Protein Family IF12851
Metagenome
Isolate
326
Members
279
Samples
98
Scaffolds
350.65
Avg Length
Representative Sequence
- ID
- iso_pr_bacteria|2874504452|2874508827|
- Length
- 376 aa
- Sequence
- MLVWLAEHLVKYYSGFNVFSYLTFRAIVSLLTALFLSLWMGPRVIKRLQEMSFGQVVRNDGPESHFSKRGTPTMGGIMILTSITISVLMWAYPSNPYVWCVLFVLVGYGIVGFVDDYRKVVRKDTKGLICSASSCMARKAXXXXIARWKYFWQSVIALIVAFAMYAVGKDTPATELVVPFFKDVMPQLGLLYILLAYFVIVGTSNAVNLTDGLDGLAIMPTVFVAAGFALVAWATGNMNFANYLHIPYLRHAGELVIVCTAIVGAGLGFLWFNTYPAQVFMGDVGSLALGGALGTIAVLLRQEFLLVIMGGVFVVETLSVILQVGSFKLRGQRIFRMAPIHHHYELKGWPEPRVIVRFWIISLMLVLIGLATLKVR
Sample Types
Isolate
69.9%
Metagenome
30.1%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
33.3%
Drosophilidae
13.6%
Apidae
8.3%
Anthocoridae
8.0%
Termitidae
5.7%
Kalotermitidae
3.4%
Tenebrionidae
3.0%
Curculionidae
3.0%
Calliphoridae
2.3%
Tephritidae
1.9%
Formicidae
1.5%
Culicidae
1.1%
Chrysomelidae
1.1%
Cerambycidae
1.1%
Talitridae
1.1%
Passalidae
1.1%
Palinuridae
0.8%
Aphididae
0.8%
Pentatomidae
0.8%
Aphalaridae
0.4%
Psyllidae
0.4%
Aleyrodidae
0.4%
Daphniidae
0.4%
Aphrophoridae
0.4%
Hodotermitidae
0.4%
Ceratophyllidae
0.4%
Penaeidae
0.4%
Glossinidae
0.4%
Carabidae
0.4%
Rhinotermitidae
0.4%
Plutellidae
0.4%
Siricidae
0.4%
Crambidae
0.4%
Muscidae
0.4%
Artemiidae
0.4%
Pteromalidae
0.4%
Cicadellidae
0.4%
Pseudococcidae
0.4%
Armadillidiidae
0.4%
Cixiidae
0.4%
Taxonomy
Archaea
0
Bacteria
302
Eukaryota
0
Viruses
0
Unclassified
24
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2874434233 | Serratia marcescens ADJS-2C_Red | Isolate | Unclassified |
| 2 | 2880115952 | Vibrio parahaemolyticus PB1937 | Isolate | Unclassified |
| 3 | 2937236879 | Lactiplantibacillus plantarum MHO2.4 | Isolate | |
| 4 | 2960772748 | Lactiplantibacillus plantarum MHO2.9 | Isolate | |
| 5 | 2961232173 | Serratia sp. OLLOLW30 | Isolate | Anthocoridae |
| 6 | 2964765680 | Lactiplantibacillus plantarum MHO2.5 | Isolate | |
| 7 | 2065487013 | Fungus-growing termite worker microbial communities from South Africa - Oerleman's Farm | Metagenome | |
| 8 | 2509601000 | Secondary endosymbiont of Ctenarytaina eucalypti Thao2000 | Isolate | Aphalaridae |
| 9 | 2512047046 | Secondary Endosymbiont of Heteropsylla cubana | Isolate | Psyllidae |
| 10 | 2548876931 | Candidatus Hamiltonella defensa MED (Bemisia tabaci) | Isolate | Aleyrodidae |
| 11 | 2574179716 | Serratia sp. DD3 | Isolate | Daphniidae |
| 12 | 2576861670 | Lactiplantibacillus plantarum WJL | Isolate | Drosophilidae |
| 13 | 2585428135 | Sodalis-like symbiont of Philaenus spumarius PSPU | Isolate | Aphrophoridae |
| 14 | 2597489903 | Providencia sneebia DSM 19967 | Isolate | Drosophilidae |
| 15 | 2597490194 | Bifidobacterium coryneforme LMG 18911 | Isolate | Apidae |
| 16 | 2654587515 | Vibrio owensii CAIM 1854 | Isolate | Palinuridae |
| 17 | 2671180601 | Bifidobacterium asteroides DSM 20089 | Isolate | Unclassified |
| 18 | 2718217944 | Serratia marcescens AS1 | Isolate | Culicidae |
| 19 | 2765235945 | Kosakonia cowanii Esp_Z | Isolate | Culicidae |
| 20 | 2820416776 | Unclassified Firmicutes Lab288P3bin9 | Isolate | Unclassified |
| 21 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 22 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 23 | 3300057007 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) | Metagenome | Tenebrionidae |
| 24 | 8100176769 | Kosakonia sp. S57 | Isolate | Curculionidae |
| 25 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 26 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 27 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 28 | 2967825073 | Lactiplantibacillus plantarum FlyG9.1.4 | Isolate | Drosophilidae |
