Protein Family IF12189
Metagenome
Isolate
241
Members
198
Samples
87
Scaffolds
304.86
Avg Length
Representative Sequence
- ID
- iso_pr_bacteria|2820854745|2820855263|
- Length
- 333 aa
- Sequence
- LSMLGTPTFQEIILALSSYWATQGCVLLQPYDTEVGAGTFHPATTLRSLGPDAWRTAYVQPSRRPTDGRYGKNPNRLQHYYQYQVLLKPSPDDVLIRYFDSLRAIGIEPAEHDIRLVEDDWESPTLGAWGLGWEVWLNGMECTQFTYFQQVGGFDCRPVSSEVTYGLERLAMYIQGVDSVYDLVWSAAPDGQLFTYADVFLANEQQYSAYNFEVADVEMLLGLFTTYEAECDRVLEAGHVLPAYDYVLKCSHAFNLLDARGAVSVTERQGYILRVRALAKACCAAYMDFIAEKADGAAQDAVPQDIVVPDVVVPDMGAQPQNVVSEGKGGGSA
Sample Types
Isolate
63.9%
Metagenome
36.1%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
26.0%
Apidae
15.5%
Drosophilidae
13.8%
Termitidae
8.3%
Halictidae
5.0%
Scarabaeidae
4.4%
Tenebrionidae
4.4%
Kalotermitidae
4.4%
Blattidae
3.9%
Elmidae
1.7%
Formicidae
1.7%
Rhinotermitidae
1.1%
Termopsidae
1.1%
Dytiscidae
1.1%
Passalidae
0.6%
Penaeidae
0.6%
Armadillidiidae
0.6%
Rhaphidophoridae
0.6%
Noctuidae
0.6%
Curculionidae
0.6%
Libellulidae
0.6%
Hydrophilidae
0.6%
Cerambycidae
0.6%
Vespidae
0.6%
Hodotermitidae
0.6%
Bombycidae
0.6%
Gomphidae
0.6%
Nephropidae
0.6%
Taxonomy
Archaea
0
Bacteria
228
Eukaryota
0
Viruses
0
Unclassified
13
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 8114555646 | Enterococcus sp. DIV1094 | Isolate | |
| 2 | 2852337885 | Paenibacillus protaetiae FW100M-2 | Isolate | Scarabaeidae |
| 3 | 2896843662 | Levilactobacillus brevis BDGP6 | Isolate | Drosophilidae |
| 4 | 2940380068 | Paenibacillus sp. PastH-2 | Isolate | Blattidae |
| 5 | 2964739456 | Lactiplantibacillus plantarum FlyG10.1.9 | Isolate | Drosophilidae |
| 6 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 7 | 2585428141 | Pilibacter termitis ATCC BAA-1030 | Isolate | Rhinotermitidae |
| 8 | 2595698190 | Melissococcus plutonius 21.1 | Isolate | Apidae |
| 9 | 2627853628 | Melissococcus plutonius 82 | Isolate | Apidae |
| 10 | 2690315820 | Lactiplantibacillus plantarum WJL | Isolate | Drosophilidae |
| 11 | 2758568515 | Lactobacillus melliventris ESL0259 | Isolate | Unclassified |
| 12 | 2758568561 | Bombilactobacillus mellis ESL0292 | Isolate | Unclassified |
| 13 | 2775507073 | Enterococcus sp. CR-Ec1 | Isolate | Unclassified |
| 14 | 2651870343 | Fructobacillus sp. EFB-N1 | Isolate | Apidae |
| 15 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 16 | 8012939035 | Enterococcus sp. UD-01 | Isolate | Tenebrionidae |
| 17 | 8082023105 | Niallia sp. Man26 | Isolate | Penaeidae |
| 18 | 8114537524 | Enterococcus sp. 12C11_DIV0727 12C11_DIV0727 | Isolate | |
| 19 | 2825804107 | Enterococcus durans BDGP3 | Isolate | Drosophilidae |
| 20 | 2850695442 | Lactococcus allomyrinae 1JSPR-7 | Isolate | Scarabaeidae |
| 21 | 2864909992 | Bacillus velezensis S00166 | Isolate | Elmidae |
| 22 | 2881902429 | Companilactobacillus metriopterae JCM 31635 | Isolate | Unclassified |
| 23 | 2905310146 | Ligilactobacillus salivarius A3iob | Isolate | Apidae |
| 24 | 2940400224 | Paenibacillus sp. PastM-2 | Isolate | Blattidae |
| 25 | 2595698199 | Melissococcus plutonius 60 | Isolate | Apidae |
| 26 | 2684622914 | Lactobacillus helsinborgensis Lb_183 | Isolate | Unclassified |
| 27 | 2756170272 | Convivina intestini DSM 28795 | Isolate | Unclassified |
| 28 | 2758568512 | Lactobacillus helsingborgensis ESL0262 | Isolate | Unclassified |
| 29 | 3300000333 | Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony | Metagenome | Apidae |
| 30 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 31 | 3004719924 | Lactobacillus sp. W8174 | Isolate | Apidae |
| 32 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 33 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 34 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 35 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 36 | 8001918023 | Bombilactobacillus bombi XV6 | Isolate | Apidae |
| 37 | 8002304686 | Apilactobacillus kunkeei UASWS1867-NN5 | Isolate | Apidae |
| 38 | 8007215774 | Enterococcus sp. BWR-S5 | Isolate | Scarabaeidae |
| 39 | 8007237282 | Enterococcus sp. DIV0212c | Isolate | |
| 40 | 8017489919 | Lactobacillus brevis EF | Isolate | Unclassified |
| 41 | 8018794549 | Enterococcus sp. 6D12_DIV0197 6D12_DIV0197 | Isolate | |
| 42 | 8018798118 | Enterococcus sp. 7D2_DIV0200 7D2_DIV0200 | Isolate | |
| 43 | 8066802609 | Apilactobacillus timberlakei HV_09 | Isolate | Halictidae |
| 44 | 2864801025 | Bacillus aerius S00042 | Isolate | Elmidae |
| 45 | 2940393498 | Paenibacillus sp. PastF-2 | Isolate | Blattidae |
| 46 | 2957623355 | Lactiplantibacillus plantarum FlyG11.1.2 | Isolate | Drosophilidae |
| 47 | 2873632256 | Weissella coleopterorum HDW19 | Isolate | Dytiscidae |
