Protein Family IF12170
Metagenome
Isolate
320
Members
244
Samples
136
Scaffolds
341.02
Avg Length
Representative Sequence
- ID
- iso_pr_bacteria|2820813074|2820813365|
- Length
- 400 aa
- Sequence
- MSGKGLAGPVPGAPGACVLVTGGAGYIGSHTCVELIQGGWRVLVVDDLSNSSAEALERVRQITGCGADDLVFYEGSILDEALLDRVFAQHAIDAIIHFAGFKAVGESTEKPLAYYENNIAGTLALCKVAGAHGVKSLAFSSSATVYGDPKAVPISESCPKGIPTNPYGHTKSMIEQILFDLYASDPGWCVALLRYFNPIGAHESGLIGEDPKGIPNNLVPYVAQVAVGKRERVGVFGDDYPTPDGTGVRDYIHVVDLARGHVKALEWMARQATGGRLGDGGGRDGGSGRDGGVDVQDGTGPQGDMAAKQQGGVGVFNLGTGKGSSVLEVIRAYGQACGKPLPYEVLPRRAGDIAVSYASCEKARDELGWTAAFDLLRMCEDSWRWQSRNPDGYRSEAAVR
Sample Types
Isolate
57.5%
Metagenome
42.5%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Coreidae
33.3%
Unclassified
14.6%
Apidae
10.8%
Termitidae
7.9%
Kalotermitidae
5.4%
Blattidae
3.3%
Formicidae
3.3%
Sarcophagidae
2.5%
Elmidae
2.5%
Drosophilidae
2.5%
Curculionidae
1.7%
Rhinotermitidae
1.2%
Noctuidae
1.2%
Termopsidae
1.2%
Culicidae
0.8%
Largidae
0.8%
Armadillidiidae
0.8%
Berytidae
0.8%
Passalidae
0.8%
Hodotermitidae
0.4%
Nephropidae
0.4%
Thripidae
0.4%
Stratiomyidae
0.4%
Pediculidae
0.4%
Nymphalidae
0.4%
Majidae
0.4%
Talitridae
0.4%
Alydidae
0.4%
Palinuridae
0.4%
Taxonomy
Archaea
0
Bacteria
304
Eukaryota
1
Viruses
0
Unclassified
15
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820813074 | Unclassified Actinobacteria Nt197P3bin52 | Isolate | Unclassified |
| 2 | 2844251356 | Photobacterium leiognathi mandapamensis ajapo.3.1 | Isolate | Unclassified |
| 3 | 2858407585 | Photobacterium swingsii DSM 24669 | Isolate | Unclassified |
| 4 | 2900349738 | Photobacterium lucens CAIM 1938 | Isolate | Unclassified |
| 5 | 2940356891 | Breznakia sp. PFB1-11 | Isolate | Blattidae |
| 6 | 2940364193 | Breznakia sp. PFB1-19 | Isolate | Blattidae |
| 7 | 2517487021 | Wohlfahrtiimonas chitiniclastica DSM 18708 | Isolate | Sarcophagidae |
| 8 | 2820457604 | Unclassified Firmicutes Lab288P3bin15 | Isolate | Unclassified |
| 9 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 10 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 11 | 8021899934 | Acinetobacter sp. AR2-3 | Isolate | Culicidae |
| 12 | 8025716094 | Caballeronia zhejiangensis LZ028 | Isolate | Coreidae |
| 13 | 8048928574 | Photobacterium swingsii CECT 7576 | Isolate | Unclassified |
| 14 | 8074882376 | Commensalibacter sp. M0270 | Isolate | Apidae |
| 15 | 8101960468 | Caballeronia sp. AAUFL_F2_KS46 | Isolate | Coreidae |
| 16 | 8101988189 | Caballeronia sp. ATUFL_F1_KS4A | Isolate | Coreidae |
| 17 | 8102014801 | Caballeronia sp. ATUFL_M2_KS44 | Isolate | Coreidae |
| 18 | 8102060671 | Caballeronia sp. GAFFF2 | Isolate | Coreidae |
| 19 | 8102152052 | Caballeronia sp. LZ001 | Isolate | Coreidae |
| 20 | 8102208438 | Caballeronia sp. LZ032 | Isolate | Coreidae |
| 21 | 8102251710 | Caballeronia sp. LZ065 | Isolate | Coreidae |
| 22 | 8102279326 | Caballeronia sp. NCTM1 | Isolate | Coreidae |
| 23 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 24 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 25 | 3300002934 | Ant worker gut metagenome for colony PL005 | Metagenome | Formicidae |
| 26 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 27 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 28 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 29 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 30 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 31 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 32 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 33 | 2820811576 | Unclassified Actinobacteria Nt197P3bin53 | Isolate | Unclassified |
| 34 | 2831380896 | Ignatzschineria ureiclastica KCTC 22644 | Isolate | Sarcophagidae |
| 35 | 2864863795 | Acinetobacter johnsonii S00116 | Isolate | Elmidae |
| 36 | 2884203697 | Commensalibacter melissae ESL0284 | Isolate | Apidae |
| 37 | 2891591111 | Commensalibacter sp. ESL0382 | Isolate | Unclassified |
| 38 | 2891610497 | Commensalibacter melissae ESL0367 | Isolate | Apidae |
| 39 | 2902451016 | Photobacterium leiognathi mandapamensis ajapo.4.1 | Isolate | Unclassified |
| 40 | 2940352027 | Breznakia sp. PH1-1 | Isolate | Blattidae |
| 41 | 2511231129 | Vibrio sp. EJY3 | Isolate | Unclassified |
| 42 | 2513237339 | Commensalibacter intestini A911 | Isolate | Drosophilidae |
| 43 | 2565956518 | Vibrio pacinii DSM 19139 | Isolate | Unclassified |
| 44 | 2820211246 | Unclassified Kiritimatiellaeota Nt197P3bin96 | Isolate | Unclassified |
| 45 | 2820389254 | Unclassified Firmicutes Nc150P4bin19 | Isolate | Unclassified |
| 46 | 2820696217 | Unclassified Firmicutes Co191P1bin66 | Isolate | Unclassified |
| 47 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 48 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 49 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 50 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 51 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 52 | 8023747282 | Caballeronia zhejiangensis LZ019 | Isolate | Coreidae |
| 53 | 8024025509 | Caballeronia grimmiae Lep1A1 | Isolate | Coreidae |
| 54 | 8024037630 | Caballeronia zhejiangensis A33_M4_a | Isolate | Coreidae |
| 55 | 8025685901 | Caballeronia fortuita LZ035 | Isolate | Coreidae |
