Protein Family IF12170

Metagenome Isolate
320 Members
244 Samples
136 Scaffolds
341.02 Avg Length

🧬 Representative Sequence

ID
iso_pr_bacteria|2820813074|2820813365|
Length
400 aa
Sequence
MSGKGLAGPVPGAPGACVLVTGGAGYIGSHTCVELIQGGWRVLVVDDLSNSSAEALERVRQITGCGADDLVFYEGSILDEALLDRVFAQHAIDAIIHFAGFKAVGESTEKPLAYYENNIAGTLALCKVAGAHGVKSLAFSSSATVYGDPKAVPISESCPKGIPTNPYGHTKSMIEQILFDLYASDPGWCVALLRYFNPIGAHESGLIGEDPKGIPNNLVPYVAQVAVGKRERVGVFGDDYPTPDGTGVRDYIHVVDLARGHVKALEWMARQATGGRLGDGGGRDGGSGRDGGVDVQDGTGPQGDMAAKQQGGVGVFNLGTGKGSSVLEVIRAYGQACGKPLPYEVLPRRAGDIAVSYASCEKARDELGWTAAFDLLRMCEDSWRWQSRNPDGYRSEAAVR

πŸ“Š Sample Types

Isolate 57.5%
Metagenome 42.5%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Coreidae 33.3%
Unclassified 14.6%
Apidae 10.8%
Termitidae 7.9%
Kalotermitidae 5.4%
Blattidae 3.3%
Formicidae 3.3%
Sarcophagidae 2.5%
Elmidae 2.5%
Drosophilidae 2.5%
Curculionidae 1.7%
Rhinotermitidae 1.2%
Noctuidae 1.2%
Termopsidae 1.2%
Culicidae 0.8%
Largidae 0.8%
Armadillidiidae 0.8%
Berytidae 0.8%
Passalidae 0.8%
Hodotermitidae 0.4%
Nephropidae 0.4%
Thripidae 0.4%
Stratiomyidae 0.4%
Pediculidae 0.4%
Nymphalidae 0.4%
Majidae 0.4%
Talitridae 0.4%
Alydidae 0.4%
Palinuridae 0.4%