| 48 | 2684622912 | Lactobacillus apis Lb_185 | Isolate | Unclassified |
| 49 | 2684622913 | Lactobacillus melliventris Lb_184 | Isolate | Unclassified |
| 50 | 2758568513 | Lactobacillus melliventris ESL0260 | Isolate | Unclassified |
| 51 | 2758568558 | Lactobacillus melliventris ESL0393 | Isolate | Unclassified |
| 52 | 2820236043 | Unclassified Firmicutes Th196P3bin97 | Isolate | Unclassified |
| 53 | 2814123166 | Lactobacillus apis LMG 26964 | Isolate | Apidae |
| 54 | 2967802344 | Lactiplantibacillus plantarum FlyG11.1.6 | Isolate | Drosophilidae |
| 55 | 2977592972 | Lactiplantibacillus plantarum FlyG7.1.6 | Isolate | Drosophilidae |
| 56 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 57 | 3300002932 | Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 | Metagenome | Formicidae |
| 58 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 59 | 3300012848 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG | Metagenome | Armadillidiidae |
| 60 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 61 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 62 | 8002299145 | Vagococcus allomyrinae BWB3-3 | Isolate | Scarabaeidae |
| 63 | 8066797744 | Apilactobacillus timberlakei HV_26 | Isolate | Halictidae |
| 64 | 8077780672 | Enterococcus sp. PLM3 | Isolate | Formicidae |
| 65 | 2896402965 | Weissella diestrammenae KACC 16890 | Isolate | Rhaphidophoridae |
| 66 | 2900804455 | Listeria sp. PSOL-1 Marseille-P4284 | Isolate | Unclassified |
| 67 | 2940261461 | Enterococcus sp. PFB1-1 | Isolate | Blattidae |
| 68 | 2956926959 | Bombilactobacillus bombi BI-1.1 | Isolate | Apidae |
| 69 | 2551306396 | Paenibacillus sp. ICGEB2008 | Isolate | Noctuidae |
| 70 | 2574180310 | Bacillus licheniformis CG-B52 | Isolate | Unclassified |
| 71 | 2576861701 | Paenibacillus sp. JCM 10914 | Isolate | Termitidae |
| 72 | 2622736579 | Desemzia incerta DSM 20581 | Isolate | Unclassified |
| 73 | 2740892556 | Enterococcus sp. JR029-101 | Isolate | Unclassified |
| 74 | 2758568557 | Bombilactobacillus mellis ESL0394 | Isolate | Unclassified |
| 75 | 2758568559 | Bombilactobacillus mellis ESL0295 | Isolate | Unclassified |
| 76 | 2770939318 | Lactiplantibacillus plantarum plantarum LP2 | Isolate | Apidae |
| 77 | 2820094617 | Unclassified Proteobacteria Lab288P3bin216 | Isolate | Unclassified |
| 78 | 2820134530 | Unclassified Proteobacteria Emb289P3bin65 | Isolate | Unclassified |
| 79 | 3300012798 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E6 MG | Metagenome | |
| 80 | 3300012803 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E11 MG | Metagenome | |
| 81 | 3300026175 | Army ant gut microbial communities from Eciton burchelli, Monteverde, Costa Rica - colony MVEbp1 | Metagenome | Formicidae |
| 82 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 83 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 84 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 85 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 86 | 8108568626 | Enterococcus sp. DIV1094 | Isolate | |
| 87 | 8108576847 | Enterococcus sp. 9D6_DIV0238 9D6_DIV0238 | Isolate | |
| 88 | 8114549044 | Enterococcus sp. 9D6_DIV0238 9D6_DIV0238 | Isolate | |
| 89 | 2834540479 | Leuconostoc citreum DmW_111 | Isolate | Drosophilidae |
| 90 | 2923762712 | Apilactobacillus micheneri Hlig3 | Isolate | Halictidae |
| 91 | 2940386776 | Paenibacillus sp. PastF-1 | Isolate | Blattidae |
| 92 | 2961515617 | Lactobacillus sp. ESL0259 | Isolate | Apidae |
| 93 | 2595698198 | Melissococcus plutonius L9 | Isolate | Apidae |
| 94 | 2630968413 | Bombilactobacillus mellifer Bin4 | Isolate | Unclassified |
| 95 | 2675903377 | Apilactobacillus kunkeei AR114 | Isolate | Unclassified |
| 96 | 2758568560 | Bombilactobacillus mellis ESL0294 | Isolate | Unclassified |
| 97 | 2820168331 | Unclassified Proteobacteria Co191P3bin57 | Isolate | Unclassified |
| 98 | 2970199020 | Lactiplantibacillus plantarum FlyG8.1.2 | Isolate | Drosophilidae |
| 99 | 2971438493 | Paenibacillus apiarius NRRL B-23460 | Isolate | Apidae |
| 100 | 2977635137 | Lactiplantibacillus plantarum DietG20.1.2 | Isolate | Unclassified |
| 101 | 3300003973 | Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle | Metagenome | Curculionidae |
| 102 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 103 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 104 | 3300056790 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) | Metagenome | Tenebrionidae |
| 105 | 3300056856 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) | Metagenome | Tenebrionidae |
| 106 | 646311952 | Sebaldella termitidis ATCC 33386 | Isolate | Unclassified |
