified
3 2940199050 Parabacteroides sp. PM6-13 Isolate Blattidae
4 2940202316 Parabacteroides sp. PF5-9 Isolate Blattidae
5 2940371297 Parabacteroides sp. PM5-20 Isolate Blattidae
6 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
7 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
8 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
9 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
10 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
11 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
12 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
13 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
14 2940195863 Parabacteroides sp. PF5-6 Isolate Blattidae
15 2940209341 Parabacteroides sp. PFB2-10 Isolate Blattidae
16 2940298504 Parabacteroides sp. PF5-13 Isolate Blattidae
17 3004667792 Bacteroides sp. 519 Isolate Blattidae
18 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
19 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
20 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
21 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
22 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
23 2820767225 Unclassified Bacteroidetes Lab288P3bin34 Isolate Unclassified
24 2609459943 Bacteroides reticulotermitis JCM 10512 Isolate Rhinotermitidae
25 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
26 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
27 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
28 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
29 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
30 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
31 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
32 2920168565 Paludibacter sp. 221 Isolate Blattidae
33 2940205530 Parabacteroides sp. PH5-33 Isolate Blattidae
34 2940216256 Dysgonomonadaceae bacterium PH5-43 Isolate Blattidae
35 2940317558 Parabacteroides sp. PH5-26 Isolate Blattidae
36 2940325180 Parabacteroides sp. PH5-41 Isolate Blattidae
37 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
38 2830041218 Bacteroides reticulotermitis DSM 105720 Isolate Unclassified
39 2910930387 Dysgonomonas sp. 216 Isolate Blattidae
40 2940212447 Parabacteroides sp. PH5-16 Isolate Blattidae
41 2940302308 Parabacteroides sp. PF5-5 Isolate Blattidae
42 2940321370 Parabacteroides sp. PH5-39 Isolate Blattidae
43 2940332795 Parabacteroides sp. PH5-8 Isolate Blattidae
44 2225789003 Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) Metagenome Passalidae
45 3004672520 Bacteroides sp. 51 Isolate Blattidae
46 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
47 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
48 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
49 2820774381 Unclassified Bacteroidetes Lab288P1bin37 Isolate Unclassified
50 2922326829 Bacteroides sp. 224 Isolate Blattidae
51 2940313741 Parabacteroides sp. PH5-17 Isolate Blattidae
52 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
53 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
54 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
55 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
56 2923982719 Parabacteroides sp. 52 Isolate Blattidae
57 2940306115 Parabacteroides sp. PFB2-22 Isolate Blattidae
58 2940309933 Parabacteroides sp. PH5-13 Isolate Blattidae