🌳 Taxonomy

Archaea 0
Bacteria 304
Eukaryota 1
Viruses 0
Unclassified 15

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820813074 Unclassified Actinobacteria Nt197P3bin52 Isolate Unclassified
2 2844251356 Photobacterium leiognathi mandapamensis ajapo.3.1 Isolate Unclassified
3 2858407585 Photobacterium swingsii DSM 24669 Isolate Unclassified
4 2900349738 Photobacterium lucens CAIM 1938 Isolate Unclassified
5 2940356891 Breznakia sp. PFB1-11 Isolate Blattidae
6 2940364193 Breznakia sp. PFB1-19 Isolate Blattidae
7 2517487021 Wohlfahrtiimonas chitiniclastica DSM 18708 Isolate Sarcophagidae
8 2820457604 Unclassified Firmicutes Lab288P3bin15 Isolate Unclassified
9 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
10 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
11 8021899934 Acinetobacter sp. AR2-3 Isolate Culicidae
12 8025716094 Caballeronia zhejiangensis LZ028 Isolate Coreidae
13 8048928574 Photobacterium swingsii CECT 7576 Isolate Unclassified
14 8074882376 Commensalibacter sp. M0270 Isolate Apidae
15 8101960468 Caballeronia sp. AAUFL_F2_KS46 Isolate Coreidae
16 8101988189 Caballeronia sp. ATUFL_F1_KS4A Isolate Coreidae
17 8102014801 Caballeronia sp. ATUFL_M2_KS44 Isolate Coreidae
18 8102060671 Caballeronia sp. GAFFF2 Isolate Coreidae
19 8102152052 Caballeronia sp. LZ001 Isolate Coreidae
20 8102208438 Caballeronia sp. LZ032 Isolate Coreidae
21 8102251710 Caballeronia sp. LZ065 Isolate Coreidae
22 8102279326 Caballeronia sp. NCTM1 Isolate Coreidae
23 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
24 3300002931 Ant worker gut metagenome for colony PL010 Metagenome Formicidae
25 3300002934 Ant worker gut metagenome for colony PL005 Metagenome Formicidae
26 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
27 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
28 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
29 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
30 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
31 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
32 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
33 2820811576 Unclassified Actinobacteria Nt197P3bin53 Isolate Unclassified
34 2831380896 Ignatzschineria ureiclastica KCTC 22644 Isolate Sarcophagidae
35 2864863795 Acinetobacter johnsonii S00116 Isolate Elmidae
36 2884203697 Commensalibacter melissae ESL0284 Isolate Apidae
37 2891591111 Commensalibacter sp. ESL0382 Isolate Unclassified
38 2891610497 Commensalibacter melissae ESL0367 Isolate Apidae
39 2902451016 Photobacterium leiognathi mandapamensis ajapo.4.1 Isolate Unclassified
40 2940352027 Breznakia sp. PH1-1 Isolate Blattidae
41 2511231129 Vibrio sp. EJY3 Isolate Unclassified
42 2513237339 Commensalibacter intestini A911 Isolate Drosophilidae
43 2565956518 Vibrio pacinii DSM 19139 Isolate Unclassified
44 2820211246 Unclassified Kiritimatiellaeota Nt197P3bin96 Isolate Unclassified
45 2820389254 Unclassified Firmicutes Nc150P4bin19 Isolate Unclassified
46 2820696217 Unclassified Firmicutes Co191P1bin66 Isolate Unclassified
47 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
48 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
49 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
50 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
51 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
52 8023747282 Caballeronia zhejiangensis LZ019 Isolate Coreidae
53 8024025509 Caballeronia grimmiae Lep1A1 Isolate Coreidae
54 8024037630 Caballeronia zhejiangensis A33_M4_a Isolate Coreidae
55 8025685901 Caballeronia fortuita LZ035 Isolate Coreidae
56 8025723035 Caballeronia grimmiae LZ025 Isolate Coreidae
57 8025756023 Caballeronia peredens LZ002 Isolate Coreidae
58 8033364368 Vibrio panuliri LBS 2 Isolate Nephropidae
59 8078130113 Caballeronia sp. INDeC2 Isolate Coreidae
60 8100455565 Delftia sp. S67 Isolate Curculionidae
61 8102054868 Caballeronia sp. GAFFF1 Isolate Coreidae
62 8102102351 Caballeronia sp. INML1 Isolate Coreidae
63 8102161003 Caballeronia sp. LZ002 Isolate Coreidae
64 8102174626 Caballeronia sp. LZ024 Isolate Coreidae
65 8102246966 Caballeronia sp. LZ050 Isolate Coreidae
66 3003869270 Paraburkholderia sp. PGU16 Isolate Largidae
67 3006156446 Acinetobacter baretiae B10A Isolate Apidae
68 3300002507 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 Metagenome Termitidae
69 3300007142 Ant gut microbial communities from Cephalotes grandinosus, Brazil Metagenome Formicidae
70 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
71 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
72 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
73 2833052049 Commensalibacter melissae AMU001 Isolate Apidae
74 2835008077 Commensalibacter intestini DmL_052 Isolate Drosophilidae
75 2864843793 Acinetobacter johnsonii S00075 Isolate Elmidae
76 2871760914 Pantoea ananatis PANS 01-2 Isolate Thripidae
77 2940368928 Breznakia sp. PFB2-30 Isolate Blattidae
78 2791354930 Wohlfahrtiimonas larvae kbl006 Isolate Stratiomyidae
79 2820676843 Unclassified Firmicutes Co191P3bin17 Isolate Unclassified
80 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
81 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
82 641522603 Acinetobacter baumannii SDF Isolate Pediculidae
83 8025650824 Caballeronia hypogeia LZ032 Isolate Coreidae
84 8025671076 Caballeronia cordobensis LZ034LL Isolate Coreidae
85 8025735396 Caballeronia zhejiangensis LZ016 Isolate Coreidae
86 8074871419 Commensalibacter sp. M0133 Isolate Apidae
87 8074884171 Commensalibacter sp. M0355 Isolate Apidae