| 107 | 647533136 | Enterococcus faecalis Fly1 | Isolate | Drosophilidae |
| 108 | 8007220153 | Enterococcus sp. BWB1-3 | Isolate | Scarabaeidae |
| 109 | 8017462664 | Lactobacillus melliventris ESL0184 | Isolate | Apidae |
| 110 | 8114541043 | Enterococcus sp. 7F3_DIV0205 7F3_DIV0205 | Isolate | Libellulidae |
| 111 | 2834951433 | Brochothrix thermosphacta CD 337 | Isolate | Unclassified |
| 112 | 2851412233 | Bombilactobacillus bombi BI-2.5 | Isolate | Apidae |
| 113 | 2864895409 | Bacillus aerius S00152 | Isolate | Elmidae |
| 114 | 2873581347 | Vagococcus hydrophili HDW17B | Isolate | Hydrophilidae |
| 115 | 2902668162 | Lacticaseibacillus paracasei DmW_181 | Isolate | Drosophilidae |
| 116 | 2964778705 | Lactiplantibacillus plantarum DietG20.2.2_EE | Isolate | Unclassified |
| 117 | 2912324399 | Lactobacillus apis ESL0185 | Isolate | Apidae |
| 118 | 2084038013 | Anoplophora glabripennis gut microbial communities from Worchester, Massachusetts, USA - Larvae | Metagenome | Cerambycidae |
| 119 | 2595698197 | Melissococcus plutonius H6 | Isolate | Apidae |
| 120 | 2597490293 | Lactiplantibacillus plantarum DmCS_001 | Isolate | Drosophilidae |
| 121 | 2718218475 | Lactiplantibacillus plantarum KP | Isolate | Drosophilidae |
| 122 | 2791355481 | Bacillus sp. ZY-1-1 | Isolate | Scarabaeidae |
| 123 | 2820166269 | Unclassified Proteobacteria Co191P4bin16 | Isolate | Unclassified |
| 124 | 2558860143 | Apilactobacillus kunkeei EFB6 | Isolate | Apidae |
| 125 | 2820411483 | Unclassified Firmicutes Lab288P4bin76 | Isolate | Unclassified |
| 126 | 2970225615 | Lactiplantibacillus plantarum FlyG8.1.1 | Isolate | Drosophilidae |
| 127 | 2977628635 | Lactiplantibacillus plantarum FlyG3.1.8 | Isolate | Drosophilidae |
| 128 | 2977653127 | Lactiplantibacillus plantarum FlyG10.1.5 | Isolate | Drosophilidae |
| 129 | 2983866074 | Paenibacillus polymyxa A18 | Isolate | Unclassified |
| 130 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 131 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 132 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 133 | 650716050 | Melissococcus plutonius ATCC 35311 | Isolate | Unclassified |
| 134 | 8007211731 | Enterococcus larvae BWM-S5 | Isolate | Scarabaeidae |
| 135 | 8064531044 | Terrisporobacter mayombei DSM 6539 | Isolate | Unclassified |
| 136 | 8066790652 | Apilactobacillus timberlakei HV_28 | Isolate | Halictidae |
| 137 | 8066792404 | Apilactobacillus timberlakei HV_04 | Isolate | Halictidae |
| 138 | 8114544644 | Enterococcus sp. 9E7_DIV0242 9E7_DIV0242 | Isolate | |
| 139 | 2820854745 | Unclassified Actinobacteria Lab288P3bin234 | Isolate | Unclassified |
| 140 | 2827179085 | Paenibacillus alvei DSM 29 | Isolate | Apidae |
| 141 | 2851410423 | Lactobacillus helsingborgensis ESL0183 | Isolate | Apidae |
| 142 | 2881375749 | Vagococcus entomophilus DSM 24756 | Isolate | Vespidae |
| 143 | 2937236879 | Lactiplantibacillus plantarum MHO2.4 | Isolate | |
| 144 | 2940218408 | Enterococcus sp. PF1-24 | Isolate | Blattidae |
| 145 | 2960772748 | Lactiplantibacillus plantarum MHO2.9 | Isolate | |
| 146 | 2964765680 | Lactiplantibacillus plantarum MHO2.5 | Isolate | |
| 147 | 2820907832 | Unclassified Actinobacteria Emb289P4bin29 | Isolate | Unclassified |
| 148 | 2209111004 | Macrotermes natalensis queen gut microbiome | Metagenome | Termitidae |
| 149 | 2576861670 | Lactiplantibacillus plantarum WJL | Isolate | Drosophilidae |
| 150 | 2595698193 | Melissococcus plutonius B5 | Isolate | Apidae |
| 151 | 2595698196 | Melissococcus plutonius 49.3 | Isolate | Apidae |
| 152 | 2758568511 | Lactobacillus apis ESL0263 | Isolate | Unclassified |
| 153 | 2808606958 | Lactobacillus sp. ESL0449 v2 | Isolate | Unclassified |
| 154 | 2820170025 | Unclassified Proteobacteria Co191P1bin43 | Isolate | Unclassified |
| 155 | 2967825073 | Lactiplantibacillus plantarum FlyG9.1.4 | Isolate | Drosophilidae |
| 156 | 2970254690 | Lactiplantibacillus plantarum FlyG9.2.5 | Isolate | Drosophilidae |
| 157 | 2977596371 | Lactiplantibacillus plantarum FlyG11.2.6 | Isolate | Drosophilidae |
| 158 | 2977622177 | Lactiplantibacillus plantarum FlyG20.2.6 | Isolate | Drosophilidae |
| 159 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 160 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 161 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 162 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 163 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 164 | 3300056564 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) | Metagenome | Tenebrionidae |
| 165 | 3300056814 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) | Metagenome | Tenebrionidae |