59 2940328985 Parabacteroides sp. PH5-46 Isolate Blattidae
60 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
61 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
62 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
63 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
64 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
65 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
66 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
67 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
68 2820772500 Unclassified Bacteroidetes Lab288P1bin72 Isolate Unclassified
69 2820785563 Unclassified Bacteroidetes Emb289P1bin74 Isolate Unclassified
70 2940346213 Parabacteroides sp. PFB2-12 Isolate Blattidae
71 3004677695 Bacteroides sp. 214 Isolate Blattidae
72 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
73 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466733_108832 3300042659 Bacteria 18233
2 Ga0123355_10000066 3300009826 Bacteria 112451
3 Ga0123356_10115137 3300010049 Bacteria 2605
4 Ga0466711_267972 3300042615 Bacteria 4333
5 Ga0466715_113935 3300042616 Bacteria 7771
6 Ga0466723_231722 3300042618 Bacteria 6415
7 Ga0466729_083010 3300042621 Bacteria 16334
8 2227554893 2225789004 Bacteria 2802
9 Ga0466706_068976 3300042599 Bacteria 62328
10 Ga0466706_082746 3300042599 Unclassified 8043
11 Ga0466706_129682 3300042599 Bacteria 50477
12 Ga0466707_332168 3300042601 Bacteria 1257
13 Ga0466696_178044 3300042596 Bacteria 3034
14 Ga0466703_400304 3300042636 Bacteria 16695
15 Ga0466704_252197 3300042643 Bacteria 2807
16 Ga0466704_579039 3300042643 Bacteria 1353
17 Ga0466725_054758 3300042654 Bacteria 4059
18 Ga0466697_127599 3300042611 Bacteria 18079
19 Ga0466723_075931 3300042618 Bacteria 72847
20 Ga0466728_057961 3300042620 Bacteria 56835
21 2227541031 2225789004 Bacteria 2988
22 JGI24702J35022_10161066 3300002462 Bacteria 1264
23 Ga0068305_10016637 3300005083 Bacteria 21059
24 Ga0466707_130825 3300042601 Bacteria 5810
25 Ga0466716_109500 3300042605 Bacteria 25649
26 Ga0466719_152967 3300042606 Bacteria 2512
27 Ga0466691_048035 3300042593 Bacteria 1517
28 Ga0466696_317252 3300042596 Bacteria 26380
29 Ga0466696_432652 3300042596 Bacteria 1230
30 Ga0466735_083079 3300042624 Bacteria 2149
31 Ga0466704_009251 3300042643 Unclassified 4851
32 Ga0466704_266903 3300042643 Bacteria 41558
33 Ga0466705_151337 3300042612 Bacteria 6479
34 Ga0466715_589396 3300042616 Bacteria 12774
35 2227493803 2225789004 Bacteria 4002
36 Ga0068305_10058765 3300005083 Bacteria 7893
37 Ga0466706_039016 3300042599 Bacteria 1977
38 Ga0466706_051177 3300042599 Bacteria 66113
39 Ga0466716_283586 3300042605 Bacteria 36250
40 Ga0466656_313567 3300042550 Bacteria 5028
41 Ga0466690_325101 3300042590 Bacteria 7661
42 Ga0466735_002456 3300042624 Bacteria 12388
43 Ga0466703_029735 3300042636 Bacteria 12751
44 Ga0466703_291043 3300042636 Bacteria 27662
45 Ga0466708_034052 3300042652 Bacteria 11502
46 Ga0466708_235488 3300042652 Bacteria 24641
47 Ga0466727_055911 3300042655 Bacteria 9680
48 Ga0466727_169926 3300042655 Bacteria 8533
49 Ga0466697_106599 3300042611 Bacteria 91903
50 Ga0466705_202926 3300042612 Bacteria 22976
51 Ga0466705_331369 3300042612 Bacteria 5598
52 Ga0466732_261268 3300042656 Bacteria 5072
53 Ga0123355_10000037 3300009826 Bacteria 130470