88 8102047609 Caballeronia sp. GACF5 Isolate Coreidae
89 8102074813 Caballeronia sp. GAWG1-1 Isolate Coreidae
90 8102081745 Caballeronia sp. GAWG1-5s-s Isolate Coreidae
91 8102117041 Caballeronia sp. INML3 Isolate Coreidae
92 8102131453 Caballeronia sp. INML5 Isolate Coreidae
93 8102138357 Caballeronia sp. INSB1 Isolate Coreidae
94 8102216467 Caballeronia sp. LZ033 Isolate Coreidae
95 8102230706 Caballeronia sp. LZ035 Isolate Coreidae
96 8102239244 Caballeronia sp. LZ043 Isolate Coreidae
97 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
98 3300012846 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG Metagenome Armadillidiidae
99 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
100 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
101 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
102 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
103 2832039703 Ignatzschineria cameli UAE-HKU59 Isolate Sarcophagidae
104 2864804954 Acinetobacter johnsonii S00050 Isolate Elmidae
105 2864973726 Acinetobacter schindleri S00243 Isolate Elmidae
106 2902469402 Photobacterium lucens CAIM 1937 Isolate Unclassified
107 2775507278 Commensalibacter papalotli (ex Servin-Garciduenas et al. 2014) MX-MONARCH01 Isolate Nymphalidae
108 2820688768 Unclassified Firmicutes Co191P1bin74 Isolate Unclassified
109 8022096067 Vibrio sp. SALL6 Isolate Unclassified
110 8023724303 Caballeronia zhejiangensis LP003 Isolate Coreidae
111 8024001094 Caballeronia sp. TF1N1 Isolate Berytidae
112 8025666332 Caballeronia grimmiae LZ050 Isolate Coreidae
113 8025694439 Caballeronia cordobensis LZ033 Isolate Coreidae
114 8025701579 Caballeronia telluris LZ031 Isolate Coreidae
115 8065338428 Ignatzschineria indica KCTC 22643 Isolate Sarcophagidae
116 8074745029 Commensalibacter melissae M0407 Isolate Apidae
117 8074748739 Commensalibacter sp. W8133 Isolate Apidae
118 8101967387 Caballeronia sp. AAUFL_F3_KS11A Isolate Coreidae
119 8102007614 Caballeronia sp. ATUFL_M1_KS5A Isolate Coreidae
120 8102041249 Caballeronia sp. GACF4 Isolate Coreidae
121 8102087471 Caballeronia sp. GAWG2-1 Isolate Coreidae
122 8102201977 Caballeronia sp. LZ031 Isolate Coreidae
123 8102264549 Caballeronia sp. NCF2 Isolate Coreidae
124 2989793055 Vibrio atypicus DSM 25292 Isolate Unclassified
125 3006190525 Acinetobacter sp. S54 Isolate Curculionidae
126 3300007085 Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut Metagenome Drosophilidae
127 3300009460 Microbial communities of aphids from Pistacia texana in Langtry, TX, USA - Geopemphigus sp. seqcov Metagenome
128 3300012849 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG Metagenome Culicidae
129 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
130 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
131 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
132 2820882373 Unclassified Actinobacteria Lab288P1bin45 Isolate Unclassified
133 2832037495 Ignatzschineria indica KCTC 22643 Isolate Sarcophagidae
134 2873884416 Photobacterium sanguinicancri Mj110 CAIM 1827 Isolate Majidae
135 2891675627 Commensalibacter melissae ESL0366 Isolate Apidae
136 2636415586 Vibrio harveyi NBRC 15634 Isolate Talitridae
137 2791355471 Vibrio bivalvicida 605 Isolate Unclassified
138 8024014383 Caballeronia sp. SL2Y3 Isolate Berytidae
139 8025740903 Caballeronia zhejiangensis LZ008 Isolate Coreidae
140 8048923410 Photobacterium sanguinicancri CECT 7579 Isolate Unclassified
141 8069748016 Caballeronia sp. LP003 Isolate Coreidae
142 8074832014 Commensalibacter melissae M0391 Isolate Apidae
143 8074875073 Commensalibacter sp. M0265 Isolate Apidae
144 8074878724 Commensalibacter sp. M0267 Isolate Apidae
145 8074880551 Commensalibacter sp. M0268 Isolate Apidae
146 8102033761 Caballeronia sp. AZ7_KS35 Isolate Coreidae
147 8102094248 Caballeronia sp. GaOx3 Isolate Coreidae
148 8102109360 Caballeronia sp. INML2 Isolate Coreidae
149 8102145433 Caballeronia sp. LP006 Isolate Coreidae
150 8102186987 Caballeronia sp. LZ028 Isolate Coreidae
151 8102223607 Caballeronia sp. LZ034LL Isolate Coreidae
152 8102286609 Caballeronia sp. NCTM5 Isolate Coreidae
153 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
154 3300002938 Larval gut metagenome for colony PL005 Metagenome Formicidae
155 3300007078 Drosophila gut microbial communities from New York, USA - Drosophila putrida male 4 gut Metagenome Drosophilidae
156 3300007095 Ant gut microbial communities from Cephalotes minutus, Brazil Metagenome Formicidae
157 3300012847 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG Metagenome Armadillidiidae
158 3300012852 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG Metagenome
159 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
160 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
161 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
162 2820911766 Unclassified Actinobacteria Emb289P3bin96 Isolate Unclassified
163 2891605396 Commensalibacter melissae ESL0392 Isolate Apidae
164 2891614855 Commensalibacter melissae ESL0379 Isolate Apidae
165 2940354458 Breznakia sp. PF1-11 Isolate Blattidae
166 2513237114 Ignatzschineria larvae DSM 13226 Isolate Sarcophagidae
167 2528768159 Alteromonadaceae bacterium Bs31 Isolate Unclassified
168 2531839311 Acinetobacter sp. HA Isolate Noctuidae
169 2597489944 Caballeronia insecticola RPE64 Isolate Alydidae
170 2788499854 Breznakia blatticola DSM 28867 Isolate Unclassified
171 2820380671 Unclassified Firmicutes Nt197P1bin4 Isolate Unclassified
172 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
173 8023752828 Caballeronia grimmiae LZ062 Isolate Coreidae
