Protein Family IF12230

Metagenome Isolate
175 Members
69 Samples
154 Scaffolds
423.99 Avg Length

🧬 Representative Sequence

ID
iso_pr_bacteria|2828505942|2828506614|
Length
462 aa
Sequence
MKILMLGWEYPPIISGGLGTATEGIVKGLLEVGHEVTLVLPHFPVKVTLPKGLKIVSPENPFIMRKKLFNNFSNSLGNKKSRYESERLMSEINENYKDLLFNSHYDYSNKQIEFSEGHKKVIKKKFLKYVNSLYKNMNISDFVSEFRKLFIDKDSYQEKAYILGLLALNIIEQDSDYHVIHANDWMTFVAAKMVKEKIDIPLFVHIHSTELDRSGEINYNEKILQIEKMGLELADMIIAVSNYTKNIIVNNFKIPNSKIKVVYNANNTKHEINNFKQSLLSLENKVPIVTFVGRVTYQKGPYYFVQAAKKVLQFNSNVMFKVVGSGDLLVSMKQLVSELKLDKNFYFTGFLNSNEVKNILADSDVFVMPSVSEPFGIVALEAIAQKIPVIISKQSGVSEVLNHVLKVDFWDTDLIADRILSVLKYHCIKSEMIDYSLQDLSQRTWIKSAETLTAAYSEIPKS

📊 Sample Types

Isolate 12.0%
Metagenome 88.0%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 31.3%
Unclassified 28.4%
Kalotermitidae 19.4%
Rhinotermitidae 6.0%
Termopsidae 4.5%
Hydrophilidae 3.0%
Blattidae 3.0%
Hodotermitidae 1.5%
Tenebrionidae 1.5%
Passalidae 1.5%

🌳 Taxonomy

Archaea 1
Bacteria 168
Eukaryota 0
Viruses 0
Unclassified 6

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820023741 Unclassified Spirochaetes Lab288P3bin165 Isolate Unclassified
2 2820727601 Unclassified Cloacimonetes Nt197P3bin46 Isolate Unclassified
3 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
4 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
5 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
6 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
7 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
8 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
9 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
10 2820770630 Unclassified Bacteroidetes Lab288P3bin130 Isolate Unclassified
11 2828505942 Spirobacillus cienkowskii binning01 Isolate Unclassified
12 2820746860 Unclassified Bacteroidetes Th196P3bin126 Isolate Unclassified
13 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
14 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
15 8100157865 Dysgonomonas sp. GY617 Isolate Rhinotermitidae
16 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
17 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
18 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
19 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
20 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
21 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
22 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
23 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
24 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
25 2820788205 Unclassified Bacteroidetes Emb289P1bin57 Isolate Unclassified
26 2873610414 Dysgonomonas sp. HDW5B Isolate Hydrophilidae
27 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
28 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
29 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
30 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
31 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
32 3300024582 Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 Metagenome
33 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
34 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
35 2695420317 Dysgonomonas sp. HGC4 Isolate Unclassified
36 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
37 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
38 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