54 Ga0466710_121363 3300042613 Bacteria 20587
55 Ga0466715_045980 3300042616 Bacteria 33517
56 Ga0466715_397213 3300042616 Bacteria 16485
57 Ga0072941_1308119 3300005201 Bacteria 4615
58 Ga0466706_060125 3300042599 Bacteria 2970
59 Ga0466706_138668 3300042599 Bacteria 11264
60 Ga0466713_110171 3300042602 Bacteria 1475
61 Ga0466719_325683 3300042606 Bacteria 5356
62 Ga0466691_002166 3300042593 Bacteria 21986
63 Ga0466691_163416 3300042593 Bacteria 43349
64 Ga0466696_095712 3300042596 Bacteria 8472
65 Ga0466703_318215 3300042636 Bacteria 7867
66 Ga0466704_014546 3300042643 Bacteria 4885
67 Ga0466704_229792 3300042643 Bacteria 44121
68 Ga0466709_015779 3300042648 Bacteria 19140
69 Ga0466705_242421 3300042612 Bacteria 31459
70 Ga0466710_033475 3300042613 Bacteria 1649
71 Ga0466715_289503 3300042616 Bacteria 56247
72 Ga0466706_188691 3300042599 Bacteria 5667
73 Ga0466714_027149 3300042603 Bacteria 1168
74 Ga0466719_258826 3300042606 Bacteria 13818
75 Ga0466690_143976 3300042590 Bacteria 7899
76 Ga0466703_057153 3300042636 Bacteria 14977
77 Ga0466709_151074 3300042648 Bacteria 5433
78 Ga0466708_232699 3300042652 Bacteria 12793
79 Ga0466728_461003 3300042620 Bacteria 2356
80 2226980369 2225789003 Bacteria 34607
81 JGI24702J35022_10107509 3300002462 Bacteria 1532
82 JGI24699J35502_11133978 3300002509 Bacteria 22406
83 Ga0466707_198130 3300042601 Bacteria 6400
84 Ga0466713_106369 3300042602 Bacteria 1542
85 Ga0466714_006756 3300042603 Bacteria 211810
86 Ga0466714_041294 3300042603 Bacteria 4234
87 Ga0466719_130583 3300042606 Bacteria 12871
88 Ga0466690_014363 3300042590 Bacteria 61479
89 Ga0466693_192059 3300042592 Bacteria 1561
90 Ga0466696_485112 3300042596 Bacteria 7496
91 Ga0466735_183523 3300042624 Unclassified 1349
92 Ga0466704_206738 3300042643 Bacteria 7961
93 Ga0466725_259465 3300042654 Bacteria 1728
94 Ga0466727_196236 3300042655 Bacteria 1390
95 Ga0466711_034823 3300042615 Bacteria 24346
96 Ga0466723_216363 3300042618 Bacteria 9719
97 Ga0466728_004763 3300042620 Bacteria 36943
98 Ga0466713_118123 3300042602 Bacteria 66356
99 Ga0466696_049124 3300042596 Bacteria 3972
100 Ga0466735_051013 3300042624 Bacteria 5895
101 Ga0466735_225962 3300042624 Bacteria 2382
102 Ga0466704_306015 3300042643 Bacteria 16226
103 Ga0466709_003381 3300042648 Bacteria 24947
104 Ga0466727_173972 3300042655 Bacteria 11139
105 Ga0466705_329189 3300042612 Bacteria 2553
106 Ga0466733_012710 3300042659 Bacteria 11988
107 Ga0466711_289496 3300042615 Unclassified 6579
108 Ga0466726_096678 3300042619 Bacteria 11771
109 Ga0466728_380574 3300042620 Bacteria 13542
110 Ga0466728_402448 3300042620 Bacteria 13423
111 2227619054 2225789004 Bacteria 45751
112 Ga0466706_138140 3300042599 Bacteria 6931
113 Ga0466713_050988 3300042602 Bacteria 3335
114 Ga0466719_150749 3300042606 Bacteria 8865
115 Ga0466722_209353 3300042609 Bacteria 1982
116 Ga0466722_219747 3300042609 Bacteria 3741
117 Ga0466690_031196 3300042590 Bacteria 10289
118 Ga0466696_124388 3300042596 Bacteria 36262
119 Ga0466696_325262 3300042596 Bacteria 5974
120 Ga0466704_063265 3300042643 Bacteria 9008
121 Ga0466724_59296 3300042649 Bacteria 1922
122 Ga0466727_126471 3300042655 Bacteria 9058
123 Ga0466727_303169 3300042655 Bacteria 3509

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042624 Ga0466735_002456 Ga0466735_002456_878_1726 219