| 56 | 8025723035 | Caballeronia grimmiae LZ025 | Isolate | Coreidae |
| 57 | 8025756023 | Caballeronia peredens LZ002 | Isolate | Coreidae |
| 58 | 8033364368 | Vibrio panuliri LBS 2 | Isolate | Nephropidae |
| 59 | 8078130113 | Caballeronia sp. INDeC2 | Isolate | Coreidae |
| 60 | 8100455565 | Delftia sp. S67 | Isolate | Curculionidae |
| 61 | 8102054868 | Caballeronia sp. GAFFF1 | Isolate | Coreidae |
| 62 | 8102102351 | Caballeronia sp. INML1 | Isolate | Coreidae |
| 63 | 8102161003 | Caballeronia sp. LZ002 | Isolate | Coreidae |
| 64 | 8102174626 | Caballeronia sp. LZ024 | Isolate | Coreidae |
| 65 | 8102246966 | Caballeronia sp. LZ050 | Isolate | Coreidae |
| 66 | 3003869270 | Paraburkholderia sp. PGU16 | Isolate | Largidae |
| 67 | 3006156446 | Acinetobacter baretiae B10A | Isolate | Apidae |
| 68 | 3300002507 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 | Metagenome | Termitidae |
| 69 | 3300007142 | Ant gut microbial communities from Cephalotes grandinosus, Brazil | Metagenome | Formicidae |
| 70 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 71 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 72 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 73 | 2833052049 | Commensalibacter melissae AMU001 | Isolate | Apidae |
| 74 | 2835008077 | Commensalibacter intestini DmL_052 | Isolate | Drosophilidae |
| 75 | 2864843793 | Acinetobacter johnsonii S00075 | Isolate | Elmidae |
| 76 | 2871760914 | Pantoea ananatis PANS 01-2 | Isolate | Thripidae |
| 77 | 2940368928 | Breznakia sp. PFB2-30 | Isolate | Blattidae |
| 78 | 2791354930 | Wohlfahrtiimonas larvae kbl006 | Isolate | Stratiomyidae |
| 79 | 2820676843 | Unclassified Firmicutes Co191P3bin17 | Isolate | Unclassified |
| 80 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 81 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 82 | 641522603 | Acinetobacter baumannii SDF | Isolate | Pediculidae |
| 83 | 8025650824 | Caballeronia hypogeia LZ032 | Isolate | Coreidae |
| 84 | 8025671076 | Caballeronia cordobensis LZ034LL | Isolate | Coreidae |
| 85 | 8025735396 | Caballeronia zhejiangensis LZ016 | Isolate | Coreidae |
| 86 | 8074871419 | Commensalibacter sp. M0133 | Isolate | Apidae |
| 87 | 8074884171 | Commensalibacter sp. M0355 | Isolate | Apidae |
| 88 | 8102047609 | Caballeronia sp. GACF5 | Isolate | Coreidae |
| 89 | 8102074813 | Caballeronia sp. GAWG1-1 | Isolate | Coreidae |
| 90 | 8102081745 | Caballeronia sp. GAWG1-5s-s | Isolate | Coreidae |
| 91 | 8102117041 | Caballeronia sp. INML3 | Isolate | Coreidae |
| 92 | 8102131453 | Caballeronia sp. INML5 | Isolate | Coreidae |
| 93 | 8102138357 | Caballeronia sp. INSB1 | Isolate | Coreidae |
| 94 | 8102216467 | Caballeronia sp. LZ033 | Isolate | Coreidae |
| 95 | 8102230706 | Caballeronia sp. LZ035 | Isolate | Coreidae |
| 96 | 8102239244 | Caballeronia sp. LZ043 | Isolate | Coreidae |
| 97 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 98 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 99 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 100 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 101 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 102 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 103 | 2832039703 | Ignatzschineria cameli UAE-HKU59 | Isolate | Sarcophagidae |
| 104 | 2864804954 | Acinetobacter johnsonii S00050 | Isolate | Elmidae |
| 105 | 2864973726 | Acinetobacter schindleri S00243 | Isolate | Elmidae |
| 106 | 2902469402 | Photobacterium lucens CAIM 1937 | Isolate | Unclassified |
| 107 | 2775507278 | Commensalibacter papalotli (ex Servin-Garciduenas et al. 2014) MX-MONARCH01 | Isolate | Nymphalidae |
| 108 | 2820688768 | Unclassified Firmicutes Co191P1bin74 | Isolate | Unclassified |
| 109 | 8022096067 | Vibrio sp. SALL6 | Isolate | Unclassified |
| 110 | 8023724303 | Caballeronia zhejiangensis LP003 | Isolate | Coreidae |
| 111 | 8024001094 | Caballeronia sp. TF1N1 | Isolate | Berytidae |
| 112 | 8025666332 | Caballeronia grimmiae LZ050 | Isolate | Coreidae |
| 113 | 8025694439 | Caballeronia cordobensis LZ033 | Isolate | Coreidae |
| 114 | 8025701579 | Caballeronia telluris LZ031 | Isolate | Coreidae |
| 115 | 8065338428 | Ignatzschineria indica KCTC 22643 | Isolate | Sarcophagidae |
| 116 | 8074745029 | Commensalibacter melissae M0407 | Isolate | Apidae |
| 117 | 8074748739 | Commensalibacter sp. W8133 | Isolate | Apidae |
| 118 | 8101967387 | Caballeronia sp. AAUFL_F3_KS11A | Isolate | Coreidae |
| 119 | 8102007614 | Caballeronia sp. ATUFL_M1_KS5A | Isolate | Coreidae |
| 120 | 8102041249 | Caballeronia sp. GACF4 | Isolate | Coreidae |
| 121 | 8102087471 | Caballeronia sp. GAWG2-1 | Isolate | Coreidae |
| 122 | 8102201977 | Caballeronia sp. LZ031 | Isolate | Coreidae |
| 123 | 8102264549 | Caballeronia sp. NCF2 | Isolate | Coreidae |
| 124 | 2989793055 | Vibrio atypicus DSM 25292 | Isolate | Unclassified |
| 125 | 3006190525 | Acinetobacter sp. S54 | Isolate | Curculionidae |
| 126 | 3300007085 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut | Metagenome | Drosophilidae |
| 127 | 3300009460 | Microbial communities of aphids from Pistacia texana in Langtry, TX, USA - Geopemphigus sp. seqcov | Metagenome | |