| 166 | 3300056857 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) | Metagenome | Tenebrionidae |
| 167 | 3300057007 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) | Metagenome | Tenebrionidae |
| 168 | 8018754795 | Enterococcus sp. 12F9_DIV0723 12F9_DIV0723 | Isolate | |
| 169 | 8038268975 | Enterococcus mundtii EM01 | Isolate | Bombycidae |
| 170 | 8066794103 | Apilactobacillus timberlakei HV_25 | Isolate | Halictidae |
| 171 | 2820833147 | Unclassified Actinobacteria Lab288P4bin85 | Isolate | Unclassified |
| 172 | 2821322763 | Unclassified Actinobacteria Cu122P5bin19 | Isolate | Unclassified |
| 173 | 2873584433 | Vagococcus coleopterorum HDW17A | Isolate | Dytiscidae |
| 174 | 2878857142 | Lactococcus lactis DmW198 | Isolate | Drosophilidae |
| 175 | 2936628749 | Apilactobacillus quenuiae HV_6 | Isolate | Halictidae |
| 176 | 2940406939 | Paenibacillus sp. PastM-3 | Isolate | Blattidae |
| 177 | 2956930723 | Bombilactobacillus bombi LV-8.1 | Isolate | Apidae |
| 178 | 2964749277 | Lactiplantibacillus plantarum FlyG20.1.4 | Isolate | Drosophilidae |
| 179 | 2964775400 | Lactiplantibacillus plantarum FlyG2.1.8 | Isolate | Unclassified |
| 180 | 2595698194 | Melissococcus plutonius 90.0 | Isolate | Apidae |
| 181 | 2595698195 | Melissococcus plutonius 119 | Isolate | Apidae |
| 182 | 2728369362 | Lactiplantibacillus plantarum DF | Isolate | Drosophilidae |
| 183 | 2731957677 | Alkalihalobacillus trypoxylicola NBRC 102646 | Isolate | Scarabaeidae |
| 184 | 2767802234 | Cytobacillus kochii BDGP4 | Isolate | Drosophilidae |
| 185 | 2820001644 | Unclassified Synergistetes Th196P3bin106 | Isolate | Unclassified |
| 186 | 2820053807 | Unclassified Proteobacteria Th196P3bin117 | Isolate | Unclassified |
| 187 | 2645727721 | Lactobacillus helsingborgensis Bma5 | Isolate | Unclassified |
| 188 | 2979949929 | Lactobacillus sp. ESL0263 | Isolate | Apidae |
| 189 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 190 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 191 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 192 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 193 | 8007223943 | Enterococcus sp. MSG2901 | Isolate | |
| 194 | 8018750880 | Enterococcus sp. 12E11_DIV0728 12E11_DIV0728 | Isolate | |
| 195 | 8018802046 | Enterococcus sp. 7E2_DIV0204 7E2_DIV0204 | Isolate | Gomphidae |
| 196 | 8043041867 | Bacillus pumilus Ha06YP001 | Isolate | Nephropidae |
| 197 | 8066795793 | Apilactobacillus timberlakei HV_10 | Isolate | Halictidae |
| 198 | 8066799369 | Apilactobacillus timberlakei HV_02 | Isolate | Halictidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466697_243091 | 3300042611 | Bacteria | 1677 |
| 2 | Ga0562379_0009 | 3300056790 | Bacteria | 1927879 |
| 3 | Ga0562375_0005 | 3300056856 | Bacteria | 2472444 |
| 4 | Ga0562374_0725 | 3300057007 | Bacteria | 48750 |
| 5 | Ga0063521_1015340 | 3300003973 | Unclassified | 1848 |
| 6 | Ga0466701_035767 | 3300042598 | Bacteria | 128967 |
| 7 | Ga0466707_048716 | 3300042601 | Bacteria | 7008 |
| 8 | Ga0466707_284811 | 3300042601 | Bacteria | 7786 |
| 9 | Ga0466713_093617 | 3300042602 | Bacteria | 168801 |
| 10 | Ga0255572_1000643 | 3300026175 | Bacteria | 42323 |
| 11 | Ga0466656_260441 | 3300042550 | Bacteria | 1004 |
| 12 | Ga0466697_177714 | 3300042611 | Bacteria | 1412 |
| 13 | Ga0466705_141790 | 3300042612 | Bacteria | 5124 |
| 14 | Ga0530661_000684 | 3300056564 | Unclassified | 22675 |
| 15 | Ga0562378_0279 | 3300056814 | Bacteria | 111869 |
| 16 | Ga0562374_0006 | 3300057007 | Bacteria | 2178283 |
| 17 | Ga0466728_103170 | 3300042620 | Bacteria | 22476 |
| 18 | Ga0123353_10175887 | 3300010167 | Unclassified | 3393 |
| 19 | Ga0466707_360001 | 3300042601 | Bacteria | 2279 |
| 20 | Ga0466691_114549 | 3300042593 | Bacteria | 24170 |
| 21 | Ga0562379_0022 | 3300056790 | Bacteria | 931623 |
| 22 | Ga0562377_0073 | 3300056842 | Bacteria | 402311 |
| 23 | Ga0562376_1206 | 3300056857 | Unclassified | 37659 |
| 24 | Ga0562374_0037 | 3300057007 | Bacteria | 679104 |
| 25 | Ga0562374_1563 | 3300057007 | Bacteria | 25967 |
| 26 | CVPL010L_1001028 | 3300002932 | Unclassified | 6462 |
| 27 | Ga0466715_062865 | 3300042616 | Bacteria | 4778 |
| 28 | Ga0123357_10007677 | 3300009784 | Bacteria | 13382 |
| 29 | Ga0466706_078168 | 3300042599 | Bacteria | 5570 |
| 30 | Ga0466706_155209 | 3300042599 | Bacteria | 186431 |
| 31 | Ga0466706_203736 | 3300042599 | Bacteria | 1121 |
| 32 | Ga0466691_168939 | 3300042593 | Bacteria | 15025 |
| 33 | Ga0466734_086426 | 3300042623 | Bacteria | 9823 |
| 34 | Ga0466703_098671 | 3300042636 | Bacteria | 4864 |