| 29 | 2970254690 | Lactiplantibacillus plantarum FlyG9.2.5 | Isolate | Drosophilidae |
| 30 | 2970791725 | Serratia sp. OLBL1 | Isolate | Anthocoridae |
| 31 | 2977596371 | Lactiplantibacillus plantarum FlyG11.2.6 | Isolate | Drosophilidae |
| 32 | 2977622177 | Lactiplantibacillus plantarum FlyG20.2.6 | Isolate | Drosophilidae |
| 33 | 2996467878 | Serratia sp. OLFL2 | Isolate | Anthocoridae |
| 34 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 35 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 36 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 37 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 38 | 8110340172 | Bifidobacterium choladohabitans B14384H11 | Isolate | Apidae |
| 39 | 2885046828 | Erwinia sp. OLCASP19 | Isolate | Anthocoridae |
| 40 | 2885054481 | Erwinia sp. OLMDSP33 | Isolate | Anthocoridae |
| 41 | 2902896024 | Pseudoalteromonas sp. S1612 | Isolate | Unclassified |
| 42 | 2908136803 | Vibrio owensii 1700302 | Isolate | Unclassified |
| 43 | 2865983822 | Bifidobacterium xylocopae XV2 | Isolate | Apidae |
| 44 | 2519899775 | Bifidobacterium asteroides PRL2011 | Isolate | Apidae |
| 45 | 2529292851 | Providencia burhodogranariea DSM 19968 | Isolate | Drosophilidae |
| 46 | 2600255074 | Vibrio proteolyticus NBRC 13287 | Isolate | Unclassified |
| 47 | 2651870110 | Izhakiella capsodis N6PO6 | Isolate | Unclassified |
| 48 | 2663763384 | Bifidobacterium bombi DSM 19703 | Isolate | Apidae |
| 49 | 2693429575 | Vibrio parahaemolyticus ISF-54-12 | Isolate | Unclassified |
| 50 | 2703719240 | Serratia marcescens ano2 | Isolate | Unclassified |
| 51 | 2819999932 | Unclassified Synergistetes Th196P4bin51 | Isolate | Unclassified |
| 52 | 2820018428 | Unclassified Spirochaetes Nt197P3bin33 | Isolate | Unclassified |
| 53 | 2820046858 | Unclassified Proteobacteria Th196P3bin84 | Isolate | Unclassified |
| 54 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 55 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 56 | 640963010 | Vibrio harveyi HY01 | Isolate | Unclassified |
| 57 | 644736334 | Candidatus Hamiltonella defensa 5AT | Isolate | Aphididae |
| 58 | 8006199443 | Yersinia pestis M-1763 | Isolate | Ceratophyllidae |
| 59 | 8017489919 | Lactobacillus brevis EF | Isolate | Unclassified |
| 60 | 8073124432 | Escherichia coli MOD1-EC294 | Isolate | Unclassified |
| 61 | 8074292191 | Tatumella sp. JGM94 | Isolate | Drosophilidae |
| 62 | 8101676404 | Providencia sp. JGM172 | Isolate | Drosophilidae |
| 63 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 64 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 65 | 2997380424 | Vibrio parahaemolyticus MVP1 | Isolate | Unclassified |
| 66 | 2998829267 | Enterobacteriaceae endosymbiont of Macroplea mutica MmutSym | Isolate | Chrysomelidae |
| 67 | 3004010258 | Citrobacter sp. JGM124 | Isolate | Drosophilidae |
| 68 | 3300000333 | Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony | Metagenome | Apidae |
| 69 | 3300007149 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 4 gut | Metagenome | Drosophilidae |
| 70 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 71 | 8110341875 | Bifidobacterium polysaccharolyticum W8117 | Isolate | Apidae |
| 72 | 2847708326 | Serratia liquefaciens P2ACOL2 | Isolate | Cerambycidae |
| 73 | 2874504452 | Serratia marcescens ADJS-2C_Purple | Isolate | Unclassified |
| 74 | 2875320051 | Vibrio parahaemolyticus 160807 | Isolate | Unclassified |
| 75 | 2877638525 | Vibrio campbellii 1114GL | Isolate | Penaeidae |
| 76 | 2877647439 | Vibrio parahaemolyticus R13 | Isolate | Unclassified |
| 77 | 2885058212 | Erwinia sp. OLTSP20 | Isolate | Anthocoridae |