| 128 | 3300012849 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG | Metagenome | Culicidae |
| 129 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 130 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 131 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 132 | 2820882373 | Unclassified Actinobacteria Lab288P1bin45 | Isolate | Unclassified |
| 133 | 2832037495 | Ignatzschineria indica KCTC 22643 | Isolate | Sarcophagidae |
| 134 | 2873884416 | Photobacterium sanguinicancri Mj110 CAIM 1827 | Isolate | Majidae |
| 135 | 2891675627 | Commensalibacter melissae ESL0366 | Isolate | Apidae |
| 136 | 2636415586 | Vibrio harveyi NBRC 15634 | Isolate | Talitridae |
| 137 | 2791355471 | Vibrio bivalvicida 605 | Isolate | Unclassified |
| 138 | 8024014383 | Caballeronia sp. SL2Y3 | Isolate | Berytidae |
| 139 | 8025740903 | Caballeronia zhejiangensis LZ008 | Isolate | Coreidae |
| 140 | 8048923410 | Photobacterium sanguinicancri CECT 7579 | Isolate | Unclassified |
| 141 | 8069748016 | Caballeronia sp. LP003 | Isolate | Coreidae |
| 142 | 8074832014 | Commensalibacter melissae M0391 | Isolate | Apidae |
| 143 | 8074875073 | Commensalibacter sp. M0265 | Isolate | Apidae |
| 144 | 8074878724 | Commensalibacter sp. M0267 | Isolate | Apidae |
| 145 | 8074880551 | Commensalibacter sp. M0268 | Isolate | Apidae |
| 146 | 8102033761 | Caballeronia sp. AZ7_KS35 | Isolate | Coreidae |
| 147 | 8102094248 | Caballeronia sp. GaOx3 | Isolate | Coreidae |
| 148 | 8102109360 | Caballeronia sp. INML2 | Isolate | Coreidae |
| 149 | 8102145433 | Caballeronia sp. LP006 | Isolate | Coreidae |
| 150 | 8102186987 | Caballeronia sp. LZ028 | Isolate | Coreidae |
| 151 | 8102223607 | Caballeronia sp. LZ034LL | Isolate | Coreidae |
| 152 | 8102286609 | Caballeronia sp. NCTM5 | Isolate | Coreidae |
| 153 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 154 | 3300002938 | Larval gut metagenome for colony PL005 | Metagenome | Formicidae |
| 155 | 3300007078 | Drosophila gut microbial communities from New York, USA - Drosophila putrida male 4 gut | Metagenome | Drosophilidae |
| 156 | 3300007095 | Ant gut microbial communities from Cephalotes minutus, Brazil | Metagenome | Formicidae |
| 157 | 3300012847 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG | Metagenome | Armadillidiidae |
| 158 | 3300012852 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG | Metagenome | |
| 159 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 160 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 161 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 162 | 2820911766 | Unclassified Actinobacteria Emb289P3bin96 | Isolate | Unclassified |
| 163 | 2891605396 | Commensalibacter melissae ESL0392 | Isolate | Apidae |
| 164 | 2891614855 | Commensalibacter melissae ESL0379 | Isolate | Apidae |
| 165 | 2940354458 | Breznakia sp. PF1-11 | Isolate | Blattidae |
| 166 | 2513237114 | Ignatzschineria larvae DSM 13226 | Isolate | Sarcophagidae |
| 167 | 2528768159 | Alteromonadaceae bacterium Bs31 | Isolate | Unclassified |
| 168 | 2531839311 | Acinetobacter sp. HA | Isolate | Noctuidae |
| 169 | 2597489944 | Caballeronia insecticola RPE64 | Isolate | Alydidae |
| 170 | 2788499854 | Breznakia blatticola DSM 28867 | Isolate | Unclassified |
| 171 | 2820380671 | Unclassified Firmicutes Nt197P1bin4 | Isolate | Unclassified |
| 172 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 173 | 8023752828 | Caballeronia grimmiae LZ062 | Isolate | Coreidae |
| 174 | 8024019580 | Caballeronia sp. Lep1P3 | Isolate | Coreidae |
| 175 | 8024044713 | Caballeronia sp. Sq4a | Isolate | Coreidae |
| 176 | 8069763219 | Caballeronia sp. LZ008 | Isolate | Coreidae |
| 177 | 8074743123 | Commensalibacter melissae M0402 | Isolate | Apidae |
| 178 | 8100449422 | Delftia sp. S66 | Isolate | Curculionidae |
| 179 | 8102001125 | Caballeronia sp. ATUFL_F2_KS9A | Isolate | Coreidae |
| 180 | 8102169119 | Caballeronia sp. LZ016 | Isolate | Coreidae |
| 181 | 8102181083 | Caballeronia sp. LZ025 | Isolate | Coreidae |
| 182 | 8102271933 | Caballeronia sp. NCF4 | Isolate | Coreidae |
| 183 | 3003878002 | Paraburkholderia sp. PGU19 | Isolate | Largidae |
| 184 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 185 | 3300005721 | Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 | Metagenome | Apidae |
| 186 | 3300007139 | Ant gut microbial communities from Cephalotes pellans, Brazil | Metagenome | Formicidae |
| 187 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 188 | 2864874997 | Acinetobacter lwoffii S00127 | Isolate | Elmidae |
| 189 | 2902438364 | Photobacterium damselae Hep-2a-11 | Isolate | Unclassified |
| 190 | 2940361758 | Breznakia sp. PFB1-14 | Isolate | Blattidae |
| 191 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 192 | 2820610792 | Unclassified Firmicutes Emb289P1bin33 | Isolate | Unclassified |
| 193 | 8023757577 | Caballeronia peredens LP006 | Isolate | Coreidae |
| 194 | 8023764196 | Caballeronia peredens LZ001 | Isolate | Coreidae |
| 195 | 8025678175 | Caballeronia hypogeia LZ043 | Isolate | Coreidae |
| 196 | 8025728939 | Caballeronia telluris LZ024 | Isolate | Coreidae |
| 197 | 8025747911 | Caballeronia peredens LZ003 | Isolate | Coreidae |
| 198 | 8069755105 | Caballeronia sp. LZ003 | Isolate | Coreidae |