39 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
40 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
41 2820785563 Unclassified Bacteroidetes Emb289P1bin74 Isolate Unclassified
42 2873600114 Dysgonomonas sp. HDW5A Isolate Hydrophilidae
43 2820027804 Unclassified Spirochaetes Lab288P1bin105 Isolate Unclassified
44 2820740053 Unclassified Bacteroidetes Th196P3bin81 Isolate Unclassified
45 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
46 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
47 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
48 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
49 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
50 2910930387 Dysgonomonas sp. 216 Isolate Blattidae
51 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
52 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
53 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
54 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
55 2920168565 Paludibacter sp. 221 Isolate Blattidae
56 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
57 2695420931 Dysgonomonas macrotermitis DSM 27370 Isolate Unclassified
58 2819990093 Unclassified Spirochaetes Cu122P1bin9 Isolate Unclassified
59 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
60 2820021908 Unclassified Spirochaetes Lab288P4bin6 Isolate Unclassified
61 2820724199 Unclassified Cloacimonetes Th196P3bin22 Isolate Unclassified
62 2820736622 Unclassified Bacteroidetes Th196P4bin26 Isolate Unclassified
63 2820208273 Unclassified Microgenomates Th196P3bin94 Isolate Unclassified
64 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
65 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
66 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
67 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
68 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
69 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466733_075139 3300042659 Bacteria 5840
2 Ga0123354_10052024 3300010882 Bacteria 6176
3 Ga0466706_011910 3300042599 Bacteria 39915
4 Ga0466706_188460 3300042599 Bacteria 25440
5 Ga0466706_230598 3300042599 Unclassified 1359
6 Ga0466700_370829 3300042600 Bacteria 1469
7 Ga0466707_372044 3300042601 Bacteria 2663
8 Ga0466714_028404 3300042603 Bacteria 2097
9 Ga0466714_131315 3300042603 Bacteria 35796
10 Ga0466697_162040 3300042611 Bacteria 2433
11 Ga0466709_392133 3300042648 Bacteria 13579
12 Ga0466705_486768 3300042612 Bacteria 3434
13 Ga0415639_046188 3300038395 Bacteria 12682
14 Ga0415639_054866 3300038395 Unclassified 11953
15 Ga0466656_200104 3300042550 Bacteria 5500
16 Ga0466690_333270 3300042590 Bacteria 11132
17 Ga0466691_227165 3300042593 Bacteria 7427
18 Ga0466696_231722 3300042596 Bacteria 21210
19 Ga0466733_073670 3300042659 Bacteria 1535
20 Ga0562377_0004 3300056842 Bacteria 3525959
21 Ga0123353_10004662 3300010167 Bacteria 17714
22 Ga0123353_10027644 3300010167 Bacteria 8698
23 Ga0466706_007312 3300042599 Bacteria 6515
24 Ga0466713_110748 3300042602 Bacteria 2996
25 Ga0466714_075210 3300042603 Bacteria 17760
26 Ga0466717_294566 3300042604 Bacteria 4665
27 JGI24702J35022_10003297 3300002462 Bacteria 9749
28 JGI24705J35276_12231883 3300002504 Bacteria 4101
29 Ga0466703_013629 3300042636 Bacteria 2849
30 Ga0466704_049172 3300042643 Bacteria 6272
31 Ga0466708_370173 3300042652 Bacteria 14554
32 Ga0466711_268714 3300042615 Bacteria 10697
