Protein Family IF13033

Metagenome Isolate
125 Members
56 Samples
98 Scaffolds
477.89 Avg Length

🧬 Representative Sequence

ID
iso_pr_bacteria|2923982719|2923984598|
Length
512 aa
Sequence
MAKNYRIPVKRFITSMTNYTQYLLRIKRINTYTMKELNKETAPKTSYPERIIQFGEGNFLRAFADWMIQVMNEKTDFNSSVVVVQPIENGMVDMLNKQDCLYHVNLQGLDKGEKVNSLTRVDVISRALNPYKEYEAFIKLAEQPEIRFVISNTTEAGIVFDPSCKLTDAPASSYPGKLTQLLYHRFQTFHADKDKGLIIFPCELIFLNGHKLKETIYQYIAHWNLGKEFETWFTEACGVYATLVDRIVPGFPRKEIDVIKEKLQYNDNLVVQAEIFHLWVIEAPQSVAKEFPADKAGLNVLFVPSEEPYHQRKVTLLNGPHTVLAPVTYLSGVDIVRDACQHEVLGKYIHKVMFDELLETLDLPKEELVQFGQDVLERFNNPFVDHSVVSIMLNSFPKYATRDLPGLKVYLERKGKLPEGLVLGLAAIMTYYKGGYRADGAACEPNDAPEILQLFKELWATGSNCKVAEGGLGASFIWGEDLNLITGLTDKLTSYLDIIQEKGMLNVVKEII

📊 Sample Types

Isolate 21.6%
Metagenome 78.4%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Blattidae 44.4%
Kalotermitidae 25.9%
Rhinotermitidae 7.4%
Unclassified 7.4%
Termopsidae 7.4%
Termitidae 5.6%
Hodotermitidae 1.9%