| 199 | 8069775773 | Caballeronia sp. LZ062 | Isolate | Coreidae |
| 200 | 8074737057 | Commensalibacter sp. M0357 | Isolate | Apidae |
| 201 | 8074867669 | Commensalibacter sp. B14384M2 | Isolate | Apidae |
| 202 | 8074869529 | Commensalibacter sp. B14384M3 | Isolate | Apidae |
| 203 | 8074873247 | Commensalibacter sp. M0134 | Isolate | Apidae |
| 204 | 8074876897 | Commensalibacter sp. M0266 | Isolate | Apidae |
| 205 | 8100461708 | Delftia sp. S65 | Isolate | Curculionidae |
| 206 | 8101951471 | Caballeronia sp. AAUFL_F1_KS45 | Isolate | Coreidae |
| 207 | 8101974301 | Caballeronia sp. ASUFL_F2_KS49 | Isolate | Coreidae |
| 208 | 8101981714 | Caballeronia sp. ATUFL_F1_KS39 | Isolate | Coreidae |
| 209 | 8102020860 | Caballeronia sp. AZ10_KS36 | Isolate | Coreidae |
| 210 | 8102026984 | Caballeronia sp. AZ1_KS37 | Isolate | Coreidae |
| 211 | 8102067727 | Caballeronia sp. GAFFF3 | Isolate | Coreidae |
| 212 | 3300007083 | Ant gut microbial communities from Cephalotes persimilis, Brazil | Metagenome | Formicidae |
| 213 | 3300007140 | Ant gut microbial communities from Cephalotes pallens, Brazil | Metagenome | Formicidae |
| 214 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 215 | 2820857933 | Unclassified Actinobacteria Lab288P3bin173 | Isolate | Unclassified |
| 216 | 2864840607 | Acinetobacter johnsonii S00071 | Isolate | Elmidae |
| 217 | 2868883784 | Photobacterium leiognathi mandapamensis AJ-1a | Isolate | Unclassified |
| 218 | 2891690481 | Commensalibacter melissae ESL0390 | Isolate | Apidae |
| 219 | 2940359323 | Breznakia sp. PFB1-12 | Isolate | Blattidae |
| 220 | 2940366561 | Breznakia sp. PFB1-4 | Isolate | Blattidae |
| 221 | 2756170209 | Commensalibacter sp. ESL0284 | Isolate | Unclassified |
| 222 | 2820209022 | Unclassified Kiritimatiellaeota Th196P3bin76 | Isolate | Unclassified |
| 223 | 2820375548 | Unclassified Firmicutes Nt197P1bin8 | Isolate | Unclassified |
| 224 | 2035265002 | Agrotis sp. gut microbial communities from Texas A and M University, USA | Metagenome | Noctuidae |
| 225 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 226 | 8025658853 | Caballeronia temeraria LZ065 | Isolate | Coreidae |
| 227 | 8025708040 | Caballeronia jiangsuensis LZ029 | Isolate | Coreidae |
| 228 | 8033368880 | Vibrio panuliri CAIM 1902 | Isolate | Palinuridae |
| 229 | 8069770227 | Caballeronia sp. LZ019 | Isolate | Coreidae |
| 230 | 8074746876 | Commensalibacter sp. W6292M3 | Isolate | Apidae |
| 231 | 8074750600 | Commensalibacter sp. W8163 | Isolate | Apidae |
| 232 | 8101994502 | Caballeronia sp. ATUFL_F2_KS42 | Isolate | Coreidae |
| 233 | 8102124461 | Caballeronia sp. INML3B | Isolate | Coreidae |
| 234 | 8102193924 | Caballeronia sp. LZ029 | Isolate | Coreidae |
| 235 | 8102312426 | Caballeronia sp. AAUFL_F1_KS47 | Isolate | Coreidae |
| 236 | 3300002501 | Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 | Metagenome | Termitidae |
| 237 | 3300007150 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 3 gut | Metagenome | Drosophilidae |
| 238 | 3300007505 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut | Metagenome | Drosophilidae |
| 239 | 3300012805 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG | Metagenome | |
| 240 | 3300003097 | Cutworm gut microbial communities from Hangzhou, China | Metagenome | Noctuidae |
| 241 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 242 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 243 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 244 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466726_157855 | 3300042619 | Bacteria | 95901 |
| 2 | Ga0466728_430329 | 3300042620 | Bacteria | 3935 |
| 3 | Ga0466729_046526 | 3300042621 | Unclassified | 4029 |
| 4 | Ga0160447_100617 | 3300012849 | Bacteria | 15909 |
| 5 | Ga0415639_028156 | 3300038395 | Bacteria | 1605 |
| 6 | Ga0466696_025181 | 3300042596 | Bacteria | 2724 |
| 7 | Ga0466729_310450 | 3300042621 | Bacteria | 3313 |
| 8 | Ga0466735_090592 | 3300042624 | Bacteria | 2842 |
| 9 | Ga0466703_018633 | 3300042636 | Bacteria | 1206 |
| 10 | Ga0466724_28668 | 3300042649 | Unclassified | 1915 |
| 11 | Ga0466716_187317 | 3300042605 | Bacteria | 1717 |
| 12 | Ga0466719_264490 | 3300042606 | Bacteria | 4896 |
| 13 | Ga0123353_10673600 | 3300010167 | Bacteria | 1459 |
| 14 | Ga0104051_1019331 | 3300007078 | Bacteria | 2920 |
| 15 | Ga0105005_1019630 | 3300007505 | Bacteria | 1984 |
| 16 | Ga0123357_10000070 | 3300009784 | Bacteria | 83799 |
| 17 | Ga0466715_120110 | 3300042616 | Bacteria | 76368 |
| 18 | Ga0466726_373793 | 3300042619 | Bacteria | 12257 |
| 19 | Ga0160430_100439 | 3300012852 | Unclassified | 24210 |
| 20 | Ga0466691_046357 | 3300042593 | Bacteria | 6524 |
| 21 | Ga0466713_010364 | 3300042602 | Bacteria | 21142 |
| 22 | Ga0123355_10000351 | 3300009826 | Bacteria | 59711 |
| 23 | Ga0123355_10255486 | 3300009826 | Bacteria | 2460 |
| 24 | Ga0123356_10017730 | 3300010049 | Unclassified | 6766 |
| 25 | Ga0123353_10085020 | 3300010167 | Bacteria | 5094 |
| 26 | JGI24703J35330_11748601 | 3300002501 | Unclassified | 21657 |
| 27 | CVPL010W_10002167 | 3300002931 | Bacteria | 23001 |
| 28 | Ga0102739_1000153 | 3300007095 | Bacteria | 19022 |