174 8024019580 Caballeronia sp. Lep1P3 Isolate Coreidae
175 8024044713 Caballeronia sp. Sq4a Isolate Coreidae
176 8069763219 Caballeronia sp. LZ008 Isolate Coreidae
177 8074743123 Commensalibacter melissae M0402 Isolate Apidae
178 8100449422 Delftia sp. S66 Isolate Curculionidae
179 8102001125 Caballeronia sp. ATUFL_F2_KS9A Isolate Coreidae
180 8102169119 Caballeronia sp. LZ016 Isolate Coreidae
181 8102181083 Caballeronia sp. LZ025 Isolate Coreidae
182 8102271933 Caballeronia sp. NCF4 Isolate Coreidae
183 3003878002 Paraburkholderia sp. PGU19 Isolate Largidae
184 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
185 3300005721 Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 Metagenome Apidae
186 3300007139 Ant gut microbial communities from Cephalotes pellans, Brazil Metagenome Formicidae
187 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
188 2864874997 Acinetobacter lwoffii S00127 Isolate Elmidae
189 2902438364 Photobacterium damselae Hep-2a-11 Isolate Unclassified
190 2940361758 Breznakia sp. PFB1-14 Isolate Blattidae
191 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
192 2820610792 Unclassified Firmicutes Emb289P1bin33 Isolate Unclassified
193 8023757577 Caballeronia peredens LP006 Isolate Coreidae
194 8023764196 Caballeronia peredens LZ001 Isolate Coreidae
195 8025678175 Caballeronia hypogeia LZ043 Isolate Coreidae
196 8025728939 Caballeronia telluris LZ024 Isolate Coreidae
197 8025747911 Caballeronia peredens LZ003 Isolate Coreidae
198 8069755105 Caballeronia sp. LZ003 Isolate Coreidae
199 8069775773 Caballeronia sp. LZ062 Isolate Coreidae
200 8074737057 Commensalibacter sp. M0357 Isolate Apidae
201 8074867669 Commensalibacter sp. B14384M2 Isolate Apidae
202 8074869529 Commensalibacter sp. B14384M3 Isolate Apidae
203 8074873247 Commensalibacter sp. M0134 Isolate Apidae
204 8074876897 Commensalibacter sp. M0266 Isolate Apidae
205 8100461708 Delftia sp. S65 Isolate Curculionidae
206 8101951471 Caballeronia sp. AAUFL_F1_KS45 Isolate Coreidae
207 8101974301 Caballeronia sp. ASUFL_F2_KS49 Isolate Coreidae
208 8101981714 Caballeronia sp. ATUFL_F1_KS39 Isolate Coreidae
209 8102020860 Caballeronia sp. AZ10_KS36 Isolate Coreidae
210 8102026984 Caballeronia sp. AZ1_KS37 Isolate Coreidae
211 8102067727 Caballeronia sp. GAFFF3 Isolate Coreidae
212 3300007083 Ant gut microbial communities from Cephalotes persimilis, Brazil Metagenome Formicidae
213 3300007140 Ant gut microbial communities from Cephalotes pallens, Brazil Metagenome Formicidae
214 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
215 2820857933 Unclassified Actinobacteria Lab288P3bin173 Isolate Unclassified
216 2864840607 Acinetobacter johnsonii S00071 Isolate Elmidae
217 2868883784 Photobacterium leiognathi mandapamensis AJ-1a Isolate Unclassified
218 2891690481 Commensalibacter melissae ESL0390 Isolate Apidae
219 2940359323 Breznakia sp. PFB1-12 Isolate Blattidae
220 2940366561 Breznakia sp. PFB1-4 Isolate Blattidae
221 2756170209 Commensalibacter sp. ESL0284 Isolate Unclassified
222 2820209022 Unclassified Kiritimatiellaeota Th196P3bin76 Isolate Unclassified
223 2820375548 Unclassified Firmicutes Nt197P1bin8 Isolate Unclassified
224 2035265002 Agrotis sp. gut microbial communities from Texas A and M University, USA Metagenome Noctuidae
225 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
226 8025658853 Caballeronia temeraria LZ065 Isolate Coreidae
227 8025708040 Caballeronia jiangsuensis LZ029 Isolate Coreidae
228 8033368880 Vibrio panuliri CAIM 1902 Isolate Palinuridae
229 8069770227 Caballeronia sp. LZ019 Isolate Coreidae
230 8074746876 Commensalibacter sp. W6292M3 Isolate Apidae
231 8074750600 Commensalibacter sp. W8163 Isolate Apidae
232 8101994502 Caballeronia sp. ATUFL_F2_KS42 Isolate Coreidae
233 8102124461 Caballeronia sp. INML3B Isolate Coreidae
234 8102193924 Caballeronia sp. LZ029 Isolate Coreidae
235 8102312426 Caballeronia sp. AAUFL_F1_KS47 Isolate Coreidae
236 3300002501 Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 Metagenome Termitidae
237 3300007150 Drosophila gut microbial communities from New York, USA - Drosophila falleni female 3 gut Metagenome Drosophilidae
238 3300007505 Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut Metagenome Drosophilidae
239 3300012805 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG Metagenome
240 3300003097 Cutworm gut microbial communities from Hangzhou, China Metagenome Noctuidae
241 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
242 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
243 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
244 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466726_157855 3300042619 Bacteria 95901
2 Ga0466728_430329 3300042620 Bacteria 3935
3 Ga0466729_046526 3300042621 Unclassified 4029
4 Ga0160447_100617 3300012849 Bacteria 15909
5 Ga0415639_028156 3300038395 Bacteria 1605
6 Ga0466696_025181 3300042596 Bacteria 2724
7 Ga0466729_310450 3300042621 Bacteria 3313
8 Ga0466735_090592 3300042624 Bacteria 2842
9 Ga0466703_018633 3300042636 Bacteria 1206
10 Ga0466724_28668 3300042649 Unclassified 1915
11 Ga0466716_187317 3300042605 Bacteria 1717
12 Ga0466719_264490 3300042606 Bacteria 4896
13 Ga0123353_10673600 3300010167 Bacteria 1459
14 Ga0104051_1019331 3300007078 Bacteria 2920
15 Ga0105005_1019630 3300007505 Bacteria 1984
16 Ga0123357_10000070 3300009784 Bacteria 83799
17 Ga0466715_120110 3300042616 Bacteria 76368
18 Ga0466726_373793 3300042619 Bacteria 12257
19 Ga0160430_100439 3300012852 Unclassified 24210