🌳 Taxonomy

Archaea 0
Bacteria 122
Eukaryota 0
Viruses 0
Unclassified 3

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2609459943 Bacteroides reticulotermitis JCM 10512 Isolate Rhinotermitidae
2 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
3 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
4 2910959314 Dysgonomonas sp. 511 Isolate Blattidae
5 2923982719 Parabacteroides sp. 52 Isolate Blattidae
6 2940306115 Parabacteroides sp. PFB2-22 Isolate Blattidae
7 2940309933 Parabacteroides sp. PH5-13 Isolate Blattidae
8 2940328985 Parabacteroides sp. PH5-46 Isolate Blattidae
9 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
10 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
11 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
12 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
13 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
14 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
15 2830041218 Bacteroides reticulotermitis DSM 105720 Isolate Unclassified
16 2940212447 Parabacteroides sp. PH5-16 Isolate Blattidae
17 2940302308 Parabacteroides sp. PF5-5 Isolate Blattidae
18 2940321370 Parabacteroides sp. PH5-39 Isolate Blattidae
19 2940332795 Parabacteroides sp. PH5-8 Isolate Blattidae
20 3004672520 Bacteroides sp. 51 Isolate Blattidae
21 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
22 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
23 2940346213 Parabacteroides sp. PFB2-12 Isolate Blattidae
24 3004677695 Bacteroides sp. 214 Isolate Blattidae
25 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
26 2922326829 Bacteroides sp. 224 Isolate Blattidae
27 2940313741 Parabacteroides sp. PH5-17 Isolate Blattidae
28 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
29 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
30 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
31 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
32 2940195863 Parabacteroides sp. PF5-6 Isolate Blattidae
33 2940209341 Parabacteroides sp. PFB2-10 Isolate Blattidae
34 2940298504 Parabacteroides sp. PF5-13 Isolate Blattidae
35 3004667792 Bacteroides sp. 519 Isolate Blattidae
36 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
37 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
38 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
39 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
40 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
41 2820762746 Unclassified Bacteroidetes Mp193P4bin3 Isolate Unclassified
42 2920168565 Paludibacter sp. 221 Isolate Blattidae
43 2940205530 Parabacteroides sp. PH5-33 Isolate Blattidae
44 2940317558 Parabacteroides sp. PH5-26 Isolate Blattidae
45 2940325180 Parabacteroides sp. PH5-41 Isolate Blattidae
46 2940199050 Parabacteroides sp. PM6-13 Isolate Blattidae
47 2940371297 Parabacteroides sp. PM5-20 Isolate Blattidae
48 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
49 3300024582 Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 Metagenome
50 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
51 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
52 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
53 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
54 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
55 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
56 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466706_191859 3300042599 Bacteria 15406
2 Ga0466707_258930 3300042601 Bacteria 22459
3 Ga0466722_085480 3300042609 Bacteria 10710
4 Ga0466723_059005 3300042618 Bacteria 62633
5 Ga0466728_119303 3300042620 Bacteria 6036
6 Ga0466728_377769 3300042620 Bacteria 9387
7 Ga0466735_008785 3300042624 Bacteria 7437
8 Ga0466735_227761 3300042624 Bacteria 1936
9 Ga0466703_004863 3300042636 Bacteria 11962
10 Ga0466703_206818 3300042636 Bacteria 4106
11 Ga0466704_168253 3300042643 Bacteria 34036
12 Ga0466690_211331 3300042590 Bacteria 24882