| 29 | Ga0466705_174413 | 3300042612 | Bacteria | 1944 |
| 30 | Ga0466733_056035 | 3300042659 | Bacteria | 12033 |
| 31 | Ga0466715_021993 | 3300042616 | Bacteria | 4267 |
| 32 | Ga0466723_317614 | 3300042618 | Bacteria | 6456 |
| 33 | Ga0466726_347306 | 3300042619 | Bacteria | 1383 |
| 34 | Ga0160445_101683 | 3300012847 | Bacteria | 5887 |
| 35 | Ga0466692_196711 | 3300042591 | Bacteria | 11771 |
| 36 | Ga0466691_141569 | 3300042593 | Bacteria | 1703 |
| 37 | Ga0466730_091158 | 3300042625 | Bacteria | 112660 |
| 38 | Ga0466717_313059 | 3300042604 | Bacteria | 6546 |
| 39 | Ga0466716_281192 | 3300042605 | Bacteria | 8790 |
| 40 | Ga0123355_10110758 | 3300009826 | Bacteria | 4290 |
| 41 | Ga0123356_10400635 | 3300010049 | Bacteria | 1510 |
| 42 | Ga0160464_100356 | 3300012805 | Bacteria | 37530 |
| 43 | 2227197206 | 2225789004 | Bacteria | 1448 |
| 44 | IMNBL1DRAFT_c0002106 | 3300000062 | Bacteria | 14170 |
| 45 | JGI24695J34938_10115298 | 3300002450 | Bacteria | 1094 |
| 46 | JGI24702J35022_10068854 | 3300002462 | Bacteria | 1903 |
| 47 | JGI24697J35500_11213035 | 3300002507 | Bacteria | 1791 |
| 48 | JGI24696J40584_12957445 | 3300002834 | Bacteria | 3518 |
| 49 | Ga0072941_1593371 | 3300005201 | Bacteria | 1392 |
| 50 | Ga0103261_1000046 | 3300007083 | Unclassified | 39142 |
| 51 | Ga0102737_1008971 | 3300007142 | Unclassified | 1740 |
| 52 | Ga0415639_012493 | 3300038395 | Bacteria | 14177 |
| 53 | Ga0415639_096453 | 3300038395 | Bacteria | 2433 |
| 54 | Ga0466693_166172 | 3300042592 | Bacteria | 1630 |
| 55 | Ga0466693_206598 | 3300042592 | Bacteria | 1783 |
| 56 | Ga0466704_310333 | 3300042643 | Bacteria | 2019 |
| 57 | Ga0466704_548200 | 3300042643 | Bacteria | 4649 |
| 58 | Ga0466724_43013 | 3300042649 | Bacteria | 36848 |
| 59 | Ga0466727_305092 | 3300042655 | Bacteria | 5429 |
| 60 | Ga0466701_047531 | 3300042598 | Bacteria | 58092 |
| 61 | Ga0466706_058827 | 3300042599 | Bacteria | 12335 |
| 62 | Ga0466706_070055 | 3300042599 | Bacteria | 20111 |
| 63 | Ga0123356_10012433 | 3300010049 | Bacteria | 8260 |
| 64 | Ga0123353_10041856 | 3300010167 | Bacteria | 7241 |
| 65 | Ga0123353_10194514 | 3300010167 | Bacteria | 3198 |
| 66 | 2227619085 | 2225789004 | Bacteria | 11786 |
| 67 | Ga0052191_101230 | 3300003097 | Unclassified | 1815 |
| 68 | Ga0127649_148118 | 3300009460 | Bacteria | 2797 |
| 69 | Ga0466715_002728 | 3300042616 | Bacteria | 18684 |
| 70 | Ga0466718_078392 | 3300042617 | Bacteria | 4998 |
| 71 | Ga0466726_043211 | 3300042619 | Bacteria | 11924 |
| 72 | Ga0160433_100762 | 3300012846 | Bacteria | 11858 |
| 73 | Ga0466696_311240 | 3300042596 | Bacteria | 1352 |
| 74 | Ga0466696_390963 | 3300042596 | Bacteria | 2233 |
| 75 | Ga0466703_118871 | 3300042636 | Bacteria | 17117 |
| 76 | Ga0466704_607981 | 3300042643 | Unclassified | 2771 |
| 77 | Ga0466708_148875 | 3300042652 | Bacteria | 14741 |
| 78 | Ga0466706_045255 | 3300042599 | Bacteria | 5731 |
| 79 | Ga0466706_281859 | 3300042599 | Bacteria | 14832 |
| 80 | Ga0466707_181989 | 3300042601 | Bacteria | 3014 |
| 81 | Ga0123357_10210877 | 3300009784 | Bacteria | 2182 |
| 82 | Ga0123355_10000691 | 3300009826 | Bacteria | 45851 |
| 83 | Ga0123355_10204330 | 3300009826 | Bacteria | 2878 |
| 84 | JGI24702J35022_10051466 | 3300002462 | Bacteria | 2195 |
| 85 | JGI24703J35330_11748350 | 3300002501 | Unclassified | 14436 |
| 86 | CVPL005W_1000171 | 3300002934 | Unclassified | 28551 |
| 87 | CVPL005L_10002609 | 3300002938 | Unclassified | 20507 |
| 88 | Ga0103260_1000027 | 3300007139 | Bacteria | 71480 |
| 89 | Ga0104019_1002712 | 3300007150 | Bacteria | 7562 |
| 90 | Ga0104019_1191373 | 3300007150 | Bacteria | 1848 |
| 91 | Ga0466715_072660 | 3300042616 | Bacteria | 7232 |
| 92 | Ga0415639_053720 | 3300038395 | Bacteria | 4739 |
| 93 | Ga0466724_25668 | 3300042649 | Unclassified | 4616 |
| 94 | Ga0466724_61258 | 3300042649 | Bacteria | 49653 |
| 95 | Ga0466714_101428 | 3300042603 | Bacteria | 21112 |
| 96 | Ga0466716_027242 | 3300042605 | Bacteria | 4262 |
| 97 | Ga0123353_10000633 | 3300010167 | Bacteria | 42953 |
| 98 | Ga0123353_10042499 | 3300010167 | Bacteria | 7188 |
| 99 | JGI24695J34938_10002635 | 3300002450 | Bacteria | 13425 |
| 100 | JGI24702J35022_10044400 | 3300002462 | Bacteria | 2369 |
| 101 | Ga0072941_1064099 | 3300005201 | Bacteria | 42220 |
| 102 | Ga0102740_1006314 | 3300007140 | Bacteria | 2125 |
| 103 | Ga0466705_303118 | 3300042612 | Bacteria | 4448 |
| 104 | Ga0466733_135655 | 3300042659 | Bacteria | 3642 |
| 105 | Ga0466705_490491 | 3300042612 | Bacteria | 14557 |
| 106 | Ga0466715_185145 | 3300042616 | Bacteria | 4580 |
| 107 | Ga0466726_129888 | 3300042619 | Bacteria | 6025 |
| 108 | Ga0466703_092914 | 3300042636 | Bacteria | 53394 |
| 109 | Ga0466707_120789 | 3300042601 | Bacteria | 129814 |
| 110 | Ga0466717_119617 | 3300042604 | Bacteria | 4961 |
| 111 | Ga0466722_152782 | 3300042609 | Bacteria | 5814 |
| 112 | Ga0123356_10200477 | 3300010049 | Bacteria | 2035 |
| 113 | Ga0123353_10012215 | 3300010167 | Bacteria | 12185 |
| 114 | Ga0123353_10119576 | 3300010167 | Bacteria | 4237 |
| 115 | Ga0123353_10262728 | 3300010167 | Bacteria | 2665 |
| 116 | IMNBL1DRAFT_c0002258 | 3300000062 | Unclassified | 13562 |
| 117 | JGI24702J35022_10096840 | 3300002462 | Bacteria | 1611 |