| 78 | 2901296437 | Erwinia dacicola Oroville | Isolate | Tephritidae |
| 79 | 2964778705 | Lactiplantibacillus plantarum DietG20.2.2_EE | Isolate | Unclassified |
| 80 | 2820918931 | Unclassified Actinobacteria Emb289P3bin56 | Isolate | Unclassified |
| 81 | 2588253732 | Klebsiella pneumoniae pneumoniae KP5-1 | Isolate | Pentatomidae |
| 82 | 2597490293 | Lactiplantibacillus plantarum DmCS_001 | Isolate | Drosophilidae |
| 83 | 2684622551 | Vibrio campbellii E1 | Isolate | Unclassified |
| 84 | 2718218475 | Lactiplantibacillus plantarum KP | Isolate | Drosophilidae |
| 85 | 2731957638 | Vibrio harveyi NBRC 15634 | Isolate | Talitridae |
| 86 | 2808606957 | Bifidobacterium sp. ESL0447 | Isolate | Unclassified |
| 87 | 2820411483 | Unclassified Firmicutes Lab288P4bin76 | Isolate | Unclassified |
| 88 | 2820499546 | Unclassified Firmicutes Lab288P1bin54 | Isolate | Unclassified |
| 89 | 637000270 | Sodalis glossinidius morsitans | Isolate | Glossinidae |
| 90 | 637000338 | Wigglesworthia glossinidia | Isolate | Unclassified |
| 91 | 649633028 | Candidatus Blochmannia vafer BVAF | Isolate | Formicidae |
| 92 | 8004118532 | Citrobacter amalonaticus ku-bf3 | Isolate | Carabidae |
| 93 | 8022096067 | Vibrio sp. SALL6 | Isolate | Unclassified |
| 94 | 8051461712 | Vibrio vulnificus Vv002 | Isolate | |
| 95 | 8060845732 | Vibrio vulnificus Vv006 | Isolate | |
| 96 | 8071343737 | Escherichia coli PN119 | Isolate | Calliphoridae |
| 97 | 8074288691 | Tatumella sp. JGM82 | Isolate | Drosophilidae |
| 98 | 8101683685 | Providencia sp. JGM181 | Isolate | Drosophilidae |
| 99 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 100 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 101 | 2970225615 | Lactiplantibacillus plantarum FlyG8.1.1 | Isolate | Drosophilidae |
| 102 | 2977628635 | Lactiplantibacillus plantarum FlyG3.1.8 | Isolate | Drosophilidae |
| 103 | 2977653127 | Lactiplantibacillus plantarum FlyG10.1.5 | Isolate | Drosophilidae |
| 104 | 2989793055 | Vibrio atypicus DSM 25292 | Isolate | Unclassified |
| 105 | 2996406003 | Serratia sp. OLJL1 | Isolate | Anthocoridae |
| 106 | 3001462594 | Tatumella sp. JGM91 | Isolate | Drosophilidae |
| 107 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 108 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 109 | 3300009460 | Microbial communities of aphids from Pistacia texana in Langtry, TX, USA - Geopemphigus sp. seqcov | Metagenome | |
| 110 | 3300035363 | Gut microbial communities from Plutella xylostella in Fujian, Fuzhou, China - pupa gut | Metagenome | Plutellidae |
| 111 | 2837516909 | Rahnella bruchi DSM 27398 | Isolate | Unclassified |
| 112 | 2841260384 | Providencia alcalifaciens Dmel2 | Isolate | Drosophilidae |
| 113 | 2878947168 | Serratia marcescens ADJS-2D_White | Isolate | Unclassified |
| 114 | 2879643867 | Bifidobacterium sp. wkB344 | Isolate | Apidae |
| 115 | 2885043073 | Erwinia sp. OLSSP12 | Isolate | Anthocoridae |
| 116 | 2896187957 | Providencia stuartii Crippen | Isolate | Calliphoridae |
| 117 | 2896843662 | Levilactobacillus brevis BDGP6 | Isolate | Drosophilidae |
| 118 | 2937735258 | Serratia marcescens KZ11 | Isolate | Apidae |
| 119 | 2961247850 | Serratia sp. OLAL2 | Isolate | Anthocoridae |
| 120 | 2964739456 | Lactiplantibacillus plantarum FlyG10.1.9 | Isolate | Drosophilidae |
| 121 | 2100351016 | Sirex noctilio microbial communities from Pennsylvania, USA - adult community | Metagenome | Siricidae |
| 122 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 123 | 2551306531 | Enterobacter hormaechei YT2 | Isolate | Tenebrionidae |
| 124 | 2667527830 | Vibrio parahaemolyticus ISF-29-3 | Isolate | Unclassified |