2 3300042590 Ga0466690_031196 Ga0466690_031196_655_1506 222
3 3300042596 Ga0466696_485112 Ga0466696_485112_5557_6402 224
4 3300042616 Ga0466715_045980 Ga0466715_045980_2070_2933 224
5 3300042652 Ga0466708_034052 Ga0466708_034052_5636_6502 225
6 3300042599 Ga0466706_082746 Ga0466706_082746_5992_6858 226
7 3300042590 Ga0466690_325101 Ga0466690_325101_2225_3088 227
8 3300042620 Ga0466728_402448 Ga0466728_402448_127_993 231
9 3300042606 Ga0466719_152967 Ga0466719_152967_1120_1959 232
10 3300042648 Ga0466709_003381 Ga0466709_003381_19874_20740 232
11 3300042619 Ga0466726_096678 Ga0466726_096678_6258_7088 234
12 3300042616 Ga0466715_397213 Ga0466715_397213_5819_6604 235
13 3300042624 Ga0466735_083079 Ga0466735_083079_1006_1875 236
14 3300042643 Ga0466704_579039 Ga0466704_579039_42_896 240
15 3300042655 Ga0466727_169926 Ga0466727_169926_6278_7120 240
16 3300042596 Ga0466696_124388 Ga0466696_124388_27827_28693 242
17 3300042599 Ga0466706_068976 Ga0466706_068976_14473_15339 244
18 3300042611 Ga0466697_127599 Ga0466697_127599_540_1388 245
19 3300042593 Ga0466691_002166 Ga0466691_002166_6073_6906 246
20 3300042599 Ga0466706_129682 Ga0466706_129682_3630_4463 246
21 3300042616 Ga0466715_289503 Ga0466715_289503_26629_27477 246
22 3300042621 Ga0466729_083010 Ga0466729_083010_4373_5233 246
23 3300042659 Ga0466733_012710 Ga0466733_012710_2403_3266 246
24 3300042593 Ga0466691_163416 Ga0466691_163416_26219_27079 247
25 3300042599 Ga0466706_039016 Ga0466706_039016_582_1442 247
26 3300042636 Ga0466703_318215 Ga0466703_318215_5280_6095 247
27 3300042652 Ga0466708_232699 Ga0466708_232699_977_1840 247
28 3300042599 Ga0466706_138140 Ga0466706_138140_1739_2596 249
29 3300042603 Ga0466714_027149 Ga0466714_027149_234_1091 249
30 3300042643 Ga0466704_266903 Ga0466704_266903_31212_32066 249
31 3300042648 Ga0466709_151074 Ga0466709_151074_2557_3396 249
32 3300042596 Ga0466696_095712 Ga0466696_095712_5523_6392 250
33 3300042605 Ga0466716_283586 Ga0466716_283586_29545_30510 250
34 3300042606 Ga0466719_258826 Ga0466719_258826_2388_3245 250
35 3300042609 Ga0466722_209353 Ga0466722_209353_570_1403 250
36 3300042624 Ga0466735_051013 Ga0466735_051013_1211_2080 250
37 3300042624 Ga0466735_183523 Ga0466735_183523_126_995 250
38 3300042624 Ga0466735_225962 Ga0466735_225962_835_1704 250
39 3300042636 Ga0466703_057153 Ga0466703_057153_1915_2775 250
40 3300042616 Ga0466715_113935 Ga0466715_113935_4054_4905 252
41 3300042599 Ga0466706_060125 Ga0466706_060125_1627_2490 253
42 3300042601 Ga0466707_130825 Ga0466707_130825_2459_3319 253
43 3300042605 Ga0466716_109500 Ga0466716_109500_21744_22586 253
44 3300042615 Ga0466711_034823 Ga0466711_034823_6085_6948 253
45 3300042655 Ga0466727_173972 Ga0466727_173972_5488_6312 253
46 3300042655 Ga0466727_196236 Ga0466727_196236_225_1076 253
47 3300002509 JGI24699J35502_11133978 JGI24699J35502_111339784 254
48 3300042596 Ga0466696_049124 Ga0466696_049124_1089_1952 254
49 3300042643 Ga0466704_252197 Ga0466704_252197_143_1006 254
50 3300042652 Ga0466708_235488 Ga0466708_235488_2308_3156 254
51 3300042596 Ga0466696_178044 Ga0466696_178044_2024_2872 255
52 3300042606 Ga0466719_325683 Ga0466719_325683_254_1075 255
53 3300042612 Ga0466705_242421 Ga0466705_242421_22367_23266 255
54 3300042659 Ga0466733_108832 Ga0466733_108832_2466_3320 256