33 Ga0466711_384978 3300042615 Bacteria 26666
34 Ga0466715_181207 3300042616 Bacteria 24444
35 Ga0466715_578748 3300042616 Bacteria 6211
36 Ga0466723_101863 3300042618 Bacteria 35831
37 Ga0466726_340103 3300042619 Bacteria 6321
38 Ga0466728_003422 3300042620 Bacteria 9494
39 Ga0466728_093793 3300042620 Bacteria 6220
40 Ga0415639_054865 3300038395 Bacteria 3463
41 Ga0466657_031327 3300042582 Bacteria 2600
42 Ga0466657_257454 3300042582 Bacteria 2023
43 Ga0466692_104659 3300042591 Bacteria 36513
44 Ga0466691_035670 3300042593 Bacteria 11664
45 Ga0466733_099225 3300042659 Bacteria 7640
46 Ga0123356_10056708 3300010049 Bacteria 3650
47 Ga0123356_10123699 3300010049 Bacteria 2521
48 Ga0123353_10029847 3300010167 Bacteria 8412
49 Ga0123354_10288765 3300010882 Bacteria 1576
50 Ga0466697_015667 3300042611 Bacteria 1279
51 JGI24705J35276_12235485 3300002504 Bacteria 6574
52 Ga0466705_171946 3300042612 Bacteria 7040
53 Ga0466705_238775 3300042612 Bacteria 8370
54 Ga0466703_164881 3300042636 Bacteria 4837
55 Ga0466703_331987 3300042636 Bacteria 2365
56 Ga0466703_355781 3300042636 Bacteria 5833
57 Ga0466708_286335 3300042652 Bacteria 16948
58 Ga0466711_151683 3300042615 Bacteria 4564
59 Ga0466711_189974 3300042615 Bacteria 5477
60 Ga0466729_139127 3300042621 Bacteria 4006
61 Ga0466657_085300 3300042582 Bacteria 6652
62 Ga0466690_116257 3300042590 Bacteria 7709
63 Ga0123356_10115721 3300010049 Bacteria 2599
64 Ga0123356_10145590 3300010049 Bacteria 2343
65 Ga0123353_10089501 3300010167 Bacteria 4956
66 Ga0466706_089813 3300042599 Bacteria 54811
67 Ga0466706_181757 3300042599 Bacteria 31091
68 Ga0466714_061134 3300042603 Bacteria 3600
69 Ga0466714_066409 3300042603 Bacteria 7079
70 Ga0466714_120823 3300042603 Bacteria 4658
71 Ga0466719_534117 3300042606 Bacteria 6240
72 2227341911 2225789004 Bacteria 6240
73 JGI24705J35276_12235370 3300002504 Bacteria 6460
74 Ga0072940_1391490 3300005200 Bacteria 3824
75 Ga0072941_1014336 3300005201 Bacteria 17012
76 Ga0466697_272913 3300042611 Bacteria 12072
77 Ga0466704_203489 3300042643 Bacteria 4118
78 Ga0466708_023836 3300042652 Bacteria 5482
79 Ga0466723_050045 3300042618 Bacteria 16417
80 Ga0466657_179854 3300042582 Bacteria 2299
81 Ga0466690_093185 3300042590 Bacteria 6040
82 Ga0466691_026668 3300042593 Bacteria 3460
83 Ga0466691_053905 3300042593 Bacteria 19612
84 Ga0466696_155458 3300042596 Bacteria 4261
85 Ga0466733_055806 3300042659 Bacteria 2727
86 Ga0123355_10010330 3300009826 Bacteria 14292
87 Ga0123353_10039792 3300010167 Bacteria 7407
88 Ga0123353_10150522 3300010167 Bacteria 3716
89 Ga0123353_10151959 3300010167 Archaea 3695
90 Ga0466713_113552 3300042602 Bacteria 2776
91 Ga0466714_058710 3300042603 Bacteria 109931
92 Ga0466714_117553 3300042603 Bacteria 17526
93 Ga0466714_119975 3300042603 Bacteria 4930
94 JGI24696J40584_12960943 3300002834 Bacteria 9557
95 Ga0072941_1091753 3300005201 Bacteria 5077
96 Ga0466715_285475 3300042616 Bacteria 12063
97 Ga0466715_368745 3300042616 Bacteria 44371
98 Ga0415639_255304 3300038395 Bacteria 2785
99 Ga0466657_053274 3300042582 Bacteria 3830
100 Ga0466690_231213 3300042590 Unclassified 3170
101 Ga0466691_022736 3300042593 Bacteria 17480
102 Ga0466733_034872 3300042659 Bacteria 11561
103 Ga0466733_169240 3300042659 Bacteria 4697
104 Ga0123355_10000700 3300009826 Bacteria 45486
105 Ga0123356_10277402 3300010049 Bacteria 1769