| 35 | Ga0562375_0304 | 3300056856 | Bacteria | 121677 |
| 36 | HBC_ctgsDRAFT_1029281 | 3300000333 | Unclassified | 1352 |
| 37 | Ga0072940_1226806 | 3300005200 | Bacteria | 3550 |
| 38 | Ga0466715_439437 | 3300042616 | Bacteria | 13795 |
| 39 | Ga0123355_10052658 | 3300009826 | Bacteria | 6602 |
| 40 | Ga0123354_10000681 | 3300010882 | Bacteria | 36122 |
| 41 | Ga0123354_10170803 | 3300010882 | Unclassified | 2531 |
| 42 | Ga0160443_100739 | 3300012848 | Bacteria | 17333 |
| 43 | Ga0466703_422881 | 3300042636 | Bacteria | 44036 |
| 44 | Ga0466724_31216 | 3300042649 | Bacteria | 1994 |
| 45 | Ga0530661_000887 | 3300056564 | Bacteria | 18482 |
| 46 | Ga0562379_0044 | 3300056790 | Bacteria | 597058 |
| 47 | Ga0562379_0069 | 3300056790 | Bacteria | 430601 |
| 48 | Ga0562378_0008 | 3300056814 | Bacteria | 1370151 |
| 49 | Ga0562377_0106 | 3300056842 | Bacteria | 268063 |
| 50 | Ga0562375_3984 | 3300056856 | Bacteria | 12315 |
| 51 | Ga0123357_10036963 | 3300009784 | Bacteria | 6645 |
| 52 | Ga0160454_100011 | 3300012798 | Bacteria | 394348 |
| 53 | Ga0466702_238990 | 3300042635 | Bacteria | 163005 |
| 54 | Ga0562379_0065 | 3300056790 | Bacteria | 449364 |
| 55 | Ga0562377_0539 | 3300056842 | Bacteria | 59504 |
| 56 | 2227591277 | 2225789004 | Bacteria | 49030 |
| 57 | JGI24696J40584_12961190 | 3300002834 | Unclassified | 11834 |
| 58 | Ga0466715_572420 | 3300042616 | Bacteria | 103400 |
| 59 | Ga0123356_10000022 | 3300010049 | Bacteria | 176186 |
| 60 | Ga0123353_10001151 | 3300010167 | Bacteria | 32240 |
| 61 | Ga0123354_10018580 | 3300010882 | Bacteria | 10902 |
| 62 | Ga0466719_474775 | 3300042606 | Bacteria | 19172 |
| 63 | Ga0466729_229591 | 3300042621 | Unclassified | 1998 |
| 64 | Ga0466724_54266 | 3300042649 | Bacteria | 1496 |
| 65 | Ga0530661_000001 | 3300056564 | Bacteria | 684835 |
| 66 | Ga0562379_0258 | 3300056790 | Bacteria | 138793 |
| 67 | Ga0562375_0035 | 3300056856 | Bacteria | 623265 |
| 68 | Ga0562375_0131 | 3300056856 | Unclassified | 227882 |
| 69 | Ga0562375_2598 | 3300056856 | Unclassified | 19654 |
| 70 | 2212252407 | 2209111004 | Bacteria | 24284 |
| 71 | Ga0123357_10127684 | 3300009784 | Bacteria | 3179 |
| 72 | Ga0160465_103166 | 3300012803 | Unclassified | 3143 |
| 73 | Ga0466707_165992 | 3300042601 | Bacteria | 110489 |
| 74 | Ga0466707_282471 | 3300042601 | Bacteria | 2464 |
| 75 | Ga0466709_052071 | 3300042648 | Bacteria | 2081 |
| 76 | Ga0562377_1775 | 3300056842 | Bacteria | 19874 |
| 77 | Ga0562375_0013 | 3300056856 | Bacteria | 1229523 |
| 78 | Ga0562376_0268 | 3300056857 | Bacteria | 104382 |
| 79 | AglaG_contig22869 | 2084038013 | Bacteria | 8539 |
| 80 | Ga0068302_10019901 | 3300005071 | Bacteria | 6547 |
| 81 | Ga0123357_10000529 | 3300009784 | Bacteria | 37494 |
| 82 | Ga0466706_171848 | 3300042599 | Bacteria | 31760 |
| 83 | Ga0466706_212735 | 3300042599 | Bacteria | 6276 |
| 84 | Ga0466706_242652 | 3300042599 | Unclassified | 4035 |
| 85 | Ga0466707_076357 | 3300042601 | Bacteria | 224161 |
| 86 | Ga0466690_294865 | 3300042590 | Bacteria | 10648 |
| 87 | Ga0466727_030597 | 3300042655 | Bacteria | 6972 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042599 | Ga0466706_155209 | Ga0466706_155209_134980_135816 | 278 |
| 2 | 3300042611 | Ga0466697_177714 | Ga0466697_177714_38_880 | 280 |
| 3 | 3300010167 | Ga0123353_10175887 | Ga0123353_101758872 | 286 |
| 4 | 3300042649 | Ga0466724_54266 | Ga0466724_54266_75_938 | 287 |
| 5 | iso_pr_bacteria | 646311952 | 646430982 | 289 |
| 6 | iso_pr_bacteria | 2820094617 | 2820095736 | 290 |
| 7 | 2225789004 | 2227591277 | 2228150350 | 291 |
| 8 | iso_pr_bacteria | 2834951433 | 2834952560 | 291 |
| 9 | 3300042601 | Ga0466707_076357 | Ga0466707_076357_30411_31289 | 292 |
| 10 | iso_pr_bacteria | 8064531044 | 8064532504 | 292 |
| 11 | iso_pr_bacteria | 8082023105 | 8082025914 | 292 |
| 12 | 3300012803 | Ga0160465_103166 | Ga0160465_1031661 | 293 |
| 13 | 3300012848 | Ga0160443_100739 | Ga0160443_10073911 | 293 |
| 14 | 3300042636 | Ga0466703_098671 | Ga0466703_098671_2969_3943 | 294 |
| 15 | 3300056564 | Ga0530661_000001 | Ga0530661_000001_204400_205284 | 294 |
| 16 | 2209111004 | 2212252407 | 2212298817 | 295 |
| 17 | 3300042550 | Ga0466656_260441 | Ga0466656_260441_20_907 | 295 |
| 18 | 3300042598 | Ga0466701_035767 | Ga0466701_035767_67058_67945 | 295 |
| 19 | 3300056790 | Ga0562379_0022 | Ga0562379_0022_263633_264520 | 295 |
| 20 | 3300056790 | Ga0562379_0065 | Ga0562379_0065_359739_360626 | 295 |
| 21 | 3300056842 | Ga0562377_0073 | Ga0562377_0073_167784_168671 | 295 |
| 22 | iso_pr_bacteria | 2551306396 | 2552923948 | 295 |
| 23 | iso_pr_bacteria | 2574180310 | 2576357491 | 295 |