| 125 | 2684622920 | Bifidobacterium asteroides Bi_200 | Isolate | Unclassified |
| 126 | 2690315820 | Lactiplantibacillus plantarum WJL | Isolate | Drosophilidae |
| 127 | 2700989396 | Vibrio parahaemolyticus ISF-77-01 | Isolate | Unclassified |
| 128 | 2731957969 | Proteus mirabilis Wood | Isolate | Calliphoridae |
| 129 | 2756170277 | Enterobacillus tribolii DSM 103736 | Isolate | Unclassified |
| 130 | 2785510762 | Vibrio parahaemolyticus VP14 | Isolate | Unclassified |
| 131 | 2802429577 | Bifidobacterium indicum DSM 20214 | Isolate | Unclassified |
| 132 | 2820075487 | Unclassified Proteobacteria Nt197P3bin122 | Isolate | Unclassified |
| 133 | 8004307473 | Serratia sp. OLIL2 | Isolate | Anthocoridae |
| 134 | 8004571736 | Serratia sp. OLDL1 | Isolate | Anthocoridae |
| 135 | 8008122225 | Vibrio harveyi CAIM 1792 | Isolate | Unclassified |
| 136 | 8021535516 | Klebsiella sp. Kd70 TUC-EEAOC | Isolate | Crambidae |
| 137 | 8042061949 | Vibrio harveyi Hep-2a-10 | Isolate | Unclassified |
| 138 | 8100181737 | Kosakonia sp. S58 | Isolate | Curculionidae |
| 139 | 2970335472 | Cronobacter muytjensii MOD1-Md1s | Isolate | Muscidae |
| 140 | 2978102237 | Serratia fonticola AeS1 | Isolate | Culicidae |
| 141 | 2987233858 | Stutzerimonas stutzeri AR9-4 | Isolate | Unclassified |
| 142 | 3007994558 | Escherichia alba B35 | Isolate | Tenebrionidae |
| 143 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 144 | 2850895757 | Vibrio campbellii 170502 | Isolate | Unclassified |
| 145 | 2860776474 | Vibrio parahaemolyticus R14 | Isolate | Unclassified |
| 146 | 2872471378 | Vibrio owensii V180403 | Isolate | Unclassified |
| 147 | 2902916284 | Pseudoalteromonas rubra S1946 | Isolate | Unclassified |
| 148 | 2922113941 | Serratia sp. OLEL1 | Isolate | Anthocoridae |
| 149 | 2937751072 | Serratia sp. OLMTLW26 | Isolate | Anthocoridae |
| 150 | 2964749277 | Lactiplantibacillus plantarum FlyG20.1.4 | Isolate | Drosophilidae |
| 151 | 2964775400 | Lactiplantibacillus plantarum FlyG2.1.8 | Isolate | Unclassified |
| 152 | 2965197371 | Serratia sp. OLCL1 | Isolate | Anthocoridae |
| 153 | 2507262057 | Enterobacteriaceae bacterium FGI 57 | Isolate | Unclassified |
| 154 | 2513237174 | Bifidobacterium asteroides ATCC 25910 | Isolate | Apidae |
| 155 | 2551306516 | Enterobacter hormaechei YT3 | Isolate | Tenebrionidae |
| 156 | 2571042430 | Vibrio harveyi NBRC 15634 | Isolate | Talitridae |
| 157 | 2599185261 | Thorsellia anophelis DSM 18579 | Isolate | Unclassified |
| 158 | 2645727657 | Bifidobacterium actinocoloniiforme DSM 22766 | Isolate | Unclassified |
| 159 | 2711768158 | Vibrio coralliilyticus S2043 | Isolate | Unclassified |
| 160 | 2728369362 | Lactiplantibacillus plantarum DF | Isolate | Drosophilidae |
| 161 | 2820713307 | Unclassified Firmicutes Co191P1bin2 | Isolate | Unclassified |
| 162 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 163 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 164 | 8001059720 | Tenebrionicola larvae YMB-R22 | Isolate | Tenebrionidae |
| 165 | 8022087107 | Vibrio sp. OULL4 | Isolate | Unclassified |
| 166 | 8022439116 | Vibrio sp. ArtGut-C1 | Isolate | Artemiidae |
| 167 | 8071333649 | Escherichia coli PN108 | Isolate | Calliphoridae |
| 168 | 8071338694 | Escherichia coli PN87 | Isolate | Calliphoridae |
| 169 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 170 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 171 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 172 | 2998831142 | Enterobacteriaceae endosymbiont of Macroplea appendiculata MappSym | Isolate | Chrysomelidae |