13 Ga0466696_486712 3300042596 Bacteria 3366
14 Ga0466696_500415 3300042596 Bacteria 13696
15 Ga0068302_10565736 3300005071 Bacteria 2169
16 Ga0466705_048505 3300042612 Bacteria 1651
17 Ga0466733_161084 3300042659 Bacteria 8174
18 Ga0466706_116680 3300042599 Bacteria 6775
19 Ga0466706_166355 3300042599 Bacteria 2250
20 Ga0466707_161230 3300042601 Unclassified 6730
21 Ga0466707_197646 3300042601 Bacteria 16993
22 Ga0466714_051455 3300042603 Bacteria 64684
23 Ga0466719_295613 3300042606 Bacteria 4609
24 Ga0466728_095021 3300042620 Bacteria 12976
25 Ga0466735_029550 3300042624 Bacteria 5603
26 Ga0466709_414115 3300042648 Bacteria 5627
27 Ga0466708_148006 3300042652 Bacteria 3730
28 Ga0466708_388127 3300042652 Bacteria 20862
29 Ga0466727_251974 3300042655 Bacteria 41475
30 Ga0466690_172738 3300042590 Bacteria 57212
31 Ga0466696_135386 3300042596 Bacteria 3486
32 Ga0466705_028542 3300042612 Bacteria 3602
33 Ga0466706_073929 3300042599 Bacteria 62218
34 Ga0466716_075443 3300042605 Bacteria 4825
35 Ga0466723_005478 3300042618 Bacteria 26749
36 Ga0466723_088575 3300042618 Bacteria 7062
37 Ga0466723_129862 3300042618 Bacteria 5318
38 Ga0466728_073725 3300042620 Bacteria 64638
39 Ga0466708_263041 3300042652 Bacteria 7617
40 Ga0466690_128650 3300042590 Bacteria 3535
41 Ga0466705_375019 3300042612 Bacteria 7696
42 Ga0466706_027167 3300042599 Bacteria 39836
43 Ga0466714_041855 3300042603 Bacteria 7411
44 Ga0466711_337967 3300042615 Bacteria 12586
45 Ga0466715_130853 3300042616 Bacteria 14868
46 Ga0466723_133687 3300042618 Bacteria 11953
47 Ga0466723_183847 3300042618 Bacteria 12292
48 Ga0466729_221109 3300042621 Bacteria 9058
49 Ga0466704_253788 3300042643 Bacteria 19909
50 Ga0466708_198288 3300042652 Bacteria 6798
51 Ga0466691_100125 3300042593 Bacteria 37337
52 Ga0466696_464977 3300042596 Bacteria 1865
53 Ga0466733_130688 3300042659 Bacteria 23826
54 Ga0466705_448784 3300042612 Bacteria 15524
55 Ga0466704_008871 3300042643 Bacteria 7878
56 Ga0466727_021199 3300042655 Bacteria 2810
57 Ga0466727_207929 3300042655 Bacteria 5074
58 Ga0265387_1001797 3300024582 Bacteria 3071
59 Ga0466690_034127 3300042590 Bacteria 10198
60 Ga0466691_048668 3300042593 Bacteria 5113
61 Ga0068302_10052783 3300005071 Bacteria 1777
62 Ga0068305_10002010 3300005083 Bacteria 184777
63 Ga0466733_051179 3300042659 Bacteria 7147
64 Ga0466706_078296 3300042599 Bacteria 2551
65 Ga0466706_166994 3300042599 Bacteria 2469
66 Ga0466707_078115 3300042601 Unclassified 2149
67 Ga0466716_202760 3300042605 Bacteria 21677
68 Ga0466726_418653 3300042619 Bacteria 12621
69 Ga0466728_007545 3300042620 Bacteria 5767
70 Ga0466735_141629 3300042624 Bacteria 6302
71 Ga0466692_125029 3300042591 Bacteria 3623
72 Ga0466696_340445 3300042596 Bacteria 3926
73 JGI24699J35502_11134204 3300002509 Bacteria 55998
74 Ga0466705_342178 3300042612 Bacteria 42153
75 Ga0466719_444059 3300042606 Bacteria 1865
76 Ga0466722_013429 3300042609 Bacteria 3456
77 Ga0466715_226670 3300042616 Bacteria 6835
78 Ga0466723_050299 3300042618 Bacteria 13082
79 Ga0466726_023136 3300042619 Bacteria 4280
80 Ga0466726_108764 3300042619 Bacteria 11715
81 Ga0466735_034592 3300042624 Bacteria 8725
82 Ga0466690_068702 3300042590 Bacteria 28629
83 Ga0466690_191714 3300042590 Bacteria 10531
84 Ga0466690_241549 3300042590 Bacteria 6321
85 Ga0466691_008552 3300042593 Bacteria 6511
86 Ga0466696_063888 3300042596 Bacteria 3886
87 Ga0466696_123377 3300042596 Bacteria 5080
88 Ga0466696_129544 3300042596 Bacteria 2300
89 Ga0466696_172325 3300042596 Bacteria 37657
90 Ga0072941_1390810 3300005201 Bacteria 3062
91 Ga0466723_094741 3300042618 Bacteria 15823
92 Ga0466726_466285 3300042619 Unclassified 1703
93 Ga0466704_603076 3300042643 Bacteria 34589
94 Ga0466709_199923 3300042648 Bacteria 96862
95 Ga0466690_082716 3300042590 Bacteria 3326
96 Ga0466690_167924 3300042590 Bacteria 15969
97 Ga0466692_006975 3300042591 Bacteria 5062
98 Ga0466691_044940 3300042593 Bacteria 6547