20 Ga0466691_046357 3300042593 Bacteria 6524
21 Ga0466713_010364 3300042602 Bacteria 21142
22 Ga0123355_10000351 3300009826 Bacteria 59711
23 Ga0123355_10255486 3300009826 Bacteria 2460
24 Ga0123356_10017730 3300010049 Unclassified 6766
25 Ga0123353_10085020 3300010167 Bacteria 5094
26 JGI24703J35330_11748601 3300002501 Unclassified 21657
27 CVPL010W_10002167 3300002931 Bacteria 23001
28 Ga0102739_1000153 3300007095 Bacteria 19022
29 Ga0466705_174413 3300042612 Bacteria 1944
30 Ga0466733_056035 3300042659 Bacteria 12033
31 Ga0466715_021993 3300042616 Bacteria 4267
32 Ga0466723_317614 3300042618 Bacteria 6456
33 Ga0466726_347306 3300042619 Bacteria 1383
34 Ga0160445_101683 3300012847 Bacteria 5887
35 Ga0466692_196711 3300042591 Bacteria 11771
36 Ga0466691_141569 3300042593 Bacteria 1703
37 Ga0466730_091158 3300042625 Bacteria 112660
38 Ga0466717_313059 3300042604 Bacteria 6546
39 Ga0466716_281192 3300042605 Bacteria 8790
40 Ga0123355_10110758 3300009826 Bacteria 4290
41 Ga0123356_10400635 3300010049 Bacteria 1510
42 Ga0160464_100356 3300012805 Bacteria 37530
43 2227197206 2225789004 Bacteria 1448
44 IMNBL1DRAFT_c0002106 3300000062 Bacteria 14170
45 JGI24695J34938_10115298 3300002450 Bacteria 1094
46 JGI24702J35022_10068854 3300002462 Bacteria 1903
47 JGI24697J35500_11213035 3300002507 Bacteria 1791
48 JGI24696J40584_12957445 3300002834 Bacteria 3518
49 Ga0072941_1593371 3300005201 Bacteria 1392
50 Ga0103261_1000046 3300007083 Unclassified 39142
51 Ga0102737_1008971 3300007142 Unclassified 1740
52 Ga0415639_012493 3300038395 Bacteria 14177
53 Ga0415639_096453 3300038395 Bacteria 2433
54 Ga0466693_166172 3300042592 Bacteria 1630
55 Ga0466693_206598 3300042592 Bacteria 1783
56 Ga0466704_310333 3300042643 Bacteria 2019
57 Ga0466704_548200 3300042643 Bacteria 4649
58 Ga0466724_43013 3300042649 Bacteria 36848
59 Ga0466727_305092 3300042655 Bacteria 5429
60 Ga0466701_047531 3300042598 Bacteria 58092
61 Ga0466706_058827 3300042599 Bacteria 12335
62 Ga0466706_070055 3300042599 Bacteria 20111
63 Ga0123356_10012433 3300010049 Bacteria 8260
64 Ga0123353_10041856 3300010167 Bacteria 7241
65 Ga0123353_10194514 3300010167 Bacteria 3198
66 2227619085 2225789004 Bacteria 11786
67 Ga0052191_101230 3300003097 Unclassified 1815
68 Ga0127649_148118 3300009460 Bacteria 2797
69 Ga0466715_002728 3300042616 Bacteria 18684
70 Ga0466718_078392 3300042617 Bacteria 4998
71 Ga0466726_043211 3300042619 Bacteria 11924
72 Ga0160433_100762 3300012846 Bacteria 11858
73 Ga0466696_311240 3300042596 Bacteria 1352
74 Ga0466696_390963 3300042596 Bacteria 2233
75 Ga0466703_118871 3300042636 Bacteria 17117
76 Ga0466704_607981 3300042643 Unclassified 2771
77 Ga0466708_148875 3300042652 Bacteria 14741
78 Ga0466706_045255 3300042599 Bacteria 5731
79 Ga0466706_281859 3300042599 Bacteria 14832
80 Ga0466707_181989 3300042601 Bacteria 3014
81 Ga0123357_10210877 3300009784 Bacteria 2182
82 Ga0123355_10000691 3300009826 Bacteria 45851
83 Ga0123355_10204330 3300009826 Bacteria 2878
84 JGI24702J35022_10051466 3300002462 Bacteria 2195
85 JGI24703J35330_11748350 3300002501 Unclassified 14436
86 CVPL005W_1000171 3300002934 Unclassified 28551
87 CVPL005L_10002609 3300002938 Unclassified 20507
88 Ga0103260_1000027 3300007139 Bacteria 71480
89 Ga0104019_1002712 3300007150 Bacteria 7562
90 Ga0104019_1191373 3300007150 Bacteria 1848
91 Ga0466715_072660 3300042616 Bacteria 7232
92 Ga0415639_053720 3300038395 Bacteria 4739
93 Ga0466724_25668 3300042649 Unclassified 4616
94 Ga0466724_61258 3300042649 Bacteria 49653
95 Ga0466714_101428 3300042603 Bacteria 21112
96 Ga0466716_027242 3300042605 Bacteria 4262
97 Ga0123353_10000633 3300010167 Bacteria 42953
98 Ga0123353_10042499 3300010167 Bacteria 7188
99 JGI24695J34938_10002635 3300002450 Bacteria 13425
100 JGI24702J35022_10044400 3300002462 Bacteria 2369
101 Ga0072941_1064099 3300005201 Bacteria 42220
102 Ga0102740_1006314 3300007140 Bacteria 2125
103 Ga0466705_303118 3300042612 Bacteria 4448
104 Ga0466733_135655 3300042659 Bacteria 3642
105 Ga0466705_490491 3300042612 Bacteria 14557
106 Ga0466715_185145 3300042616 Bacteria 4580
107 Ga0466726_129888 3300042619 Bacteria 6025
108 Ga0466703_092914 3300042636 Bacteria 53394
109 Ga0466707_120789 3300042601 Bacteria 129814
110 Ga0466717_119617 3300042604 Bacteria 4961
111 Ga0466722_152782 3300042609 Bacteria 5814
112 Ga0123356_10200477 3300010049 Bacteria 2035
113 Ga0123353_10012215 3300010167 Bacteria 12185
114 Ga0123353_10119576 3300010167 Bacteria 4237
115 Ga0123353_10262728 3300010167 Bacteria 2665
116 IMNBL1DRAFT_c0002258 3300000062 Unclassified 13562
117 JGI24702J35022_10096840 3300002462 Bacteria 1611
118 Ga0074278_110274 3300005721 Bacteria 65258
119 Ga0104045_1002366 3300007085 Bacteria 3466
120 Ga0102740_1000054 3300007140 Unclassified 27264
121 Ga0466732_423307 3300042656 Bacteria 2577
122 Ga0466723_224621 3300042618 Bacteria 4309
123 Ga0466723_271234 3300042618 Eukaryota 1239
124 Ga0466690_194305 3300042590 Bacteria 2016
125 Ga0466701_013932 3300042598 Bacteria 93883
126 Ga0466735_123597 3300042624 Bacteria 1959
127 Ga0466730_003163 3300042625 Bacteria 80945
128 Ga0466730_060188 3300042625 Bacteria 807184
129 Ga0466730_071032 3300042625 Bacteria 7197
130 Ga0466704_439382 3300042643 Bacteria 7883
131 Ga0466709_193739 3300042648 Bacteria 5289
132 Ga0123355_10023445 3300009826 Bacteria 9912
133 Ga0123353_10000813 3300010167 Bacteria 38028
134 Ga0123353_10004265 3300010167 Bacteria 18366
135 Ga0123353_10028579 3300010167 Bacteria 8572
136 CwormDRAF_NODE_8368_len_1785_cov_185_489639 2035265002 Bacteria 1815