| 118 | Ga0074278_110274 | 3300005721 | Bacteria | 65258 |
| 119 | Ga0104045_1002366 | 3300007085 | Bacteria | 3466 |
| 120 | Ga0102740_1000054 | 3300007140 | Unclassified | 27264 |
| 121 | Ga0466732_423307 | 3300042656 | Bacteria | 2577 |
| 122 | Ga0466723_224621 | 3300042618 | Bacteria | 4309 |
| 123 | Ga0466723_271234 | 3300042618 | Eukaryota | 1239 |
| 124 | Ga0466690_194305 | 3300042590 | Bacteria | 2016 |
| 125 | Ga0466701_013932 | 3300042598 | Bacteria | 93883 |
| 126 | Ga0466735_123597 | 3300042624 | Bacteria | 1959 |
| 127 | Ga0466730_003163 | 3300042625 | Bacteria | 80945 |
| 128 | Ga0466730_060188 | 3300042625 | Bacteria | 807184 |
| 129 | Ga0466730_071032 | 3300042625 | Bacteria | 7197 |
| 130 | Ga0466704_439382 | 3300042643 | Bacteria | 7883 |
| 131 | Ga0466709_193739 | 3300042648 | Bacteria | 5289 |
| 132 | Ga0123355_10023445 | 3300009826 | Bacteria | 9912 |
| 133 | Ga0123353_10000813 | 3300010167 | Bacteria | 38028 |
| 134 | Ga0123353_10004265 | 3300010167 | Bacteria | 18366 |
| 135 | Ga0123353_10028579 | 3300010167 | Bacteria | 8572 |
| 136 | CwormDRAF_NODE_8368_len_1785_cov_185_489639 | 2035265002 | Bacteria | 1815 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300038395 | Ga0415639_096453 | Ga0415639_096453_1587_2393 | 268 |
| 2 | 3300042618 | Ga0466723_224621 | Ga0466723_224621_3433_4281 | 282 |
| 3 | 2225789004 | 2227197206 | 2227621426 | 299 |
| 4 | iso_pr_bacteria | 2820610792 | 2820611580 | 303 |
| 5 | 2225789004 | 2227619085 | 2228196785 | 320 |
| 6 | 3300000062 | IMNBL1DRAFT_c0002258 | IMNBL1DRAFT_00022589 | 321 |
| 7 | 3300010167 | Ga0123353_10673600 | Ga0123353_106736001 | 323 |
| 8 | 3300007505 | Ga0105005_1019630 | Ga0105005_10196302 | 324 |
| 9 | 3300005201 | Ga0072941_1593371 | Ga0072941_15933711 | 325 |
| 10 | 3300038395 | Ga0415639_053720 | Ga0415639_053720_3654_4646 | 330 |
| 11 | 3300042619 | Ga0466726_043211 | Ga0466726_043211_4025_5017 | 330 |
| 12 | 3300042656 | Ga0466732_423307 | Ga0466732_423307_799_1791 | 330 |
| 13 | 3300042636 | Ga0466703_118871 | Ga0466703_118871_15925_16920 | 331 |
| 14 | 3300042659 | Ga0466733_056035 | Ga0466733_056035_2664_3680 | 331 |
| 15 | 3300010167 | Ga0123353_10012215 | Ga0123353_100122157 | 332 |
| 16 | 3300010167 | Ga0123353_10028579 | Ga0123353_100285792 | 332 |
| 17 | 3300042599 | Ga0466706_045255 | Ga0466706_045255_88_1086 | 332 |
| 18 | 3300042599 | Ga0466706_070055 | Ga0466706_070055_6380_7378 | 332 |
| 19 | iso_pr_bacteria | 2820375548 | 2820378199 | 332 |
| 20 | 2035265002 | CwormDRAF_NODE_8368_len_1785_cov_185_489639 | CwormDRAFT_286880 | 333 |
| 21 | 3300002501 | JGI24703J35330_11748601 | JGI24703J35330_1174860123 | 333 |
| 22 | 3300042592 | Ga0466693_166172 | Ga0466693_166172_364_1365 | 333 |
| 23 | 3300042603 | Ga0466714_101428 | Ga0466714_101428_18929_19930 | 333 |
| 24 | 3300042659 | Ga0466733_135655 | Ga0466733_135655_2381_3382 | 333 |
| 25 | 3300002834 | JGI24696J40584_12957445 | JGI24696J40584_129574452 | 334 |
| 26 | 3300003097 | Ga0052191_101230 | Ga0052191_1012302 | 334 |
| 27 | 3300009826 | Ga0123355_10023445 | Ga0123355_100234452 | 334 |
| 28 | 3300009826 | Ga0123355_10204330 | Ga0123355_102043303 | 334 |
| 29 | 3300010049 | Ga0123356_10012433 | Ga0123356_100124332 | 334 |
| 30 | 3300042596 | Ga0466696_025181 | Ga0466696_025181_255_1259 | 334 |
| 31 | 3300042598 | Ga0466701_047531 | Ga0466701_047531_46547_47551 | 334 |
| 32 | 3300000062 | IMNBL1DRAFT_c0002106 | IMNBL1DRAFT_00021063 | 335 |
| 33 | 3300002462 | JGI24702J35022_10044400 | JGI24702J35022_100444001 | 335 |
| 34 | 3300002462 | JGI24702J35022_10068854 | JGI24702J35022_100688541 | 335 |
| 35 | 3300010049 | Ga0123356_10400635 | Ga0123356_104006352 | 335 |
| 36 | 3300038395 | Ga0415639_012493 | Ga0415639_012493_7104_8111 | 335 |
| 37 | 3300042596 | Ga0466696_390963 | Ga0466696_390963_938_1945 | 335 |
| 38 | 3300042609 | Ga0466722_152782 | Ga0466722_152782_1141_2148 | 335 |
| 39 | 3300042612 | Ga0466705_490491 | Ga0466705_490491_10821_11828 | 335 |
| 40 | 3300042618 | Ga0466723_271234 | Ga0466723_271234_82_1089 | 335 |
| 41 | 3300042643 | Ga0466704_439382 | Ga0466704_439382_6363_7370 | 335 |
| 42 | 3300042643 | Ga0466704_548200 | Ga0466704_548200_494_1501 | 335 |
| 43 | iso_pr_bacteria | 2788499854 | 2788759964 | 335 |
| 44 | iso_pr_bacteria | 2820676843 | 2820679199 | 335 |
| 45 | iso_pr_bacteria | 2820688768 | 2820688843 | 335 |
| 46 | iso_pr_bacteria | 2820696217 | 2820698450 | 335 |
| 47 | iso_pr_bacteria | 2940352027 | 2940352474 | 335 |
| 48 | iso_pr_bacteria | 2940354458 | 2940354905 | 335 |
| 49 | iso_pr_bacteria | 2940356891 | 2940357339 | 335 |
| 50 | iso_pr_bacteria | 2940359323 | 2940359589 | 335 |
| 51 | iso_pr_bacteria | 2940361758 | 2940362205 | 335 |
| 52 | iso_pr_bacteria | 2940364193 | 2940364640 | 335 |
| 53 | iso_pr_bacteria | 2940366561 | 2940367944 | 335 |
| 54 | iso_pr_bacteria | 2940368928 | 2940369193 | 335 |
| 55 | 3300002450 | JGI24695J34938_10002635 | JGI24695J34938_1000263513 | 336 |
| 56 | 3300002450 | JGI24695J34938_10115298 | JGI24695J34938_101152981 | 336 |
| 57 | 3300002938 | CVPL005L_10002609 | CVPL005L_1000260918 | 336 |
| 58 | 3300038395 | Ga0415639_028156 | Ga0415639_028156_202_1212 | 336 |