| 173 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 174 | 3300007130 | Drosophila gut microbial communities from New York, USA - Drosophila falleni male 4 gut | Metagenome | Drosophilidae |
| 175 | 2822856742 | Enterobacter cancerogenus CR-Eb1 | Isolate | Unclassified |
| 176 | 2832201259 | Rickettsiella grylli TrM1 | Isolate | Unclassified |
| 177 | 2838140227 | Dyella sp. OAE510 | Isolate | Unclassified |
| 178 | 2843904799 | Shewanella khirikhana TH2012 | Isolate | Unclassified |
| 179 | 2850131454 | Providencia rettgeri NVIT03 | Isolate | Pteromalidae |
| 180 | 2874880541 | Enterobacter hormaechei E3442 | Isolate | Unclassified |
| 181 | 2898975184 | Erwinia dacicola IL | Isolate | Tephritidae |
| 182 | 2035918003 | Mountain Pine Beetle microbial communities from McBride, British Columbia, Canada - Lodgepole pine | Metagenome | Curculionidae |
| 183 | 2225789003 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) | Metagenome | Passalidae |
| 184 | 2521172698 | Candidatus Blochmannia chromaiodes 640 | Isolate | Unclassified |
| 185 | 2547132185 | Enterobacter cancerogenus YZ1 | Isolate | Tenebrionidae |
| 186 | 2551306507 | Vibrio parahaemolyticus PCV08-7 | Isolate | Unclassified |
| 187 | 2636415586 | Vibrio harveyi NBRC 15634 | Isolate | Talitridae |
| 188 | 2648501856 | Candidatus Baumannia cicadellinicola BGSS | Isolate | Cicadellidae |
| 189 | 2667527887 | Vibrio harveyi LMG 4044 | Isolate | Unclassified |
| 190 | 2684622918 | Bifidobacterium asteroides Bi_198 | Isolate | Unclassified |
| 191 | 2778261152 | Escherichia coli MOD1-EC284 | Isolate | Unclassified |
| 192 | 2791355471 | Vibrio bivalvicida 605 | Isolate | Unclassified |
| 193 | 2820013017 | Unclassified Spirochaetes Th196P3bin152 | Isolate | Unclassified |
| 194 | 2820267566 | Unclassified Firmicutes Th196P3bin33 | Isolate | Unclassified |
| 195 | 2820592308 | Unclassified Firmicutes Emb289P1bin71 | Isolate | Unclassified |
| 196 | 3300056856 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) | Metagenome | Tenebrionidae |
| 197 | 637000057 | Candidatus Blochmannia pennsylvanicus BPEN | Isolate | Formicidae |
| 198 | 639633012 | Buchnera aphidicola Bp | Isolate | Aphididae |
| 199 | 650716016 | Candidatus Moranella endobia PCIT | Isolate | Pseudococcidae |
| 200 | 8018312681 | Enterobacter sp. OLF | Isolate | Tephritidae |
| 201 | 8021540981 | Klebsiella sp. Kpp | Isolate | Tephritidae |
| 202 | 8024981139 | Bifidobacterium asteroides ESL0170 | Isolate | Apidae |
| 203 | 8024984606 | Bifidobacterium asteroides ESL0199 | Isolate | Apidae |
| 204 | 8028002147 | Enterobacter sp. 10-1 | Isolate | Cerambycidae |
| 205 | 8051534459 | Vibrio vulnificus Vv004 | Isolate | |
| 206 | 8110023836 | Enterobacterales bacterium BIT-L3 | Isolate | Tenebrionidae |
| 207 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 208 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 209 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 210 | 2970199020 | Lactiplantibacillus plantarum FlyG8.1.2 | Isolate | Drosophilidae |
| 211 | 2977635137 | Lactiplantibacillus plantarum DietG20.1.2 | Isolate | Unclassified |
| 212 | 2978161719 | Serratia marcescens KZ2 | Isolate | Apidae |
| 213 | 3006225627 | Vibrio sp. Hep-1b-8 | Isolate | Unclassified |
| 214 | 3006242587 | Vibrio sp. RE86 | Isolate | Unclassified |
| 215 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 216 | 3300003973 | Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle | Metagenome | Curculionidae |
| 217 | 2835335304 | Rahnella sp. Larv3_ips | Isolate | Curculionidae |
| 218 | 2859315706 | Serratia sp. 3ACOL1 | Isolate | Cerambycidae |