πŸ“‹ Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300038395 Ga0415639_096453 Ga0415639_096453_1587_2393 268
2 3300042618 Ga0466723_224621 Ga0466723_224621_3433_4281 282
3 2225789004 2227197206 2227621426 299
4 iso_pr_bacteria 2820610792 2820611580 303
5 2225789004 2227619085 2228196785 320
6 3300000062 IMNBL1DRAFT_c0002258 IMNBL1DRAFT_00022589 321
7 3300010167 Ga0123353_10673600 Ga0123353_106736001 323
8 3300007505 Ga0105005_1019630 Ga0105005_10196302 324
9 3300005201 Ga0072941_1593371 Ga0072941_15933711 325
10 3300038395 Ga0415639_053720 Ga0415639_053720_3654_4646 330
11 3300042619 Ga0466726_043211 Ga0466726_043211_4025_5017 330
12 3300042656 Ga0466732_423307 Ga0466732_423307_799_1791 330
13 3300042636 Ga0466703_118871 Ga0466703_118871_15925_16920 331
14 3300042659 Ga0466733_056035 Ga0466733_056035_2664_3680 331
15 3300010167 Ga0123353_10012215 Ga0123353_100122157 332
16 3300010167 Ga0123353_10028579 Ga0123353_100285792 332
17 3300042599 Ga0466706_045255 Ga0466706_045255_88_1086 332
18 3300042599 Ga0466706_070055 Ga0466706_070055_6380_7378 332
19 iso_pr_bacteria 2820375548 2820378199 332
20 2035265002 CwormDRAF_NODE_8368_len_1785_cov_185_489639 CwormDRAFT_286880 333
21 3300002501 JGI24703J35330_11748601 JGI24703J35330_1174860123 333
22 3300042592 Ga0466693_166172 Ga0466693_166172_364_1365 333
23 3300042603 Ga0466714_101428 Ga0466714_101428_18929_19930 333
24 3300042659 Ga0466733_135655 Ga0466733_135655_2381_3382 333
25 3300002834 JGI24696J40584_12957445 JGI24696J40584_129574452 334
26 3300003097 Ga0052191_101230 Ga0052191_1012302 334
27 3300009826 Ga0123355_10023445 Ga0123355_100234452 334
28 3300009826 Ga0123355_10204330 Ga0123355_102043303 334
29 3300010049 Ga0123356_10012433 Ga0123356_100124332 334
30 3300042596 Ga0466696_025181 Ga0466696_025181_255_1259 334
31 3300042598 Ga0466701_047531 Ga0466701_047531_46547_47551 334
32 3300000062 IMNBL1DRAFT_c0002106 IMNBL1DRAFT_00021063 335
33 3300002462 JGI24702J35022_10044400 JGI24702J35022_100444001 335
34 3300002462 JGI24702J35022_10068854 JGI24702J35022_100688541 335
35 3300010049 Ga0123356_10400635 Ga0123356_104006352 335
36 3300038395 Ga0415639_012493 Ga0415639_012493_7104_8111 335
37 3300042596 Ga0466696_390963 Ga0466696_390963_938_1945 335
38 3300042609 Ga0466722_152782 Ga0466722_152782_1141_2148 335
39 3300042612 Ga0466705_490491 Ga0466705_490491_10821_11828 335
40 3300042618 Ga0466723_271234 Ga0466723_271234_82_1089 335
41 3300042643 Ga0466704_439382 Ga0466704_439382_6363_7370 335
42 3300042643 Ga0466704_548200 Ga0466704_548200_494_1501 335
43 iso_pr_bacteria 2788499854 2788759964 335
44 iso_pr_bacteria 2820676843 2820679199 335
45 iso_pr_bacteria 2820688768 2820688843 335
46 iso_pr_bacteria 2820696217 2820698450 335
47 iso_pr_bacteria 2940352027 2940352474 335
48 iso_pr_bacteria 2940354458 2940354905 335
49 iso_pr_bacteria 2940356891 2940357339 335
50 iso_pr_bacteria 2940359323 2940359589 335
51 iso_pr_bacteria 2940361758 2940362205 335
52 iso_pr_bacteria 2940364193 2940364640 335
53 iso_pr_bacteria 2940366561 2940367944 335
54 iso_pr_bacteria 2940368928 2940369193 335
55 3300002450 JGI24695J34938_10002635 JGI24695J34938_1000263513 336
56 3300002450 JGI24695J34938_10115298 JGI24695J34938_101152981 336
57 3300002938 CVPL005L_10002609 CVPL005L_1000260918 336
58 3300038395 Ga0415639_028156 Ga0415639_028156_202_1212 336
59 3300042599 Ga0466706_281859 Ga0466706_281859_7840_8850 336
60 3300042621 Ga0466729_310450 Ga0466729_310450_196_1206 336
61 3300042625 Ga0466730_060188 Ga0466730_060188_548966_549976 336
62 3300042636 Ga0466703_018633 Ga0466703_018633_19_1029 336
63 iso_pr_bacteria 2511231129 2511734028 336
64 iso_pr_bacteria 2820380671 2820381853 336
65 iso_pr_bacteria 2858407585 2858408200 336
66 iso_pr_bacteria 2873884416 2873884682 336
67 iso_pr_bacteria 8048928574 8048929940 336
68 iso_pr_bacteria 8100449422 8100450733 336
69 iso_pr_bacteria 8100455565 8100458456 336
70 iso_pr_bacteria 8100461708 8100464061 336
71 3300002462 JGI24702J35022_10051466 JGI24702J35022_100514661 337
72 3300002501 JGI24703J35330_11748350 JGI24703J35330_117483509 337
73 3300002507 JGI24697J35500_11213035 JGI24697J35500_112130352 337
74 3300005201 Ga0072941_1064099 Ga0072941_106409926 337
75 3300010167 Ga0123353_10085020 Ga0123353_100850203 337
76 3300042591 Ga0466692_196711 Ga0466692_196711_6498_7511 337
77 3300042593 Ga0466691_046357 Ga0466691_046357_2071_3084 337
78 3300042599 Ga0466706_058827 Ga0466706_058827_6189_7202 337
79 3300042604 Ga0466717_119617 Ga0466717_119617_275_1288 337
80 3300042605 Ga0466716_281192 Ga0466716_281192_473_1486 337
81 3300042612 Ga0466705_303118 Ga0466705_303118_17_1030 337
82 3300042616 Ga0466715_002728 Ga0466715_002728_13601_14614 337
83 3300042616 Ga0466715_072660 Ga0466715_072660_2911_3924 337
84 3300042616 Ga0466715_120110 Ga0466715_120110_16395_17408 337
85 3300042618 Ga0466723_317614 Ga0466723_317614_3307_4320 337
86 3300042620 Ga0466728_430329 Ga0466728_430329_210_1223 337
87 3300042621 Ga0466729_046526 Ga0466729_046526_2930_3943 337
88 3300042624 Ga0466735_090592 Ga0466735_090592_1768_2781 337
89 3300042643 Ga0466704_310333 Ga0466704_310333_334_1347 337
90 3300042643 Ga0466704_607981 Ga0466704_607981_70_1083 337
91 3300042648 Ga0466709_193739 Ga0466709_193739_1391_2404 337
92 iso_pr_bacteria 2513237339 2514544694 337
93 iso_pr_bacteria 2775507278 2778219958 337
94 iso_pr_bacteria 2820389254 2820390178 337
95 iso_pr_bacteria 2835008077 2835008637 337
96 iso_pr_bacteria 2989793055 2989795416 337
97 3300009784 Ga0123357_10000070 Ga0123357_100000708 338
98 3300010167 Ga0123353_10041856 Ga0123353_100418564 338
99 3300042617 Ga0466718_078392 Ga0466718_078392_1393_2409 338
100 3300042636 Ga0466703_092914 Ga0466703_092914_35874_36890 338
101 3300042652 Ga0466708_148875 Ga0466708_148875_11687_12703 338