| 59 | 3300042599 | Ga0466706_281859 | Ga0466706_281859_7840_8850 | 336 |
| 60 | 3300042621 | Ga0466729_310450 | Ga0466729_310450_196_1206 | 336 |
| 61 | 3300042625 | Ga0466730_060188 | Ga0466730_060188_548966_549976 | 336 |
| 62 | 3300042636 | Ga0466703_018633 | Ga0466703_018633_19_1029 | 336 |
| 63 | iso_pr_bacteria | 2511231129 | 2511734028 | 336 |
| 64 | iso_pr_bacteria | 2820380671 | 2820381853 | 336 |
| 65 | iso_pr_bacteria | 2858407585 | 2858408200 | 336 |
| 66 | iso_pr_bacteria | 2873884416 | 2873884682 | 336 |
| 67 | iso_pr_bacteria | 8048928574 | 8048929940 | 336 |
| 68 | iso_pr_bacteria | 8100449422 | 8100450733 | 336 |
| 69 | iso_pr_bacteria | 8100455565 | 8100458456 | 336 |
| 70 | iso_pr_bacteria | 8100461708 | 8100464061 | 336 |
| 71 | 3300002462 | JGI24702J35022_10051466 | JGI24702J35022_100514661 | 337 |
| 72 | 3300002501 | JGI24703J35330_11748350 | JGI24703J35330_117483509 | 337 |
| 73 | 3300002507 | JGI24697J35500_11213035 | JGI24697J35500_112130352 | 337 |
| 74 | 3300005201 | Ga0072941_1064099 | Ga0072941_106409926 | 337 |
| 75 | 3300010167 | Ga0123353_10085020 | Ga0123353_100850203 | 337 |
| 76 | 3300042591 | Ga0466692_196711 | Ga0466692_196711_6498_7511 | 337 |
| 77 | 3300042593 | Ga0466691_046357 | Ga0466691_046357_2071_3084 | 337 |
| 78 | 3300042599 | Ga0466706_058827 | Ga0466706_058827_6189_7202 | 337 |
| 79 | 3300042604 | Ga0466717_119617 | Ga0466717_119617_275_1288 | 337 |
| 80 | 3300042605 | Ga0466716_281192 | Ga0466716_281192_473_1486 | 337 |
| 81 | 3300042612 | Ga0466705_303118 | Ga0466705_303118_17_1030 | 337 |
| 82 | 3300042616 | Ga0466715_002728 | Ga0466715_002728_13601_14614 | 337 |
| 83 | 3300042616 | Ga0466715_072660 | Ga0466715_072660_2911_3924 | 337 |
| 84 | 3300042616 | Ga0466715_120110 | Ga0466715_120110_16395_17408 | 337 |
| 85 | 3300042618 | Ga0466723_317614 | Ga0466723_317614_3307_4320 | 337 |
| 86 | 3300042620 | Ga0466728_430329 | Ga0466728_430329_210_1223 | 337 |
| 87 | 3300042621 | Ga0466729_046526 | Ga0466729_046526_2930_3943 | 337 |
| 88 | 3300042624 | Ga0466735_090592 | Ga0466735_090592_1768_2781 | 337 |
| 89 | 3300042643 | Ga0466704_310333 | Ga0466704_310333_334_1347 | 337 |
| 90 | 3300042643 | Ga0466704_607981 | Ga0466704_607981_70_1083 | 337 |
| 91 | 3300042648 | Ga0466709_193739 | Ga0466709_193739_1391_2404 | 337 |
| 92 | iso_pr_bacteria | 2513237339 | 2514544694 | 337 |
| 93 | iso_pr_bacteria | 2775507278 | 2778219958 | 337 |
| 94 | iso_pr_bacteria | 2820389254 | 2820390178 | 337 |
| 95 | iso_pr_bacteria | 2835008077 | 2835008637 | 337 |
| 96 | iso_pr_bacteria | 2989793055 | 2989795416 | 337 |
| 97 | 3300009784 | Ga0123357_10000070 | Ga0123357_100000708 | 338 |
| 98 | 3300010167 | Ga0123353_10041856 | Ga0123353_100418564 | 338 |
| 99 | 3300042617 | Ga0466718_078392 | Ga0466718_078392_1393_2409 | 338 |
| 100 | 3300042636 | Ga0466703_092914 | Ga0466703_092914_35874_36890 | 338 |
| 101 | 3300042652 | Ga0466708_148875 | Ga0466708_148875_11687_12703 | 338 |
| 102 | iso_pr_bacteria | 2517487021 | 2517563938 | 338 |
| 103 | iso_pr_bacteria | 2565956518 | 2566025429 | 338 |
| 104 | iso_pr_bacteria | 2756170209 | 2756540752 | 338 |
| 105 | iso_pr_bacteria | 2820457604 | 2820458796 | 338 |
| 106 | iso_pr_bacteria | 2831380896 | 2831381626 | 338 |
| 107 | iso_pr_bacteria | 2832037495 | 2832038191 | 338 |
| 108 | iso_pr_bacteria | 2833052049 | 2833053146 | 338 |
| 109 | iso_pr_bacteria | 2858407585 | 2858411001 | 338 |
| 110 | iso_pr_bacteria | 2864874997 | 2864877219 | 338 |
| 111 | iso_pr_bacteria | 2873884416 | 2873888073 | 338 |
| 112 | iso_pr_bacteria | 2884203697 | 2884204747 | 338 |
| 113 | iso_pr_bacteria | 2891591111 | 2891592146 | 338 |
| 114 | iso_pr_bacteria | 2891605396 | 2891606454 | 338 |
| 115 | iso_pr_bacteria | 2891610497 | 2891611575 | 338 |
| 116 | iso_pr_bacteria | 2891614855 | 2891615908 | 338 |
| 117 | iso_pr_bacteria | 2891675627 | 2891676706 | 338 |
| 118 | iso_pr_bacteria | 2891690481 | 2891691511 | 338 |
| 119 | iso_pr_bacteria | 2902438364 | 2902442224 | 338 |
| 120 | iso_pr_bacteria | 641522603 | 641582789 | 338 |
| 121 | iso_pr_bacteria | 8033364368 | 8033365220 | 338 |
| 122 | iso_pr_bacteria | 8033368880 | 8033370548 | 338 |
| 123 | iso_pr_bacteria | 8048923410 | 8048927516 | 338 |
| 124 | iso_pr_bacteria | 8048928574 | 8048932407 | 338 |
| 125 | iso_pr_bacteria | 8065338428 | 8065339043 | 338 |
| 126 | iso_pr_bacteria | 8074737057 | 8074737231 | 338 |
| 127 | iso_pr_bacteria | 8074743123 | 8074743307 | 338 |
| 128 | iso_pr_bacteria | 8074745029 | 8074745590 | 338 |
| 129 | iso_pr_bacteria | 8074746876 | 8074747427 | 338 |
| 130 | iso_pr_bacteria | 8074748739 | 8074749368 | 338 |
| 131 | iso_pr_bacteria | 8074750600 | 8074752108 | 338 |
| 132 | iso_pr_bacteria | 8074832014 | 8074832600 | 338 |
| 133 | iso_pr_bacteria | 8074867669 | 8074868299 | 338 |
| 134 | iso_pr_bacteria | 8074869529 | 8074870536 | 338 |
| 135 | iso_pr_bacteria | 8074871419 | 8074871876 | 338 |
| 136 | iso_pr_bacteria | 8074873247 | 8074873853 | 338 |
| 137 | iso_pr_bacteria | 8074875073 | 8074875637 | 338 |
| 138 | iso_pr_bacteria | 8074876897 | 8074877459 | 338 |
| 139 | iso_pr_bacteria | 8074878724 | 8074879287 | 338 |
| 140 | iso_pr_bacteria | 8074880551 | 8074881097 | 338 |