| 219 | 2885050628 | Erwinia sp. OLMTSP26 | Isolate | Anthocoridae |
| 220 | 2885061987 | Erwinia sp. OLFS4 | Isolate | Anthocoridae |
| 221 | 2885065815 | Erwinia sp. OAMSP11 | Isolate | Anthocoridae |
| 222 | 2898991528 | Erwinia sp. OLMDLW33 | Isolate | Anthocoridae |
| 223 | 2912570088 | Vibrio parahaemolyticus CHN25 | Isolate | |
| 224 | 2957623355 | Lactiplantibacillus plantarum FlyG11.1.2 | Isolate | Drosophilidae |
| 225 | 2961206375 | Serratia sp. OMLW3 | Isolate | Anthocoridae |
| 226 | 2531839005 | Vibrio harveyi CAIM 1792 | Isolate | Unclassified |
| 227 | 2537561600 | Salmonella enterica enterica sv. Newport CVM 19443 | Isolate | Unclassified |
| 228 | 2554235022 | Vibrio parahaemolyticus v110 | Isolate | |
| 229 | 2562617066 | Rickettsiella grylli AAQJ | Isolate | Armadillidiidae |
| 230 | 2660238275 | Bifidobacterium indicum DSM 20214 | Isolate | Unclassified |
| 231 | 2663763317 | Vibrio parahaemolyticus ISF-94-1 | Isolate | Unclassified |
| 232 | 2684622916 | Bifidobacterium asteroides Bi_170 | Isolate | Unclassified |
| 233 | 2684622917 | Bifidobacterium coryneforme Bi_197 | Isolate | Unclassified |
| 234 | 2693429521 | Bifidobacterium coryneforme DSM 20216 | Isolate | Unclassified |
| 235 | 2703719239 | Serratia marcescens ano1 | Isolate | Unclassified |
| 236 | 2778261153 | Escherichia coli MOD1-EC286 | Isolate | Unclassified |
| 237 | 2788500098 | Bombiscardovia coagulans DSM 22924 | Isolate | Apidae |
| 238 | 2820471304 | Unclassified Firmicutes Lab288P1bin89 | Isolate | Unclassified |
| 239 | 8004285568 | Serratia sp. OLHL2 | Isolate | Anthocoridae |
| 240 | 8004541719 | Serratia marcescens KZ19 | Isolate | Apidae |
| 241 | 8004582426 | Serratia sp. OSPLW9 | Isolate | Anthocoridae |
| 242 | 8024982947 | Bifidobacterium asteroides ESL0200 | Isolate | Apidae |
| 243 | 8051551332 | Vibrio vulnificus Vv003 | Isolate | |
| 244 | 2967802344 | Lactiplantibacillus plantarum FlyG11.1.6 | Isolate | Drosophilidae |
| 245 | 2977592972 | Lactiplantibacillus plantarum FlyG7.1.6 | Isolate | Drosophilidae |
| 246 | 2986970932 | Candidatus Fukatsuia symbiotica 5D | Isolate | Unclassified |
| 247 | 2999270917 | Enterobacteriaceae endosymbiont of Neohaemonia nigricornis NnigSym | Isolate | Chrysomelidae |
| 248 | 3300002932 | Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 | Metagenome | Formicidae |
| 249 | 3300005721 | Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 | Metagenome | Apidae |
| 250 | 3300007733 | Gill chamber microbial communities of deep-sea hydrothermal vent shrimp from South Atlantic Ocean | Metagenome | |
| 251 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 252 | 2846386538 | Rahnella sp. AN3-3W3 | Isolate | Pentatomidae |
| 253 | 2938192669 | Citrobacter sp. TSA-1 | Isolate | Unclassified |
| 254 | 2568526170 | Bifidobacterium sp. A11 | Isolate | Apidae |
| 255 | 2571042554 | Vibrio owensii CAIM 1854 | Isolate | Palinuridae |
| 256 | 2597489902 | Providencia rettgeri Dmel1 | Isolate | Drosophilidae |
| 257 | 2600255079 | Bifidobacterium bombi DSM 19703 | Isolate | Apidae |
| 258 | 2617270844 | Dyella sp. HyOG | Isolate | Cixiidae |
| 259 | 2671180705 | Pseudoalteromonas piscicida S2040 | Isolate | Unclassified |
| 260 | 2684622919 | Bifidobacterium asteroides Bi_199 | Isolate | Unclassified |
| 261 | 2770939318 | Lactiplantibacillus plantarum plantarum LP2 | Isolate | Apidae |
| 262 | 2820110010 | Unclassified Proteobacteria Emb289P4bin35 | Isolate | Unclassified |
| 263 | 8021546568 | Klebsiella sp. Kps | Isolate | Tephritidae |
| 264 | 8024986378 | Bifidobacterium asteroides ESL0198 | Isolate | Apidae |
| 265 | 8032009961 | Bifidobacterium indicum ESL0197 | Isolate | Apidae |