106 Ga0123353_10008238 3300010167 Bacteria 14206
107 Ga0123353_10028149 3300010167 Bacteria 8627
108 Ga0123353_10218372 3300010167 Bacteria 2984
109 Ga0123353_10431290 3300010167 Bacteria 1949
110 Ga0123354_10297348 3300010882 Bacteria 1534
111 Ga0466706_024921 3300042599 Bacteria 4563
112 Ga0466706_041845 3300042599 Unclassified 3812
113 Ga0466706_053003 3300042599 Unclassified 2184
114 Ga0466713_021467 3300042602 Bacteria 36702
115 JGI24702J35022_10001262 3300002462 Bacteria 15781
116 Ga0466705_010836 3300042612 Bacteria 7056
117 Ga0466705_042060 3300042612 Bacteria 13919
118 Ga0466735_177842 3300042624 Bacteria 1554
119 Ga0466708_181194 3300042652 Bacteria 24776
120 Ga0466711_274662 3300042615 Bacteria 19079
121 Ga0466715_017275 3300042616 Bacteria 2252
122 Ga0466726_407218 3300042619 Bacteria 2908
123 Ga0265387_1001354 3300024582 Bacteria 3583
124 Ga0466690_024348 3300042590 Bacteria 16349
125 Ga0466695_315523 3300042595 Bacteria 24973
126 Ga0466732_040314 3300042656 Bacteria 3544
127 Ga0466706_213723 3300042599 Bacteria 14614
128 Ga0466700_061944 3300042600 Bacteria 2549
129 Ga0466714_009598 3300042603 Bacteria 4407
130 Ga0466714_146137 3300042603 Bacteria 42453
131 Ga0466722_167084 3300042609 Bacteria 4108
132 2227591281 2225789004 Bacteria 48540
133 JGI24702J35022_10002145 3300002462 Bacteria 12176
134 Ga0072941_1025750 3300005201 Bacteria 10646
135 Ga0072941_1036082 3300005201 Unclassified 6923
136 Ga0466734_070901 3300042623 Bacteria 2289
137 Ga0466730_054826 3300042625 Bacteria 4037
138 Ga0466727_136441 3300042655 Bacteria 19395
139 Ga0466733_032834 3300042659 Bacteria 13907
140 Ga0123357_10033407 3300009784 Bacteria 6990
141 Ga0123355_10001902 3300009826 Bacteria 29343
142 Ga0123353_10000175 3300010167 Bacteria 81609
143 Ga0123353_10202659 3300010167 Bacteria 3120
144 Ga0466706_279275 3300042599 Bacteria 5698
145 Ga0466714_032455 3300042603 Bacteria 12581
146 Ga0466714_119180 3300042603 Bacteria 4609
147 Ga0466714_149877 3300042603 Bacteria 4520
148 Ga0068305_10333635 3300005083 Bacteria 5530
149 Ga0072941_1018815 3300005201 Bacteria 18367
150 Ga0466729_243212 3300042621 Bacteria 24352
151 Ga0466708_277226 3300042652 Bacteria 15355
152 Ga0466728_119745 3300042620 Bacteria 20813
153 Ga0415639_062502 3300038395 Bacteria 2956
154 Ga0466690_272889 3300042590 Bacteria 7294

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042582 Ga0466657_031327 Ga0466657_031327_21_1031 336
2 iso_pr_bacteria 2820023741 2820025018 359
3 3300010167 Ga0123353_10029847 Ga0123353_100298472 360
4 3300010882 Ga0123354_10288765 Ga0123354_102887652 366
5 3300042603 Ga0466714_028404 Ga0466714_028404_20_1246 394
6 3300042611 Ga0466697_015667 Ga0466697_015667_14_1201 395
7 3300042603 Ga0466714_119975 Ga0466714_119975_2826_4139 397
8 3300005200 Ga0072940_1391490 Ga0072940_13914901 399
9 3300042599 Ga0466706_053003 Ga0466706_053003_393_1682 402
10 3300042603 Ga0466714_119180 Ga0466714_119180_2421_3695 402
11 3300042599 Ga0466706_041845 Ga0466706_041845_396_1688 404
12 3300042599 Ga0466706_213723 Ga0466706_213723_410_1696 404
13 3300009826 Ga0123355_10001902 Ga0123355_1000190210 406
14 3300042590 Ga0466690_333270 Ga0466690_333270_2684_3973 406
15 3300042659 Ga0466733_032834 Ga0466733_032834_2239_3513 406
16 3300042593 Ga0466691_022736 Ga0466691_022736_11670_12962 407
17 3300042599 Ga0466706_230598 Ga0466706_230598_41_1327 410