55 3300042596 Ga0466696_432652 Ga0466696_432652_228_1070 257
56 3300042620 Ga0466728_057961 Ga0466728_057961_3317_4168 257
57 3300042590 Ga0466690_143976 Ga0466690_143976_4554_5414 258
58 3300042612 Ga0466705_151337 Ga0466705_151337_5141_5995 258
59 3300042618 Ga0466723_231722 Ga0466723_231722_47_910 258
60 3300042643 Ga0466704_009251 Ga0466704_009251_1802_2665 258
61 3300042649 Ga0466724_59296 Ga0466724_59296_237_1121 258
62 2225789004 2227541031 2228062596 259
63 3300042613 Ga0466710_121363 Ga0466710_121363_12119_13003 259
64 3300042615 Ga0466711_289496 Ga0466711_289496_4559_5428 259
65 3300009826 Ga0123355_10000066 Ga0123355_1000006633 260
66 3300010049 Ga0123356_10115137 Ga0123356_101151373 260
67 3300042599 Ga0466706_138668 Ga0466706_138668_2094_2951 260
68 3300042602 Ga0466713_118123 Ga0466713_118123_49605_50438 260
69 3300042620 Ga0466728_380574 Ga0466728_380574_10390_11319 260
70 3300002462 JGI24702J35022_10161066 JGI24702J35022_101610662 261
71 3300005083 Ga0068305_10016637 Ga0068305_100166372 261
72 3300042602 Ga0466713_110171 Ga0466713_110171_253_1119 261
73 3300042615 Ga0466711_267972 Ga0466711_267972_1152_2021 261
74 3300042654 Ga0466725_259465 Ga0466725_259465_738_1580 263
75 3300042601 Ga0466707_332168 Ga0466707_332168_96_959 264
76 3300042592 Ga0466693_192059 Ga0466693_192059_443_1366 266
77 3300042603 Ga0466714_041294 Ga0466714_041294_3221_4084 266
78 3300042613 Ga0466710_033475 Ga0466710_033475_284_1150 266
79 3300042601 Ga0466707_198130 Ga0466707_198130_55_891 267
80 3300042655 Ga0466727_126471 Ga0466727_126471_5526_6380 267
81 3300042596 Ga0466696_325262 Ga0466696_325262_766_1608 268
82 3300042636 Ga0466703_400304 Ga0466703_400304_1342_2184 268
83 3300042550 Ga0466656_313567 Ga0466656_313567_431_1261 269
84 3300042599 Ga0466706_051177 Ga0466706_051177_27719_28591 269
85 3300042643 Ga0466704_063265 Ga0466704_063265_3304_4167 269
86 3300042654 Ga0466725_054758 Ga0466725_054758_411_1265 270
87 3300042611 Ga0466697_106599 Ga0466697_106599_30675_31556 271
88 3300042612 Ga0466705_331369 Ga0466705_331369_1875_2726 271
89 3300002462 JGI24702J35022_10107509 JGI24702J35022_101075092 274
90 3300009826 Ga0123355_10000037 Ga0123355_1000003745 274
91 3300042609 Ga0466722_219747 Ga0466722_219747_585_1442 274
92 3300042620 Ga0466728_004763 Ga0466728_004763_6749_7609 275
93 3300042620 Ga0466728_461003 Ga0466728_461003_690_1517 275
94 3300042618 Ga0466723_075931 Ga0466723_075931_62381_63358 276
95 3300042643 Ga0466704_014546 Ga0466704_014546_1904_2767 276
96 3300042636 Ga0466703_291043 Ga0466703_291043_20886_21719 277
97 2225789004 2227554893 2228087130 278
98 3300042599 Ga0466706_188691 Ga0466706_188691_3744_4580 278
99 3300042643 Ga0466704_306015 Ga0466704_306015_13177_14040 278
100 3300042648 Ga0466709_015779 Ga0466709_015779_1933_2868 278
101 3300042643 Ga0466704_229792 Ga0466704_229792_22241_23116 279
102 3300042606 Ga0466719_130583 Ga0466719_130583_5220_6062 280
103 3300042612 Ga0466705_202926 Ga0466705_202926_22046_22906 280
104 3300042655 Ga0466727_055911 Ga0466727_055911_3067_3909 280
105 iso_pr_bacteria 2609459943 2610739964 280
106 iso_pr_bacteria 2830041218 2830042302 280
107 iso_pr_bacteria 2940216256 2940217914 281
108 2225789004 2227493803 2227968654 282
109 3300042596 Ga0466696_317252 Ga0466696_317252_5661_6548 282