| 266 | 8065462725 | Tatumella sp. JGM100 | Isolate | Drosophilidae |
| 267 | 8065466226 | Tatumella sp. JGM130 | Isolate | Drosophilidae |
| 268 | 8065469765 | Tatumella sp. JGM16 | Isolate | Drosophilidae |
| 269 | 8071322446 | Escherichia coli PN122 | Isolate | Calliphoridae |
| 270 | 8100171289 | Kosakonia sp. S42 | Isolate | Curculionidae |
| 271 | 8101680043 | Providencia sp. JGM178 | Isolate | Drosophilidae |
| 272 | 8103002986 | Erwinia sp. S38 | Isolate | Curculionidae |
| 273 | 8103008710 | Erwinia sp. S43 | Isolate | Curculionidae |
| 274 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 275 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 276 | 2971189173 | Yersinia pestis A-1249 | Isolate | Unclassified |
| 277 | 3300007505 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut | Metagenome | Drosophilidae |
| 278 | 3300009457 | Microbial communities of aphids from Cornus stolonifera in Ithaca, NY, USA - Anoecia oenotherae NM10041110_01 seqcov | Metagenome | |
| 279 | 3300030930 | Ant gut bacterial community from Pseudomyrmex nigropilosus larvae, the Area de Conservacion Guanacaste, Costa Rica - colony BER0554 | Metagenome | Formicidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466733_181520 | 3300042659 | Bacteria | 6887 |
| 2 | Ga0466715_350462 | 3300042616 | Bacteria | 102654 |
| 3 | Ga0466715_542117 | 3300042616 | Bacteria | 8959 |
| 4 | Ga0466691_120274 | 3300042593 | Bacteria | 2357 |
| 5 | Ga0466706_077622 | 3300042599 | Bacteria | 15420 |
| 6 | Ga0466707_075100 | 3300042601 | Bacteria | 6888 |
| 7 | Ga0466730_000957 | 3300042625 | Bacteria | 12710 |
| 8 | Ga0466730_053790 | 3300042625 | Unclassified | 5536 |
| 9 | Ga0466724_08214 | 3300042649 | Unclassified | 5100 |
| 10 | CVPL010L_1000331 | 3300002932 | Unclassified | 11536 |
| 11 | Ga0063521_1000800 | 3300003973 | Unclassified | 11238 |
| 12 | Ga0123355_10043904 | 3300009826 | Unclassified | 7272 |
| 13 | Ga0123353_10242305 | 3300010167 | Bacteria | 2800 |
| 14 | Ga0123353_10560078 | 3300010167 | Bacteria | 1646 |
| 15 | Ga0415639_169508 | 3300038395 | Bacteria | 1416 |
| 16 | Ga0466690_372316 | 3300042590 | Bacteria | 4601 |
| 17 | Ga0466714_108797 | 3300042603 | Bacteria | 2224 |
| 18 | Ga0466716_068056 | 3300042605 | Bacteria | 18344 |
| 19 | Ga0466722_144248 | 3300042609 | Bacteria | 5924 |
| 20 | Ga0466703_379003 | 3300042636 | Bacteria | 2375 |
| 21 | FGTW_contig18894 | 2065487013 | Unclassified | 3917 |
| 22 | SWWA_contig04819__length_3600___numreads_61 | 2100351016 | Unclassified | 3600 |
| 23 | 2227080770 | 2225789004 | Bacteria | 234484 |
| 24 | 2227161923 | 2225789004 | Bacteria | 1551 |
| 25 | AustNasuHG_c1000972 | 3300000089 | Bacteria | 10321 |
| 26 | Ga0068305_10001462 | 3300005083 | Unclassified | 45206 |
| 27 | Ga0123357_10000427 | 3300009784 | Unclassified | 40313 |
| 28 | Ga0123355_10289581 | 3300009826 | Bacteria | 2249 |
| 29 | Ga0123356_10014337 | 3300010049 | Bacteria | 7624 |
| 30 | Ga0123353_10149709 | 3300010167 | Bacteria | 3727 |
| 31 | Ga0123353_10959233 | 3300010167 | Bacteria | 1155 |
| 32 | Ga0466710_126847 | 3300042613 | Bacteria | 25061 |
| 33 | Ga0466711_188417 | 3300042615 | Bacteria | 19499 |
| 34 | Ga0265387_1000118 | 3300024582 | Bacteria | 16924 |
| 35 | Ga0247289_0691 | 3300035363 | Unclassified | 4345 |
| 36 | Ga0415639_073918 | 3300038395 | Bacteria | 8514 |
| 37 | Ga0466730_027729 | 3300042625 | Unclassified | 15796 |
| 38 | Ga0466704_116946 | 3300042643 | Bacteria | 15161 |
| 39 | Ga0466724_51256 | 3300042649 | Bacteria | 9653 |
| 40 | DPOL_contig14146 | 2035918003 | Bacteria | 15282 |
| 41 | FGTW_contig30406 | 2065487013 | Bacteria | 104687 |