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042612 Ga0466705_342178 Ga0466705_342178_34641_35981 434
2 3300042652 Ga0466708_388127 Ga0466708_388127_10524_11849 441
3 3300042612 Ga0466705_048505 Ga0466705_048505_236_1564 442
4 3300042591 Ga0466692_125029 Ga0466692_125029_1045_2376 443
5 3300042616 Ga0466715_226670 Ga0466715_226670_4945_6279 444
6 3300042619 Ga0466726_023136 Ga0466726_023136_2379_3815 462
7 3300005201 Ga0072941_1390810 Ga0072941_13908102 465
8 3300042601 Ga0466707_078115 Ga0466707_078115_728_2125 465
9 3300042601 Ga0466707_197646 Ga0466707_197646_11090_12487 465
10 3300042636 Ga0466703_004863 Ga0466703_004863_2471_3871 466
11 3300042601 Ga0466707_161230 Ga0466707_161230_1164_2567 467
12 3300042612 Ga0466705_375019 Ga0466705_375019_1702_3105 467
13 3300042621 Ga0466729_221109 Ga0466729_221109_7422_8828 468
14 3300042590 Ga0466690_172738 Ga0466690_172738_24076_25518 472
15 3300042596 Ga0466696_464977 Ga0466696_464977_313_1755 472
16 3300042618 Ga0466723_129862 Ga0466723_129862_1799_3247 473
17 3300042643 Ga0466704_008871 Ga0466704_008871_3867_5291 474
18 3300042615 Ga0466711_337967 Ga0466711_337967_10869_12299 476
19 3300042590 Ga0466690_241549 Ga0466690_241549_2023_3456 477
20 3300042606 Ga0466719_295613 Ga0466719_295613_2615_4048 477
21 3300042619 Ga0466726_418653 Ga0466726_418653_5903_7336 477
22 3300042655 Ga0466727_207929 Ga0466727_207929_2011_3444 477
23 3300042596 Ga0466696_172325 Ga0466696_172325_27566_29002 478
24 3300042596 Ga0466696_340445 Ga0466696_340445_2168_3634 478
25 3300042616 Ga0466715_130853 Ga0466715_130853_2172_3608 478
26 3300042624 Ga0466735_029550 Ga0466735_029550_1466_2902 478
27 3300042643 Ga0466704_253788 Ga0466704_253788_17273_18727 478
28 iso_pr_bacteria 2910959314 2910960940 478
29 3300024582 Ga0265387_1001797 Ga0265387_10017972 479
30 3300042593 Ga0466691_008552 Ga0466691_008552_4487_5926 479
31 3300042593 Ga0466691_044940 Ga0466691_044940_2084_3523 479
32 3300042596 Ga0466696_123377 Ga0466696_123377_1475_2914 479
33 3300042596 Ga0466696_135386 Ga0466696_135386_1959_3398 479
34 3300042599 Ga0466706_166994 Ga0466706_166994_11_1450 479
35 3300042599 Ga0466706_191859 Ga0466706_191859_6076_7515 479
36 3300042603 Ga0466714_041855 Ga0466714_041855_4203_5642 479
37 3300042618 Ga0466723_050299 Ga0466723_050299_2376_3815 479
38 3300042618 Ga0466723_183847 Ga0466723_183847_2096_3535 479
39 3300042619 Ga0466726_466285 Ga0466726_466285_111_1550 479
40 3300042620 Ga0466728_095021 Ga0466728_095021_3548_4987 479
41 3300042624 Ga0466735_227761 Ga0466735_227761_184_1623 479
42 3300042643 Ga0466704_168253 Ga0466704_168253_2939_4378 479
43 3300042659 Ga0466733_051179 Ga0466733_051179_76_1515 479
44 3300042659 Ga0466733_130688 Ga0466733_130688_17843_19282 479
45 3300042659 Ga0466733_161084 Ga0466733_161084_6706_8145 479
46 iso_pr_bacteria 2609459943 2610742401 479
47 iso_pr_bacteria 2830041218 2830042174 479
48 iso_pr_bacteria 2920168565 2920170070 479
49 iso_pr_bacteria 2922326829 2922328229 479
50 iso_pr_bacteria 2940195863 2940196300 479
51 iso_pr_bacteria 2940199050 2940201347 479
52 iso_pr_bacteria 2940205530 2940206185 479
53 iso_pr_bacteria 2940209341 2940210003 479
54 iso_pr_bacteria 2940212447 2940213100 479
55 iso_pr_bacteria 2940298504 2940299156 479
56 iso_pr_bacteria 2940302308 2940302771 479
57 iso_pr_bacteria 2940306115 2940306179 479
58 iso_pr_bacteria 2940309933 2940310187 479
59 iso_pr_bacteria 2940313741 2940313997 479
60 iso_pr_bacteria 2940317558 2940317622 479
61 iso_pr_bacteria 2940321370 2940321625 479
62 iso_pr_bacteria 2940325180 2940325643 479
63 iso_pr_bacteria 2940328985 2940329449 479
64 iso_pr_bacteria 2940332795 2940332859 479
65 iso_pr_bacteria 2940346213 2940349237 479
66 iso_pr_bacteria 3004667792 3004670712 479
67 iso_pr_bacteria 3004672520 3004674633 479
68 iso_pr_bacteria 3004677695 3004678785 479
69 3300005083 Ga0068305_10002010 Ga0068305_1000201010 480