102 iso_pr_bacteria 2517487021 2517563938 338
103 iso_pr_bacteria 2565956518 2566025429 338
104 iso_pr_bacteria 2756170209 2756540752 338
105 iso_pr_bacteria 2820457604 2820458796 338
106 iso_pr_bacteria 2831380896 2831381626 338
107 iso_pr_bacteria 2832037495 2832038191 338
108 iso_pr_bacteria 2833052049 2833053146 338
109 iso_pr_bacteria 2858407585 2858411001 338
110 iso_pr_bacteria 2864874997 2864877219 338
111 iso_pr_bacteria 2873884416 2873888073 338
112 iso_pr_bacteria 2884203697 2884204747 338
113 iso_pr_bacteria 2891591111 2891592146 338
114 iso_pr_bacteria 2891605396 2891606454 338
115 iso_pr_bacteria 2891610497 2891611575 338
116 iso_pr_bacteria 2891614855 2891615908 338
117 iso_pr_bacteria 2891675627 2891676706 338
118 iso_pr_bacteria 2891690481 2891691511 338
119 iso_pr_bacteria 2902438364 2902442224 338
120 iso_pr_bacteria 641522603 641582789 338
121 iso_pr_bacteria 8033364368 8033365220 338
122 iso_pr_bacteria 8033368880 8033370548 338
123 iso_pr_bacteria 8048923410 8048927516 338
124 iso_pr_bacteria 8048928574 8048932407 338
125 iso_pr_bacteria 8065338428 8065339043 338
126 iso_pr_bacteria 8074737057 8074737231 338
127 iso_pr_bacteria 8074743123 8074743307 338
128 iso_pr_bacteria 8074745029 8074745590 338
129 iso_pr_bacteria 8074746876 8074747427 338
130 iso_pr_bacteria 8074748739 8074749368 338
131 iso_pr_bacteria 8074750600 8074752108 338
132 iso_pr_bacteria 8074832014 8074832600 338
133 iso_pr_bacteria 8074867669 8074868299 338
134 iso_pr_bacteria 8074869529 8074870536 338
135 iso_pr_bacteria 8074871419 8074871876 338
136 iso_pr_bacteria 8074873247 8074873853 338
137 iso_pr_bacteria 8074875073 8074875637 338
138 iso_pr_bacteria 8074876897 8074877459 338
139 iso_pr_bacteria 8074878724 8074879287 338
140 iso_pr_bacteria 8074880551 8074881097 338
141 iso_pr_bacteria 8074882376 8074882544 338
142 iso_pr_bacteria 8074884171 8074884341 338
143 3300002462 JGI24702J35022_10096840 JGI24702J35022_100968402 339
144 3300005721 Ga0074278_110274 Ga0074278_11027414 339
145 3300007085 Ga0104045_1002366 Ga0104045_10023662 339
146 3300007150 Ga0104019_1002712 Ga0104019_10027122 339
147 3300010167 Ga0123353_10042499 Ga0123353_100424996 339
148 3300010167 Ga0123353_10194514 Ga0123353_101945143 339
149 3300012846 Ga0160433_100762 Ga0160433_1007629 339
150 3300012852 Ga0160430_100439 Ga0160430_10043914 339
151 3300042592 Ga0466693_206598 Ga0466693_206598_695_1714 339
152 3300042593 Ga0466691_141569 Ga0466691_141569_55_1074 339
153 3300042606 Ga0466719_264490 Ga0466719_264490_2807_3826 339
154 3300042625 Ga0466730_003163 Ga0466730_003163_2292_3311 339
155 3300042649 Ga0466724_25668 Ga0466724_25668_2203_3222 339
156 3300042649 Ga0466724_28668 Ga0466724_28668_75_1094 339
157 3300042649 Ga0466724_61258 Ga0466724_61258_29007_30026 339
158 iso_pr_bacteria 2513237114 2513782419 339
159 iso_pr_bacteria 2531839311 2533040588 339
160 iso_pr_bacteria 2531839311 2533040686 339
161 iso_pr_bacteria 2791354930 2792024651 339
162 iso_pr_bacteria 2791355471 2794376921 339
163 iso_pr_bacteria 2832039703 2832040962 339
164 iso_pr_bacteria 2844251356 2844255065 339
165 iso_pr_bacteria 2864804954 2864807091 339
166 iso_pr_bacteria 2864840607 2864842755 339
167 iso_pr_bacteria 2864843793 2864845632 339
168 iso_pr_bacteria 2864863795 2864865818 339
169 iso_pr_bacteria 2864973726 2864975167 339
170 iso_pr_bacteria 2868883784 2868886269 339
171 iso_pr_bacteria 2871760914 2871765640 339
172 iso_pr_bacteria 2900349738 2900350951 339
173 iso_pr_bacteria 2902438364 2902440525 339
174 iso_pr_bacteria 2902451016 2902453722 339
175 iso_pr_bacteria 2902469402 2902470645 339
176 iso_pr_bacteria 3006156446 3006157267 339
177 iso_pr_bacteria 3006190525 3006193904 339
178 iso_pr_bacteria 8021899934 8021900751 339
179 3300007140 Ga0102740_1006314 Ga0102740_10063142 340
180 3300007150 Ga0104019_1191373 Ga0104019_11913732 340
181 3300010167 Ga0123353_10000813 Ga0123353_1000081312 340
182 3300010167 Ga0123353_10004265 Ga0123353_1000426515 340
183 3300042598 Ga0466701_013932 Ga0466701_013932_51772_52794 340
184 3300042605 Ga0466716_027242 Ga0466716_027242_3212_4234 340
185 3300042605 Ga0466716_187317 Ga0466716_187317_16_1038 340
186 3300042649 Ga0466724_43013 Ga0466724_43013_6651_7673 340
187 3300042655 Ga0466727_305092 Ga0466727_305092_938_1960 340
188 iso_pr_bacteria 2528768159 2529054839 340
189 iso_pr_bacteria 3003869270 3003871841 340
190 iso_pr_bacteria 3003878002 3003880700 340
191 3300007078 Ga0104051_1019331 Ga0104051_10193312 341
192 3300042612 Ga0466705_174413 Ga0466705_174413_131_1156 341
193 3300042616 Ga0466715_021993 Ga0466715_021993_33_1058 341
194 3300042624 Ga0466735_123597 Ga0466735_123597_502_1527 341
195 3300009826 Ga0123355_10110758 Ga0123355_101107582 342
196 3300042590 Ga0466690_194305 Ga0466690_194305_13_1041 342
197 iso_pr_bacteria 8102014801 8102016895 342
198 3300009826 Ga0123355_10255486 Ga0123355_102554862 343
199 3300010167 Ga0123353_10262728 Ga0123353_102627282 343
200 3300042619 Ga0466726_157855 Ga0466726_157855_41743_42774 343
201 3300042619 Ga0466726_373793 Ga0466726_373793_7638_8669 343
202 3300042625 Ga0466730_071032 Ga0466730_071032_2974_4005 343
203 iso_pr_bacteria 2820911766 2820913563 343
204 3300007095 Ga0102739_1000153 Ga0102739_100015313 344
205 3300010049 Ga0123356_10017730 Ga0123356_100177305 344
206 3300010049 Ga0123356_10200477 Ga0123356_102004772 344
207 iso_pr_bacteria 8024037630 8024039759 344
208 iso_pr_bacteria 8025701579 8025706762 344
209 iso_pr_bacteria 8025716094 8025718597 344
210 iso_pr_bacteria 8025728939 8025731261 344
211 iso_pr_bacteria 8025740903 8025742938 344
212 iso_pr_bacteria 8069748016 8069749826 344
213 iso_pr_bacteria 8069763219 8069765254 344
214 iso_pr_bacteria 8101951471 8101953595 344
215 iso_pr_bacteria 8101960468 8101962590 344