| 42 | JGI24702J35022_10000541 | 3300002462 | Bacteria | 22799 |
| 43 | Ga0063521_1000008 | 3300003973 | Bacteria | 208160 |
| 44 | Ga0063521_1000806 | 3300003973 | Bacteria | 11149 |
| 45 | Ga0562375_0529 | 3300056856 | Bacteria | 77135 |
| 46 | Ga0466657_055885 | 3300042582 | Bacteria | 5376 |
| 47 | Ga0466690_128201 | 3300042590 | Bacteria | 2803 |
| 48 | Ga0466706_203742 | 3300042599 | Bacteria | 9050 |
| 49 | Ga0466730_051950 | 3300042625 | Unclassified | 7328 |
| 50 | Ga0466703_037718 | 3300042636 | Bacteria | 6098 |
| 51 | Ga0466704_064085 | 3300042643 | Bacteria | 388657 |
| 52 | Ga0466704_468085 | 3300042643 | Bacteria | 1214 |
| 53 | FGTW_contig33477 | 2065487013 | Unclassified | 1610 |
| 54 | 2227619063 | 2225789004 | Bacteria | 44654 |
| 55 | HBC_ctgsDRAFT_1000454 | 3300000333 | Bacteria | 9277 |
| 56 | Ga0072941_1216147 | 3300005201 | Bacteria | 3511 |
| 57 | Ga0074278_142697 | 3300005721 | Unclassified | 6589 |
| 58 | Ga0123355_10103583 | 3300009826 | Bacteria | 4473 |
| 59 | Ga0123353_10042182 | 3300010167 | Unclassified | 7214 |
| 60 | Ga0123353_10110347 | 3300010167 | Bacteria | 4432 |
| 61 | Ga0466705_208932 | 3300042612 | Bacteria | 112571 |
| 62 | Ga0562375_0158 | 3300056856 | Unclassified | 198740 |
| 63 | Ga0265387_1001775 | 3300024582 | Unclassified | 3089 |
| 64 | Ga0466713_040791 | 3300042602 | Bacteria | 12801 |
| 65 | Ga0466730_078667 | 3300042625 | Bacteria | 2481 |
| 66 | Ga0466724_07961 | 3300042649 | Bacteria | 121451 |
| 67 | IMNBL1DRAFT_c0004526 | 3300000062 | Bacteria | 8307 |
| 68 | Ga0127657_109754 | 3300009457 | Bacteria | 31965 |
| 69 | Ga0466723_179017 | 3300042618 | Bacteria | 5587 |
| 70 | Ga0466723_189744 | 3300042618 | Bacteria | 70878 |
| 71 | Ga0466723_255670 | 3300042618 | Bacteria | 17956 |
| 72 | Ga0316159_11023 | 3300030930 | Bacteria | 4964 |
| 73 | Ga0466707_246801 | 3300042601 | Unclassified | 4004 |
| 74 | Ga0466725_418178 | 3300042654 | Bacteria | 11595 |
| 75 | IMNBL1DRAFT_c0000066 | 3300000062 | Bacteria | 95639 |
| 76 | Ga0105524_101507 | 3300007733 | Unclassified | 6693 |
| 77 | Ga0105524_101508 | 3300007733 | Bacteria | 4274 |
| 78 | Ga0127649_143139 | 3300009460 | Bacteria | 3953 |
| 79 | Ga0123356_10053429 | 3300010049 | Bacteria | 3760 |
| 80 | Ga0123353_10004893 | 3300010167 | Bacteria | 17423 |
| 81 | Ga0123353_10169817 | 3300010167 | Bacteria | 3463 |
| 82 | Ga0123354_10133230 | 3300010882 | Unclassified | 3125 |
| 83 | Ga0562374_0001 | 3300057007 | Bacteria | 4762007 |
| 84 | Ga0466706_175790 | 3300042599 | Bacteria | 85125 |
| 85 | Ga0466714_051629 | 3300042603 | Bacteria | 4302 |
| 86 | Ga0104042_1001399 | 3300007130 | Unclassified | 6100 |
| 87 | Ga0105005_1032090 | 3300007505 | Bacteria | 18462 |
| 88 | Ga0123353_10225479 | 3300010167 | Bacteria | 2926 |
| 89 | Ga0123353_10460983 | 3300010167 | Bacteria | 1867 |
| 90 | Ga0466730_075185 | 3300042625 | Unclassified | 1381 |
| 91 | Ga0466730_093779 | 3300042625 | Bacteria | 13770 |
| 92 | Ga0466730_095719 | 3300042625 | Bacteria | 1186 |
| 93 | Ga0466724_43871 | 3300042649 | Bacteria | 1139 |
| 94 | 2227010941 | 2225789003 | Unclassified | 5560 |
| 95 | Ga0104040_1039395 | 3300007149 | Unclassified | 1746 |
| 96 | Ga0123355_10002302 | 3300009826 | Bacteria | 26960 |
| 97 | Ga0123356_10000097 | 3300010049 | Bacteria | 92344 |
| 98 | Ga0123356_10057165 | 3300010049 | Bacteria | 3636 |
Family Sequences
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00953 | Glycos_transf_4 | Glycosyl transferase family 4 | 99 | 300 | 0.91 |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.91 | 0.92 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.