18 3300042599 Ga0466706_024921 Ga0466706_024921_2062_3351 411
19 2225789004 2227341911 2227788704 413
20 3300042619 Ga0466726_407218 Ga0466726_407218_760_2028 414
21 3300042659 Ga0466733_073670 Ga0466733_073670_194_1438 414
22 iso_pr_bacteria 2820727601 2820728677 414
23 3300042616 Ga0466715_368745 Ga0466715_368745_6646_7911 415
24 3300042659 Ga0466733_034872 Ga0466733_034872_3781_5070 415
25 3300042659 Ga0466733_169240 Ga0466733_169240_300_1583 415
26 3300002834 JGI24696J40584_12960943 JGI24696J40584_129609432 416
27 3300005083 Ga0068305_10333635 Ga0068305_103336353 416
28 3300042600 Ga0466700_061944 Ga0466700_061944_472_1758 416
29 3300042659 Ga0466733_055806 Ga0466733_055806_787_2073 416
30 3300042596 Ga0466696_155458 Ga0466696_155458_1587_2840 417
31 3300042602 Ga0466713_113552 Ga0466713_113552_125_1378 417
32 3300042603 Ga0466714_120823 Ga0466714_120823_1138_2436 417
33 3300042611 Ga0466697_162040 Ga0466697_162040_244_1497 417
34 3300042612 Ga0466705_486768 Ga0466705_486768_1888_3141 417
35 3300042616 Ga0466715_578748 Ga0466715_578748_973_2226 417
36 3300042652 Ga0466708_277226 Ga0466708_277226_8377_9672 417
37 3300009826 Ga0123355_10010330 Ga0123355_1001033012 418
38 3300038395 Ga0415639_054866 Ga0415639_054866_3029_4360 418
39 3300042601 Ga0466707_372044 Ga0466707_372044_51_1307 418
40 3300042603 Ga0466714_146137 Ga0466714_146137_4245_5501 418
41 3300042621 Ga0466729_139127 Ga0466729_139127_1443_2699 418
42 iso_pr_bacteria 2910930387 2910931091 418
43 3300010167 Ga0123353_10218372 Ga0123353_102183722 419
44 3300042636 Ga0466703_331987 Ga0466703_331987_960_2219 419
45 iso_pr_bacteria 2920168565 2920169717 419
46 3300042619 Ga0466726_340103 Ga0466726_340103_2603_3883 420
47 3300042625 Ga0466730_054826 Ga0466730_054826_1970_3232 420
48 3300042643 Ga0466704_203489 Ga0466704_203489_491_1753 420
49 3300042656 Ga0466732_040314 Ga0466732_040314_684_1946 420
50 3300010167 Ga0123353_10202659 Ga0123353_102026593 421
51 3300038395 Ga0415639_054865 Ga0415639_054865_1198_2538 421
52 3300042590 Ga0466690_024348 Ga0466690_024348_3365_4630 421
53 3300042590 Ga0466690_272889 Ga0466690_272889_3099_4364 421
54 3300042593 Ga0466691_035670 Ga0466691_035670_4185_5450 421
55 3300042616 Ga0466715_181207 Ga0466715_181207_18642_19907 421
56 3300042596 Ga0466696_231722 Ga0466696_231722_17344_18612 422
57 3300042593 Ga0466691_053905 Ga0466691_053905_13306_14601 423
58 3300042599 Ga0466706_007312 Ga0466706_007312_5213_6484 423
59 3300042599 Ga0466706_279275 Ga0466706_279275_4312_5583 423
60 3300042603 Ga0466714_058710 Ga0466714_058710_65651_66922 423
61 3300042615 Ga0466711_384978 Ga0466711_384978_14116_15387 423
62 3300042616 Ga0466715_285475 Ga0466715_285475_6984_8258 424
63 3300042624 Ga0466735_177842 Ga0466735_177842_28_1302 424
64 3300010049 Ga0123356_10277402 Ga0123356_102774022 425
65 3300042582 Ga0466657_257454 Ga0466657_257454_494_1771 425
66 3300042590 Ga0466690_116257 Ga0466690_116257_1557_2834 425
67 3300042593 Ga0466691_227165 Ga0466691_227165_2620_3897 425
68 3300042599 Ga0466706_089813 Ga0466706_089813_26490_27767 425
69 3300042602 Ga0466713_021467 Ga0466713_021467_7022_8299 425
70 3300042603 Ga0466714_075210 Ga0466714_075210_2952_4229 425
71 3300042604 Ga0466717_294566 Ga0466717_294566_2642_3919 425
72 3300042615 Ga0466711_151683 Ga0466711_151683_2091_3368 425
73 3300042615 Ga0466711_268714 Ga0466711_268714_5992_7269 425