| 24 | iso_pr_bacteria | 2576861701 | 2579267938 | 295 |
| 25 | iso_pr_bacteria | 2731957677 | 2732686084 | 295 |
| 26 | iso_pr_bacteria | 2791355481 | 2794424667 | 295 |
| 27 | iso_pr_bacteria | 2827179085 | 2827183045 | 295 |
| 28 | iso_pr_bacteria | 2864801025 | 2864803585 | 295 |
| 29 | iso_pr_bacteria | 2864895409 | 2864897967 | 295 |
| 30 | iso_pr_bacteria | 2864909992 | 2864912716 | 295 |
| 31 | iso_pr_bacteria | 2940380068 | 2940384515 | 295 |
| 32 | iso_pr_bacteria | 2940386776 | 2940391227 | 295 |
| 33 | iso_pr_bacteria | 2940393498 | 2940397800 | 295 |
| 34 | iso_pr_bacteria | 2940400224 | 2940404532 | 295 |
| 35 | iso_pr_bacteria | 2940406939 | 2940411016 | 295 |
| 36 | iso_pr_bacteria | 2983866074 | 2983867061 | 295 |
| 37 | iso_pr_bacteria | 8018750880 | 8018753450 | 295 |
| 38 | iso_pr_bacteria | 8018754795 | 8018755681 | 295 |
| 39 | iso_pr_bacteria | 8043041867 | 8043042341 | 295 |
| 40 | 3300010882 | Ga0123354_10000681 | Ga0123354_1000068119 | 296 |
| 41 | 3300012798 | Ga0160454_100011 | Ga0160454_100011276 | 296 |
| 42 | iso_pr_bacteria | 2767802234 | 2769331366 | 296 |
| 43 | iso_pr_bacteria | 2852337885 | 2852339518 | 296 |
| 44 | iso_pr_bacteria | 2900804455 | 2900805245 | 296 |
| 45 | iso_pr_bacteria | 8002299145 | 8002302168 | 296 |
| 46 | 3300042593 | Ga0466691_114549 | Ga0466691_114549_10132_11025 | 297 |
| 47 | 3300042593 | Ga0466691_168939 | Ga0466691_168939_1312_2205 | 297 |
| 48 | 3300042636 | Ga0466703_422881 | Ga0466703_422881_21819_22712 | 297 |
| 49 | iso_pr_bacteria | 2971438493 | 2971439665 | 297 |
| 50 | iso_pr_bacteria | 2902668162 | 2902669206 | 298 |
| 51 | 3300009826 | Ga0123355_10052658 | Ga0123355_100526585 | 299 |
| 52 | 3300042601 | Ga0466707_165992 | Ga0466707_165992_67774_68673 | 299 |
| 53 | 3300042601 | Ga0466707_282471 | Ga0466707_282471_198_1097 | 299 |
| 54 | 3300056790 | Ga0562379_0009 | Ga0562379_0009_1165744_1166643 | 299 |
| 55 | 3300056790 | Ga0562379_0044 | Ga0562379_0044_481889_482788 | 299 |
| 56 | 3300056814 | Ga0562378_0008 | Ga0562378_0008_408910_409809 | 299 |
| 57 | 3300056856 | Ga0562375_0131 | Ga0562375_0131_40709_41608 | 299 |
| 58 | iso_pr_bacteria | 2576861670 | 2579164919 | 299 |
| 59 | iso_pr_bacteria | 2597490293 | 2598962658 | 299 |
| 60 | iso_pr_bacteria | 2690315820 | 2691202451 | 299 |
| 61 | iso_pr_bacteria | 2718218475 | 2721608220 | 299 |
| 62 | iso_pr_bacteria | 2728369362 | 2730151094 | 299 |
| 63 | iso_pr_bacteria | 2770939318 | 2771020989 | 299 |
| 64 | iso_pr_bacteria | 2873581347 | 2873583943 | 299 |
| 65 | iso_pr_bacteria | 2937236879 | 2937238660 | 299 |
| 66 | iso_pr_bacteria | 2957623355 | 2957626025 | 299 |
| 67 | iso_pr_bacteria | 2960772748 | 2960774634 | 299 |
| 68 | iso_pr_bacteria | 2964739456 | 2964741981 | 299 |
| 69 | iso_pr_bacteria | 2964749277 | 2964749360 | 299 |
| 70 | iso_pr_bacteria | 2964765680 | 2964766045 | 299 |
| 71 | iso_pr_bacteria | 2964775400 | 2964775479 | 299 |
| 72 | iso_pr_bacteria | 2964778705 | 2964778788 | 299 |
| 73 | iso_pr_bacteria | 2967802344 | 2967804915 | 299 |
| 74 | iso_pr_bacteria | 2967825073 | 2967825158 | 299 |
| 75 | iso_pr_bacteria | 2970199020 | 2970201514 | 299 |
| 76 | iso_pr_bacteria | 2970225615 | 2970228077 | 299 |
| 77 | iso_pr_bacteria | 2970254690 | 2970256928 | 299 |
| 78 | iso_pr_bacteria | 2977592972 | 2977595181 | 299 |
| 79 | iso_pr_bacteria | 2977596371 | 2977597490 | 299 |
| 80 | iso_pr_bacteria | 2977622177 | 2977623830 | 299 |
| 81 | iso_pr_bacteria | 2977628635 | 2977628718 | 299 |
| 82 | iso_pr_bacteria | 2977635137 | 2977635221 | 299 |
| 83 | iso_pr_bacteria | 2977653127 | 2977655784 | 299 |
| 84 | iso_pr_bacteria | 2820001644 | 2820002236 | 300 |
| 85 | iso_pr_bacteria | 2873584433 | 2873585933 | 300 |
| 86 | 3300042611 | Ga0466697_243091 | Ga0466697_243091_650_1555 | 301 |
| 87 | 3300056564 | Ga0530661_000684 | Ga0530661_000684_15324_16229 | 301 |
| 88 | 3300056856 | Ga0562375_0013 | Ga0562375_0013_388148_389053 | 301 |
| 89 | 3300057007 | Ga0562374_0037 | Ga0562374_0037_13623_14528 | 301 |
| 90 | iso_pr_bacteria | 2595698190 | 2596206136 | 301 |
| 91 | iso_pr_bacteria | 2595698193 | 2596211547 | 301 |
| 92 | iso_pr_bacteria | 2595698194 | 2596213268 | 301 |
| 93 | iso_pr_bacteria | 2595698195 | 2596215164 | 301 |
| 94 | iso_pr_bacteria | 2595698196 | 2596217048 | 301 |
| 95 | iso_pr_bacteria | 2595698197 | 2596218886 | 301 |
| 96 | iso_pr_bacteria | 2595698198 | 2596220717 | 301 |
| 97 | iso_pr_bacteria | 2595698199 | 2596222529 | 301 |
| 98 | iso_pr_bacteria | 2627853628 | 2628280850 | 301 |
| 99 | iso_pr_bacteria | 2881375749 | 2881376143 | 301 |
| 100 | iso_pr_bacteria | 2881902429 | 2881903124 | 301 |