70 3300042590 Ga0466690_068702 Ga0466690_068702_11633_13075 480
71 3300042590 Ga0466690_128650 Ga0466690_128650_1513_2955 480
72 3300042591 Ga0466692_006975 Ga0466692_006975_1953_3395 480
73 3300042596 Ga0466696_486712 Ga0466696_486712_1538_2980 480
74 3300042599 Ga0466706_166355 Ga0466706_166355_408_1850 480
75 3300042603 Ga0466714_051455 Ga0466714_051455_34763_36205 480
76 3300042609 Ga0466722_085480 Ga0466722_085480_5638_7080 480
77 3300042612 Ga0466705_028542 Ga0466705_028542_897_2339 480
78 3300042618 Ga0466723_059005 Ga0466723_059005_48989_50431 480
79 3300042620 Ga0466728_073725 Ga0466728_073725_3204_4646 480
80 3300042624 Ga0466735_008785 Ga0466735_008785_3287_4729 480
81 3300042624 Ga0466735_034592 Ga0466735_034592_2135_3577 480
82 3300042643 Ga0466704_603076 Ga0466704_603076_12040_13482 480
83 3300042648 Ga0466709_414115 Ga0466709_414115_56_1498 480
84 3300042652 Ga0466708_198288 Ga0466708_198288_4995_6437 480
85 3300042652 Ga0466708_263041 Ga0466708_263041_5697_7139 480
86 3300042655 Ga0466727_021199 Ga0466727_021199_1018_2460 480
87 3300042590 Ga0466690_034127 Ga0466690_034127_424_1869 481
88 3300042590 Ga0466690_082716 Ga0466690_082716_1339_2784 481
89 3300042590 Ga0466690_191714 Ga0466690_191714_4864_6309 481
90 3300042593 Ga0466691_048668 Ga0466691_048668_1133_2578 481
91 3300042596 Ga0466696_063888 Ga0466696_063888_443_1888 481
92 3300042596 Ga0466696_129544 Ga0466696_129544_88_1533 481
93 3300042599 Ga0466706_073929 Ga0466706_073929_16208_17653 481
94 3300042599 Ga0466706_116680 Ga0466706_116680_3410_4855 481
95 3300042601 Ga0466707_258930 Ga0466707_258930_16178_17623 481
96 3300042605 Ga0466716_075443 Ga0466716_075443_3207_4652 481
97 3300042606 Ga0466719_444059 Ga0466719_444059_386_1831 481
98 3300042612 Ga0466705_448784 Ga0466705_448784_3403_4848 481
99 3300042618 Ga0466723_005478 Ga0466723_005478_4889_6334 481
100 3300042618 Ga0466723_088575 Ga0466723_088575_4941_6386 481
101 3300042618 Ga0466723_094741 Ga0466723_094741_7002_8447 481
102 3300042618 Ga0466723_133687 Ga0466723_133687_7872_9317 481
103 3300042619 Ga0466726_108764 Ga0466726_108764_6628_8073 481
104 3300042620 Ga0466728_007545 Ga0466728_007545_1750_3195 481
105 3300042620 Ga0466728_119303 Ga0466728_119303_1665_3110 481
106 3300042620 Ga0466728_377769 Ga0466728_377769_5217_6662 481
107 3300042636 Ga0466703_206818 Ga0466703_206818_2293_3738 481
108 3300042648 Ga0466709_199923 Ga0466709_199923_94260_95705 481
109 3300042652 Ga0466708_148006 Ga0466708_148006_705_2150 481
110 3300042655 Ga0466727_251974 Ga0466727_251974_10307_11752 481
111 3300005071 Ga0068302_10052783 Ga0068302_100527831 482
112 3300042590 Ga0466690_167924 Ga0466690_167924_11454_12902 482
113 3300042590 Ga0466690_211331 Ga0466690_211331_9616_11064 482
114 3300042596 Ga0466696_500415 Ga0466696_500415_10481_11953 482
115 3300042599 Ga0466706_078296 Ga0466706_078296_458_1906 482
116 3300042605 Ga0466716_202760 Ga0466716_202760_9012_10460 482
117 3300042624 Ga0466735_141629 Ga0466735_141629_1208_2656 482
118 3300042593 Ga0466691_100125 Ga0466691_100125_31865_33319 484
119 3300042599 Ga0466706_027167 Ga0466706_027167_8311_9765 484
120 3300042609 Ga0466722_013429 Ga0466722_013429_1520_2974 484
121 iso_pr_bacteria 2820762746 2820764886 486
122 3300002509 JGI24699J35502_11134204 JGI24699J35502_1113420450 487
123 3300005071 Ga0068302_10565736 Ga0068302_105657362 497
124 iso_pr_bacteria 2923982719 2923984598 512
125 iso_pr_bacteria 2940371297 2940372113 512

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01232 Mannitol_dh Mannitol dehydrogenase Rossmann domain 49 291 0.95
PF08125 Mannitol_dh_C Mannitol dehydrogenase C-terminal domain 307 456 0.82

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF01232 GO:0016491 oxidoreductase activity MF

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.84 0.87 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.