74 3300042618 Ga0466723_101863 Ga0466723_101863_28119_29396 425
75 3300042623 Ga0466734_070901 Ga0466734_070901_550_1827 425
76 3300042636 Ga0466703_355781 Ga0466703_355781_2316_3593 425
77 iso_pr_bacteria 2695420931 2698110487 425
78 3300010167 Ga0123353_10027644 Ga0123353_100276442 426
79 3300024582 Ga0265387_1001354 Ga0265387_10013542 426
80 3300042603 Ga0466714_149877 Ga0466714_149877_3154_4434 426
81 3300042648 Ga0466709_392133 Ga0466709_392133_12106_13386 426
82 3300042655 Ga0466727_136441 Ga0466727_136441_11331_12611 426
83 iso_pr_bacteria 2873600114 2873603214 426
84 iso_pr_bacteria 2873610414 2873613595 426
85 2225789004 2227591281 2228150546 427
86 3300042618 Ga0466723_050045 Ga0466723_050045_12766_14049 427
87 3300042621 Ga0466729_243212 Ga0466729_243212_10835_12118 427
88 3300056842 Ga0562377_0004 Ga0562377_0004_1148922_1150205 427
89 3300010049 Ga0123356_10115721 Ga0123356_101157212 428
90 3300010167 Ga0123353_10151959 Ga0123353_101519593 428
91 3300042582 Ga0466657_085300 Ga0466657_085300_3777_5063 428
92 3300042582 Ga0466657_179854 Ga0466657_179854_146_1432 428
93 3300042590 Ga0466690_093185 Ga0466690_093185_868_2154 428
94 3300042590 Ga0466690_231213 Ga0466690_231213_237_1523 428
95 3300042591 Ga0466692_104659 Ga0466692_104659_1909_3195 428
96 3300042599 Ga0466706_181757 Ga0466706_181757_13402_14688 428
97 3300042599 Ga0466706_188460 Ga0466706_188460_16020_17306 428
98 3300042600 Ga0466700_370829 Ga0466700_370829_75_1361 428
99 3300042603 Ga0466714_009598 Ga0466714_009598_818_2104 428
100 3300042603 Ga0466714_131315 Ga0466714_131315_805_2091 428
101 3300042606 Ga0466719_534117 Ga0466719_534117_4680_5966 428
102 3300042611 Ga0466697_272913 Ga0466697_272913_8954_10255 428
103 3300042620 Ga0466728_093793 Ga0466728_093793_2828_4114 428
104 3300042659 Ga0466733_099225 Ga0466733_099225_3832_5118 428
105 3300002462 JGI24702J35022_10003297 JGI24702J35022_100032972 429
106 3300010167 Ga0123353_10431290 Ga0123353_104312902 429
107 3300010882 Ga0123354_10297348 Ga0123354_102973482 429
108 3300042582 Ga0466657_053274 Ga0466657_053274_2207_3496 429
109 3300042612 Ga0466705_171946 Ga0466705_171946_2544_3833 429
110 3300042636 Ga0466703_013629 Ga0466703_013629_193_1482 429
111 3300042652 Ga0466708_286335 Ga0466708_286335_11745_13034 429
112 3300042659 Ga0466733_075139 Ga0466733_075139_1870_3159 429
113 iso_pr_bacteria 2820208273 2820208571 429
114 3300002462 JGI24702J35022_10002145 JGI24702J35022_100021452 430
115 3300002504 JGI24705J35276_12231883 JGI24705J35276_122318833 430
116 3300002504 JGI24705J35276_12235485 JGI24705J35276_122354856 430
117 3300009784 Ga0123357_10033407 Ga0123357_100334073 430
118 3300010049 Ga0123356_10056708 Ga0123356_100567083 430
119 3300010049 Ga0123356_10123699 Ga0123356_101236992 430
120 3300010049 Ga0123356_10145590 Ga0123356_101455902 430
121 3300010167 Ga0123353_10028149 Ga0123353_100281494 430
122 3300010167 Ga0123353_10089501 Ga0123353_100895013 430
123 3300010167 Ga0123353_10150522 Ga0123353_101505222 430
124 3300010882 Ga0123354_10052024 Ga0123354_100520243 430
125 3300042593 Ga0466691_026668 Ga0466691_026668_852_2144 430
126 3300042595 Ga0466695_315523 Ga0466695_315523_1427_2719 430
127 3300042599 Ga0466706_011910 Ga0466706_011910_16273_17565 430
128 3300042616 Ga0466715_017275 Ga0466715_017275_590_1882 430
129 iso_pr_bacteria 2820746860 2820746867 430