| 101 | iso_pr_bacteria | 650716050 | 650845447 | 301 |
| 102 | iso_pr_bacteria | 8007215774 | 8007218438 | 301 |
| 103 | iso_pr_bacteria | 8012939035 | 8012939439 | 301 |
| 104 | iso_pr_bacteria | 8114544644 | 8114544807 | 301 |
| 105 | 3300056564 | Ga0530661_000887 | Ga0530661_000887_13119_14027 | 302 |
| 106 | 3300056842 | Ga0562377_1775 | Ga0562377_1775_4733_5641 | 302 |
| 107 | iso_pr_bacteria | 2622736579 | 2623392602 | 302 |
| 108 | iso_pr_bacteria | 2740892556 | 2743947283 | 302 |
| 109 | iso_pr_bacteria | 8007220153 | 8007222891 | 302 |
| 110 | iso_pr_bacteria | 8007237282 | 8007238684 | 302 |
| 111 | iso_pr_bacteria | 8018798118 | 8018800089 | 302 |
| 112 | iso_pr_bacteria | 8018802046 | 8018804894 | 302 |
| 113 | iso_pr_bacteria | 8077780672 | 8077782628 | 302 |
| 114 | iso_pr_bacteria | 8108576847 | 8108577257 | 302 |
| 115 | iso_pr_bacteria | 8114537524 | 8114538248 | 302 |
| 116 | iso_pr_bacteria | 8114541043 | 8114541548 | 302 |
| 117 | iso_pr_bacteria | 8114549044 | 8114549454 | 302 |
| 118 | 3300002932 | CVPL010L_1001028 | CVPL010L_10010285 | 303 |
| 119 | 3300009784 | Ga0123357_10000529 | Ga0123357_1000052920 | 303 |
| 120 | 3300056790 | Ga0562379_0258 | Ga0562379_0258_58345_59256 | 303 |
| 121 | 3300056814 | Ga0562378_0279 | Ga0562378_0279_22437_23348 | 303 |
| 122 | 3300056856 | Ga0562375_0035 | Ga0562375_0035_187561_188472 | 303 |
| 123 | 3300056856 | Ga0562375_2598 | Ga0562375_2598_10243_11154 | 303 |
| 124 | 3300056857 | Ga0562376_1206 | Ga0562376_1206_2468_3379 | 303 |
| 125 | iso_pr_bacteria | 2775507073 | 2777017804 | 303 |
| 126 | iso_pr_bacteria | 8018794549 | 8018796221 | 303 |
| 127 | 3300042612 | Ga0466705_141790 | Ga0466705_141790_1520_2434 | 304 |
| 128 | 3300056857 | Ga0562376_0268 | Ga0562376_0268_25959_26873 | 304 |
| 129 | iso_pr_bacteria | 2630968413 | 2631703082 | 304 |
| 130 | 3300042616 | Ga0466715_572420 | Ga0466715_572420_66137_67054 | 305 |
| 131 | 3300057007 | Ga0562374_1563 | Ga0562374_1563_21003_21920 | 305 |
| 132 | iso_pr_bacteria | 2645727721 | 2646684426 | 305 |
| 133 | iso_pr_bacteria | 2684622912 | 2686075495 | 305 |
| 134 | iso_pr_bacteria | 2684622913 | 2686077340 | 305 |
| 135 | iso_pr_bacteria | 2684622914 | 2686079195 | 305 |
| 136 | iso_pr_bacteria | 2758568511 | 2760262126 | 305 |
| 137 | iso_pr_bacteria | 2758568512 | 2760263872 | 305 |
| 138 | iso_pr_bacteria | 2758568513 | 2760265718 | 305 |
| 139 | iso_pr_bacteria | 2758568515 | 2760269561 | 305 |
| 140 | iso_pr_bacteria | 2758568558 | 2760423519 | 305 |
| 141 | iso_pr_bacteria | 2814123166 | 2815022433 | 305 |
| 142 | iso_pr_bacteria | 2825804107 | 2825804253 | 305 |
| 143 | iso_pr_bacteria | 2851410423 | 2851411369 | 305 |
| 144 | iso_pr_bacteria | 2905310146 | 2905311421 | 305 |
| 145 | iso_pr_bacteria | 2912324399 | 2912325237 | 305 |
| 146 | iso_pr_bacteria | 2961515617 | 2961516527 | 305 |
| 147 | iso_pr_bacteria | 2979949929 | 2979950870 | 305 |
| 148 | iso_pr_bacteria | 3004719924 | 3004720297 | 305 |
| 149 | iso_pr_bacteria | 8007223943 | 8007225875 | 305 |
| 150 | iso_pr_bacteria | 8017462664 | 8017463773 | 305 |
| 151 | iso_pr_bacteria | 8038268975 | 8038269221 | 305 |
| 152 | iso_pr_bacteria | 8108568626 | 8108568662 | 305 |
| 153 | iso_pr_bacteria | 8114555646 | 8114555682 | 305 |
| 154 | 3300000333 | HBC_ctgsDRAFT_1029281 | HBC_ctgsDRAFT_10292811 | 306 |
| 155 | 3300042601 | Ga0466707_284811 | Ga0466707_284811_5870_6790 | 306 |
| 156 | iso_pr_bacteria | 2758568557 | 2760422984 | 306 |
| 157 | iso_pr_bacteria | 2758568559 | 2760426202 | 306 |
| 158 | iso_pr_bacteria | 2758568560 | 2760427451 | 306 |
| 159 | iso_pr_bacteria | 2758568561 | 2760429552 | 306 |
| 160 | iso_pr_bacteria | 2808606958 | 2811757939 | 306 |
| 161 | iso_pr_bacteria | 2820833147 | 2820834333 | 306 |
| 162 | iso_pr_bacteria | 2940218408 | 2940220555 | 306 |
| 163 | iso_pr_bacteria | 2940261461 | 2940263602 | 306 |
| 164 | 3300009784 | Ga0123357_10007677 | Ga0123357_100076772 | 307 |
| 165 | iso_pr_bacteria | 2851412233 | 2851412779 | 307 |
| 166 | iso_pr_bacteria | 2896843662 | 2896844054 | 307 |
| 167 | iso_pr_bacteria | 2956926959 | 2956928280 | 307 |
| 168 | iso_pr_bacteria | 2956930723 | 2956930987 | 307 |
| 169 | iso_pr_bacteria | 8001918023 | 8001918376 | 307 |
| 170 | iso_pr_bacteria | 8017489919 | 8017491579 | 307 |
| 171 | 3300042655 | Ga0466727_030597 | Ga0466727_030597_2312_3238 | 308 |
| 172 | 3300056842 | Ga0562377_0106 | Ga0562377_0106_53358_54284 | 308 |
| 173 | 3300057007 | Ga0562374_0725 | Ga0562374_0725_23165_24091 | 308 |
| 174 | iso_pr_bacteria | 2585428141 | 2588054230 | 308 |
| 175 | iso_pr_bacteria | 2873632256 | 2873633491 | 308 |