110 3300042603 Ga0466714_006756 Ga0466714_006756_110092_110940 282
111 3300042612 Ga0466705_329189 Ga0466705_329189_728_1612 283
112 3300042606 Ga0466719_150749 Ga0466719_150749_6528_7415 284
113 3300042618 Ga0466723_216363 Ga0466723_216363_5373_6260 284
114 iso_pr_bacteria 2820774381 2820774508 284
115 iso_pr_bacteria 2820785563 2820785779 284
116 3300042602 Ga0466713_050988 Ga0466713_050988_129_986 285
117 iso_pr_bacteria 2820788205 2820788363 285
118 iso_pr_bacteria 2940205530 2940207095 285
119 iso_pr_bacteria 2940212447 2940213749 285
120 iso_pr_bacteria 2940298504 2940300064 285
121 iso_pr_bacteria 2940302308 2940303610 285
122 iso_pr_bacteria 2940306115 2940307085 285
123 iso_pr_bacteria 2940309933 2940311424 285
124 iso_pr_bacteria 2940313741 2940314976 285
125 iso_pr_bacteria 2940317558 2940319052 285
126 iso_pr_bacteria 2940321370 2940322602 285
127 iso_pr_bacteria 2940325180 2940326743 285
128 iso_pr_bacteria 2940328985 2940330288 285
129 iso_pr_bacteria 2940332795 2940334289 285
130 2225789003 2226980369 2227324704 286
131 2225789004 2227619054 2228196109 286
132 3300005083 Ga0068305_10058765 Ga0068305_100587658 286
133 3300042593 Ga0466691_048035 Ga0466691_048035_222_1082 286
134 3300042616 Ga0466715_589396 Ga0466715_589396_6518_7378 286
135 3300042643 Ga0466704_206738 Ga0466704_206738_4337_5197 286
136 iso_pr_bacteria 2910930387 2910931428 286
137 iso_pr_bacteria 2923982719 2923984206 286
138 iso_pr_bacteria 2940371297 2940371879 286
139 3300042590 Ga0466690_014363 Ga0466690_014363_14582_15445 287
140 3300042602 Ga0466713_106369 Ga0466713_106369_398_1261 287
141 iso_pr_bacteria 2920168565 2920168985 287
142 iso_pr_bacteria 2922326829 2922327057 287
143 3300042636 Ga0466703_029735 Ga0466703_029735_4386_5252 288
144 iso_pr_bacteria 2820757377 2820758237 288
145 iso_pr_bacteria 2940195863 2940198715 288
146 iso_pr_bacteria 2940199050 2940199549 288
147 iso_pr_bacteria 2940209341 2940209488 288
148 iso_pr_bacteria 2940346213 2940347122 288
149 iso_pr_bacteria 3004667792 3004671112 288
150 iso_pr_bacteria 3004672520 3004673322 288
151 iso_pr_bacteria 2820767225 2820767351 290
152 iso_pr_bacteria 2820772500 2820772856 290
153 3300042656 Ga0466732_261268 Ga0466732_261268_3608_4486 292
154 iso_pr_bacteria 3004677695 3004680358 292
155 3300005201 Ga0072941_1308119 Ga0072941_13081191 293
156 3300042655 Ga0466727_303169 Ga0466727_303169_1907_2794 295
157 iso_pr_bacteria 2940202316 2940202322 306

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF13237 Fer4_10 4Fe-4S dicluster domain 217 259 0.96
PF00037 Fer4 4Fe-4S binding domain 242 263 0.95
PF12837 Fer4_6 4Fe-4S binding domain 241 263 0.95
PF12838 Fer4_7 4Fe-4S dicluster domain 219 262 0.95
PF13187 Fer4_9 4Fe-4S dicluster domain 218 263 0.95
PF04060 FeS Putative Fe-S cluster 42 64 0.93
PF12797 Fer4_2 4Fe-4S binding domain 164 182 0.91
PF14697 Fer4_21 4Fe-4S dicluster domain 217 263 0.9
PF13484 Fer4_16 4Fe-4S double cluster binding domain 170 231 0.82
PF13534 Fer4_17 4Fe-4S dicluster domain 170 230 0.79
PF13183 Fer4_8 4Fe-4S dicluster domain 169 231 0.71

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF04060 GO:0051536 iron-sulfur cluster binding MF

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.7 0.8 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.