130 iso_pr_bacteria 2820770630 2820771436 430
131 iso_pr_bacteria 2820785563 2820786549 430
132 iso_pr_bacteria 2820788205 2820789470 430
133 3300009826 Ga0123355_10000700 Ga0123355_100007002 431
134 3300010167 Ga0123353_10000175 Ga0123353_1000017583 431
135 3300042603 Ga0466714_061134 Ga0466714_061134_2171_3466 431
136 iso_pr_bacteria 2695420317 2695486459 431
137 iso_pr_bacteria 2819990093 2819991088 431
138 iso_pr_bacteria 2820027804 2820028428 431
139 iso_pr_bacteria 8100157865 8100160999 431
140 3300042603 Ga0466714_032455 Ga0466714_032455_6980_8278 432
141 iso_pr_bacteria 2820736622 2820737121 433
142 iso_pr_bacteria 2820740053 2820741144 433
143 3300002462 JGI24702J35022_10001262 JGI24702J35022_100012629 434
144 3300002504 JGI24705J35276_12235370 JGI24705J35276_122353704 434
145 3300010167 Ga0123353_10039792 Ga0123353_100397925 434
146 3300042602 Ga0466713_110748 Ga0466713_110748_776_2080 434
147 3300042612 Ga0466705_010836 Ga0466705_010836_1475_2779 434
148 3300042612 Ga0466705_238775 Ga0466705_238775_5610_6914 434
149 3300042615 Ga0466711_189974 Ga0466711_189974_2494_3798 434
150 3300042620 Ga0466728_003422 Ga0466728_003422_4129_5433 434
151 3300042636 Ga0466703_164881 Ga0466703_164881_1864_3168 434
152 3300042643 Ga0466704_049172 Ga0466704_049172_2444_3748 434
153 3300042652 Ga0466708_370173 Ga0466708_370173_6990_8294 434
154 3300042603 Ga0466714_066409 Ga0466714_066409_1407_2714 435
155 3300042652 Ga0466708_023836 Ga0466708_023836_1959_3266 435
156 3300042609 Ga0466722_167084 Ga0466722_167084_1848_3158 436
157 iso_pr_bacteria 2820021908 2820023282 437
158 iso_pr_bacteria 2820724199 2820725358 437
159 3300010167 Ga0123353_10004662 Ga0123353_100046625 438
160 3300042550 Ga0466656_200104 Ga0466656_200104_2894_4210 438
161 3300042615 Ga0466711_274662 Ga0466711_274662_15212_16528 438
162 3300038395 Ga0415639_062502 Ga0415639_062502_208_1527 439
163 3300038395 Ga0415639_255304 Ga0415639_255304_90_1409 439
164 3300005201 Ga0072941_1014336 Ga0072941_101433615 440
165 3300005201 Ga0072941_1018815 Ga0072941_10188156 440
166 3300005201 Ga0072941_1025750 Ga0072941_10257506 440
167 3300005201 Ga0072941_1036082 Ga0072941_10360822 440
168 3300005201 Ga0072941_1091753 Ga0072941_10917533 440
169 3300042603 Ga0466714_117553 Ga0466714_117553_12961_14283 440
170 3300010167 Ga0123353_10008238 Ga0123353_100082386 442
171 3300042612 Ga0466705_042060 Ga0466705_042060_6552_7880 442
172 3300038395 Ga0415639_046188 Ga0415639_046188_4724_6055 443
173 3300042620 Ga0466728_119745 Ga0466728_119745_12115_13446 443
174 3300042652 Ga0466708_181194 Ga0466708_181194_2422_3753 443
175 iso_pr_bacteria 2828505942 2828506614 462

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF13692 Glyco_trans_1_4 Glycosyl transferases group 1 287 424 0.91
PF00534 Glycos_transf_1 Glycosyl transferases group 1 283 424 0.91
PF13579 Glyco_trans_4_4 Glycosyl transferase 4-like domain 169 264 0.83
PF13439 Glyco_transf_4 Glycosyltransferase Family 4 165 268 0.8
PF20706 GT4-conflict Family 4 Glycosyltransferase in conflict systems 202 407 0.76
PF08323 Glyco_transf_5 Starch synthase catalytic domain 2 250 0.64

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF00534 GO:0016757 glycosyltransferase activity MF

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.76 0.8 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.