| 176 | iso_pr_bacteria | 2896402965 | 2896404430 | 308 |
| 177 | 3300005071 | Ga0068302_10019901 | Ga0068302_100199013 | 309 |
| 178 | 3300026175 | Ga0255572_1000643 | Ga0255572_100064325 | 309 |
| 179 | iso_pr_bacteria | 2923762712 | 2923763460 | 309 |
| 180 | iso_pr_bacteria | 2936628749 | 2936628996 | 309 |
| 181 | iso_pr_bacteria | 8066790652 | 8066791241 | 309 |
| 182 | iso_pr_bacteria | 8066792404 | 8066792954 | 309 |
| 183 | iso_pr_bacteria | 8066794103 | 8066795295 | 309 |
| 184 | iso_pr_bacteria | 8066795793 | 8066795949 | 309 |
| 185 | iso_pr_bacteria | 8066797744 | 8066798301 | 309 |
| 186 | iso_pr_bacteria | 8066799369 | 8066799900 | 309 |
| 187 | iso_pr_bacteria | 8066802609 | 8066802821 | 309 |
| 188 | iso_pr_bacteria | 2558860143 | 2559000733 | 310 |
| 189 | iso_pr_bacteria | 2675903377 | 2677723524 | 310 |
| 190 | iso_pr_bacteria | 8002304686 | 8002305882 | 310 |
| 191 | 3300042623 | Ga0466734_086426 | Ga0466734_086426_6352_7287 | 311 |
| 192 | 3300056856 | Ga0562375_3984 | Ga0562375_3984_5763_6698 | 311 |
| 193 | 2084038013 | AglaG_contig22869 | AglaG_02599740 | 313 |
| 194 | 3300010167 | Ga0123353_10001151 | Ga0123353_100011512 | 313 |
| 195 | 3300042601 | Ga0466707_048716 | Ga0466707_048716_3585_4526 | 313 |
| 196 | 3300042620 | Ga0466728_103170 | Ga0466728_103170_17538_18479 | 313 |
| 197 | 3300042648 | Ga0466709_052071 | Ga0466709_052071_827_1768 | 313 |
| 198 | 3300056790 | Ga0562379_0069 | Ga0562379_0069_150071_151012 | 313 |
| 199 | iso_pr_bacteria | 647533136 | 647747387 | 313 |
| 200 | 3300010882 | Ga0123354_10018580 | Ga0123354_1001858011 | 314 |
| 201 | 3300042601 | Ga0466707_360001 | Ga0466707_360001_983_1927 | 314 |
| 202 | iso_pr_bacteria | 2756170272 | 2756775328 | 314 |
| 203 | iso_pr_bacteria | 2834540479 | 2834541334 | 314 |
| 204 | 3300005200 | Ga0072940_1226806 | Ga0072940_12268063 | 315 |
| 205 | 3300042621 | Ga0466729_229591 | Ga0466729_229591_604_1551 | 315 |
| 206 | iso_pr_bacteria | 2651870343 | 2654486271 | 315 |
| 207 | iso_pr_bacteria | 2820236043 | 2820237304 | 315 |
| 208 | 3300042606 | Ga0466719_474775 | Ga0466719_474775_16513_17463 | 316 |
| 209 | 3300042616 | Ga0466715_062865 | Ga0466715_062865_1724_2674 | 316 |
| 210 | 3300042599 | Ga0466706_078168 | Ga0466706_078168_2873_3826 | 317 |
| 211 | 3300042602 | Ga0466713_093617 | Ga0466713_093617_144883_145836 | 317 |
| 212 | iso_pr_bacteria | 2850695442 | 2850696215 | 317 |
| 213 | iso_pr_bacteria | 2878857142 | 2878859572 | 317 |
| 214 | 3300003973 | Ga0063521_1015340 | Ga0063521_10153401 | 318 |
| 215 | 3300042590 | Ga0466690_294865 | Ga0466690_294865_7484_8443 | 319 |
| 216 | 3300042599 | Ga0466706_212735 | Ga0466706_212735_3545_4504 | 319 |
| 217 | 3300042635 | Ga0466702_238990 | Ga0466702_238990_53603_54562 | 319 |
| 218 | iso_pr_bacteria | 2820053807 | 2820054144 | 321 |
| 219 | iso_pr_bacteria | 2820134530 | 2820134549 | 321 |
| 220 | iso_pr_bacteria | 2820166269 | 2820167378 | 321 |
| 221 | iso_pr_bacteria | 2820168331 | 2820169266 | 321 |
| 222 | iso_pr_bacteria | 2820170025 | 2820171071 | 321 |
| 223 | 3300002834 | JGI24696J40584_12961190 | JGI24696J40584_129611909 | 322 |
| 224 | 3300010049 | Ga0123356_10000022 | Ga0123356_1000002220 | 322 |
| 225 | 3300056856 | Ga0562375_0005 | Ga0562375_0005_1200408_1201376 | 322 |
| 226 | 3300056856 | Ga0562375_0304 | Ga0562375_0304_39492_40460 | 322 |
| 227 | 3300057007 | Ga0562374_0006 | Ga0562374_0006_2110645_2111613 | 322 |
| 228 | iso_pr_bacteria | 2820411483 | 2820412434 | 322 |
| 229 | 3300010882 | Ga0123354_10170803 | Ga0123354_101708032 | 323 |
| 230 | 3300042616 | Ga0466715_439437 | Ga0466715_439437_753_1757 | 323 |
| 231 | 3300042599 | Ga0466706_242652 | Ga0466706_242652_506_1480 | 324 |
| 232 | 3300042599 | Ga0466706_171848 | Ga0466706_171848_14507_15484 | 325 |
| 233 | 3300042599 | Ga0466706_203736 | Ga0466706_203736_26_1009 | 327 |
| 234 | iso_pr_bacteria | 2820907832 | 2820908203 | 329 |
| 235 | iso_pr_bacteria | 8007211731 | 8007213387 | 329 |
| 236 | iso_pr_bacteria | 2821322763 | 2821323511 | 330 |
| 237 | 3300042649 | Ga0466724_31216 | Ga0466724_31216_496_1491 | 331 |
| 238 | iso_pr_bacteria | 2820854745 | 2820855263 | 333 |
| 239 | 3300009784 | Ga0123357_10036963 | Ga0123357_100369632 | 337 |
| 240 | 3300056842 | Ga0562377_0539 | Ga0562377_0539_47357_48373 | 338 |
| 241 | 3300009784 | Ga0123357_10127684 | Ga0123357_101276842 | 340 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF02091 | tRNA-synt_2e | Glycyl-tRNA synthetase alpha subunit | 9 | 288 | 0.98 |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.81 | 0.87 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.