216 iso_pr_bacteria 8101967387 8101969508 344
217 iso_pr_bacteria 8101974301 8101976425 344
218 iso_pr_bacteria 8101981714 8101983835 344
219 iso_pr_bacteria 8101988189 8101990394 344
220 iso_pr_bacteria 8101994502 8101996931 344
221 iso_pr_bacteria 8102001125 8102003103 344
222 iso_pr_bacteria 8102007614 8102009687 344
223 iso_pr_bacteria 8102026984 8102029199 344
224 iso_pr_bacteria 8102033761 8102036282 344
225 iso_pr_bacteria 8102047609 8102049823 344
226 iso_pr_bacteria 8102067727 8102069855 344
227 iso_pr_bacteria 8102094248 8102096647 344
228 iso_pr_bacteria 8102131453 8102134290 344
229 iso_pr_bacteria 8102174626 8102176948 344
230 iso_pr_bacteria 8102186987 8102189489 344
231 iso_pr_bacteria 8102201977 8102207160 344
232 iso_pr_bacteria 8102264549 8102266751 344
233 iso_pr_bacteria 8102271933 8102274215 344
234 iso_pr_bacteria 8102279326 8102281484 344
235 iso_pr_bacteria 8102286609 8102288902 344
236 iso_pr_bacteria 8102312426 8102318215 344
237 3300002931 CVPL010W_10002167 CVPL010W_100021676 345
238 3300002934 CVPL005W_1000171 CVPL005W_100017126 345
239 3300007083 Ga0103261_1000046 Ga0103261_10000464 345
240 3300007139 Ga0103260_1000027 Ga0103260_100002743 345
241 3300007140 Ga0102740_1000054 Ga0102740_100005424 345
242 3300007142 Ga0102737_1008971 Ga0102737_10089712 345
243 3300042616 Ga0466715_185145 Ga0466715_185145_3445_4482 345
244 iso_pr_bacteria 2820857933 2820857938 345
245 iso_pr_bacteria 2820882373 2820883647 345
246 3300009826 Ga0123355_10000691 Ga0123355_1000069134 346
247 3300010167 Ga0123353_10000633 Ga0123353_100006336 346
248 3300012847 Ga0160445_101683 Ga0160445_1016832 346
249 3300042601 Ga0466707_120789 Ga0466707_120789_18590_19630 346
250 iso_pr_bacteria 2820209022 2820209594 346
251 3300042619 Ga0466726_129888 Ga0466726_129888_3135_4178 347
252 iso_pr_bacteria 2820211246 2820212660 347
253 iso_pr_bacteria 8022096067 8022100560 348
254 iso_pr_bacteria 8023747282 8023750454 348
255 iso_pr_bacteria 8024025509 8024026220 348
256 iso_pr_bacteria 8025723035 8025725001 348
257 iso_pr_bacteria 8025735396 8025736918 348
258 iso_pr_bacteria 8069770227 8069773399 348
259 iso_pr_bacteria 8102169119 8102170641 348
260 iso_pr_bacteria 8102181083 8102183049 348
261 3300009460 Ga0127649_148118 Ga0127649_1481182 349
262 iso_pr_bacteria 8025650824 8025653124 349
263 iso_pr_bacteria 8025658853 8025661275 349
264 iso_pr_bacteria 8025671076 8025673217 349
265 iso_pr_bacteria 8025678175 8025680154 349
266 iso_pr_bacteria 8025685901 8025688532 349
267 iso_pr_bacteria 8025694439 8025696868 349
268 iso_pr_bacteria 8025708040 8025710313 349
269 iso_pr_bacteria 8078130113 8078132224 349
270 iso_pr_bacteria 8102102351 8102104429 349
271 iso_pr_bacteria 8102109360 8102111495 349
272 iso_pr_bacteria 8102117041 8102119093 349
273 iso_pr_bacteria 8102124461 8102126713 349
274 iso_pr_bacteria 8102138357 8102140483 349
275 iso_pr_bacteria 8102193924 8102196196 349
276 iso_pr_bacteria 8102208438 8102210738 349
277 iso_pr_bacteria 8102216467 8102218896 349
278 iso_pr_bacteria 8102223607 8102225748 349
279 iso_pr_bacteria 8102230706 8102233337 349
280 iso_pr_bacteria 8102239244 8102241222 349
281 iso_pr_bacteria 8102251710 8102254132 349
282 3300012849 Ga0160447_100617 Ga0160447_10061712 350
283 iso_pr_bacteria 2597489944 2598058206 351
284 iso_pr_bacteria 8024019580 8024020407 351
285 3300012805 Ga0160464_100356 Ga0160464_10035611 352
286 3300042601 Ga0466707_181989 Ga0466707_181989_21_1079 352
287 iso_pr_bacteria 8023752828 8023754462 352
288 iso_pr_bacteria 8024014383 8024016358 352
289 iso_pr_bacteria 8024044713 8024046785 352
290 iso_pr_bacteria 8025666332 8025668328 352
291 iso_pr_bacteria 8069775773 8069777407 352
292 iso_pr_bacteria 8102020860 8102023297 352
293 iso_pr_bacteria 8102054868 8102056918 352
294 iso_pr_bacteria 8102081745 8102083901 352
295 iso_pr_bacteria 8102246966 8102248962 352
296 3300010167 Ga0123353_10119576 Ga0123353_101195764 353
297 3300042596 Ga0466696_311240 Ga0466696_311240_183_1244 353
298 iso_pr_bacteria 2636415586 2637167098 354
299 iso_pr_bacteria 2820811576 2820812026 354
300 3300009826 Ga0123355_10000351 Ga0123355_1000035146 356
301 iso_pr_bacteria 8023724303 8023730192 356
302 iso_pr_bacteria 8023757577 8023763466 356
303 iso_pr_bacteria 8023764196 8023770447 356
304 iso_pr_bacteria 8024001094 8024003191 356
305 iso_pr_bacteria 8025747911 8025750161 356
306 iso_pr_bacteria 8025756023 8025758272 356
307 iso_pr_bacteria 8069755105 8069757355 356
308 iso_pr_bacteria 8102041249 8102043334 356
309 iso_pr_bacteria 8102060671 8102062937 356
310 iso_pr_bacteria 8102074813 8102077010 356
311 iso_pr_bacteria 8102087471 8102089582 356
312 iso_pr_bacteria 8102145433 8102151322 356
313 iso_pr_bacteria 8102152052 8102158303 356
314 iso_pr_bacteria 8102161003 8102167062 356
315 3300042602 Ga0466713_010364 Ga0466713_010364_8315_9400 361
316 3300042625 Ga0466730_091158 Ga0466730_091158_81722_82855 366
317 3300042619 Ga0466726_347306 Ga0466726_347306_184_1299 371
318 3300042604 Ga0466717_313059 Ga0466717_313059_3020_4222 375
319 3300009784 Ga0123357_10210877 Ga0123357_102108772 378
320 iso_pr_bacteria 2820813074 2820813365 400

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01370 Epimerase NAD dependent epimerase/dehydratase family 18 271 0.94
PF04321 RmlD_sub_bind RmlD substrate binding domain 18 178 0.92
PF16363 GDP_Man_Dehyd GDP-mannose 4,6 dehydratase 19 259 0.9
PF02719 Polysacc_synt_2 Polysaccharide biosynthesis protein 18 200 0.83
PF00106 adh_short short chain dehydrogenase 17 119 0.82
PF01073 3Beta_HSD 3-beta hydroxysteroid dehydrogenase/isomerase family 19 178 0.81

βš›οΈ Structure & Feature Viewer

pLDDTpTMQuality
0.86 0.91 High

Powered by Feature Viewer

Powered by PDBe Molstar

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.