| 141 | iso_pr_bacteria | 8074882376 | 8074882544 | 338 |
| 142 | iso_pr_bacteria | 8074884171 | 8074884341 | 338 |
| 143 | 3300002462 | JGI24702J35022_10096840 | JGI24702J35022_100968402 | 339 |
| 144 | 3300005721 | Ga0074278_110274 | Ga0074278_11027414 | 339 |
| 145 | 3300007085 | Ga0104045_1002366 | Ga0104045_10023662 | 339 |
| 146 | 3300007150 | Ga0104019_1002712 | Ga0104019_10027122 | 339 |
| 147 | 3300010167 | Ga0123353_10042499 | Ga0123353_100424996 | 339 |
| 148 | 3300010167 | Ga0123353_10194514 | Ga0123353_101945143 | 339 |
| 149 | 3300012846 | Ga0160433_100762 | Ga0160433_1007629 | 339 |
| 150 | 3300012852 | Ga0160430_100439 | Ga0160430_10043914 | 339 |
| 151 | 3300042592 | Ga0466693_206598 | Ga0466693_206598_695_1714 | 339 |
| 152 | 3300042593 | Ga0466691_141569 | Ga0466691_141569_55_1074 | 339 |
| 153 | 3300042606 | Ga0466719_264490 | Ga0466719_264490_2807_3826 | 339 |
| 154 | 3300042625 | Ga0466730_003163 | Ga0466730_003163_2292_3311 | 339 |
| 155 | 3300042649 | Ga0466724_25668 | Ga0466724_25668_2203_3222 | 339 |
| 156 | 3300042649 | Ga0466724_28668 | Ga0466724_28668_75_1094 | 339 |
| 157 | 3300042649 | Ga0466724_61258 | Ga0466724_61258_29007_30026 | 339 |
| 158 | iso_pr_bacteria | 2513237114 | 2513782419 | 339 |
| 159 | iso_pr_bacteria | 2531839311 | 2533040588 | 339 |
| 160 | iso_pr_bacteria | 2531839311 | 2533040686 | 339 |
| 161 | iso_pr_bacteria | 2791354930 | 2792024651 | 339 |
| 162 | iso_pr_bacteria | 2791355471 | 2794376921 | 339 |
| 163 | iso_pr_bacteria | 2832039703 | 2832040962 | 339 |
| 164 | iso_pr_bacteria | 2844251356 | 2844255065 | 339 |
| 165 | iso_pr_bacteria | 2864804954 | 2864807091 | 339 |
| 166 | iso_pr_bacteria | 2864840607 | 2864842755 | 339 |
| 167 | iso_pr_bacteria | 2864843793 | 2864845632 | 339 |
| 168 | iso_pr_bacteria | 2864863795 | 2864865818 | 339 |
| 169 | iso_pr_bacteria | 2864973726 | 2864975167 | 339 |
| 170 | iso_pr_bacteria | 2868883784 | 2868886269 | 339 |
| 171 | iso_pr_bacteria | 2871760914 | 2871765640 | 339 |
| 172 | iso_pr_bacteria | 2900349738 | 2900350951 | 339 |
| 173 | iso_pr_bacteria | 2902438364 | 2902440525 | 339 |
| 174 | iso_pr_bacteria | 2902451016 | 2902453722 | 339 |
| 175 | iso_pr_bacteria | 2902469402 | 2902470645 | 339 |
| 176 | iso_pr_bacteria | 3006156446 | 3006157267 | 339 |
| 177 | iso_pr_bacteria | 3006190525 | 3006193904 | 339 |
| 178 | iso_pr_bacteria | 8021899934 | 8021900751 | 339 |
| 179 | 3300007140 | Ga0102740_1006314 | Ga0102740_10063142 | 340 |
| 180 | 3300007150 | Ga0104019_1191373 | Ga0104019_11913732 | 340 |
| 181 | 3300010167 | Ga0123353_10000813 | Ga0123353_1000081312 | 340 |
| 182 | 3300010167 | Ga0123353_10004265 | Ga0123353_1000426515 | 340 |
| 183 | 3300042598 | Ga0466701_013932 | Ga0466701_013932_51772_52794 | 340 |
| 184 | 3300042605 | Ga0466716_027242 | Ga0466716_027242_3212_4234 | 340 |
| 185 | 3300042605 | Ga0466716_187317 | Ga0466716_187317_16_1038 | 340 |
| 186 | 3300042649 | Ga0466724_43013 | Ga0466724_43013_6651_7673 | 340 |
| 187 | 3300042655 | Ga0466727_305092 | Ga0466727_305092_938_1960 | 340 |
| 188 | iso_pr_bacteria | 2528768159 | 2529054839 | 340 |
| 189 | iso_pr_bacteria | 3003869270 | 3003871841 | 340 |
| 190 | iso_pr_bacteria | 3003878002 | 3003880700 | 340 |
| 191 | 3300007078 | Ga0104051_1019331 | Ga0104051_10193312 | 341 |
| 192 | 3300042612 | Ga0466705_174413 | Ga0466705_174413_131_1156 | 341 |
| 193 | 3300042616 | Ga0466715_021993 | Ga0466715_021993_33_1058 | 341 |
| 194 | 3300042624 | Ga0466735_123597 | Ga0466735_123597_502_1527 | 341 |
| 195 | 3300009826 | Ga0123355_10110758 | Ga0123355_101107582 | 342 |
| 196 | 3300042590 | Ga0466690_194305 | Ga0466690_194305_13_1041 | 342 |
| 197 | iso_pr_bacteria | 8102014801 | 8102016895 | 342 |
| 198 | 3300009826 | Ga0123355_10255486 | Ga0123355_102554862 | 343 |
| 199 | 3300010167 | Ga0123353_10262728 | Ga0123353_102627282 | 343 |
| 200 | 3300042619 | Ga0466726_157855 | Ga0466726_157855_41743_42774 | 343 |
| 201 | 3300042619 | Ga0466726_373793 | Ga0466726_373793_7638_8669 | 343 |
| 202 | 3300042625 | Ga0466730_071032 | Ga0466730_071032_2974_4005 | 343 |
| 203 | iso_pr_bacteria | 2820911766 | 2820913563 | 343 |
| 204 | 3300007095 | Ga0102739_1000153 | Ga0102739_100015313 | 344 |
| 205 | 3300010049 | Ga0123356_10017730 | Ga0123356_100177305 | 344 |
| 206 | 3300010049 | Ga0123356_10200477 | Ga0123356_102004772 | 344 |
| 207 | iso_pr_bacteria | 8024037630 | 8024039759 | 344 |
| 208 | iso_pr_bacteria | 8025701579 | 8025706762 | 344 |
| 209 | iso_pr_bacteria | 8025716094 | 8025718597 | 344 |
| 210 | iso_pr_bacteria | 8025728939 | 8025731261 | 344 |
| 211 | iso_pr_bacteria | 8025740903 | 8025742938 | 344 |
| 212 | iso_pr_bacteria | 8069748016 | 8069749826 | 344 |
| 213 | iso_pr_bacteria | 8069763219 | 8069765254 | 344 |
| 214 | iso_pr_bacteria | 8101951471 | 8101953595 | 344 |
| 215 | iso_pr_bacteria | 8101960468 | 8101962590 | 344 |
| 216 | iso_pr_bacteria | 8101967387 | 8101969508 | 344 |
| 217 | iso_pr_bacteria | 8101974301 | 8101976425 | 344 |
| 218 | iso_pr_bacteria | 8101981714 | 8101983835 | 344 |
| 219 | iso_pr_bacteria | 8101988189 | 8101990394 | 344 |
| 220 | iso_pr_bacteria | 8101994502 | 8101996931 | 344 |
| 221 | iso_pr_bacteria | 8102001125 | 8102003103 | 344 |
| 222 | iso_pr_bacteria | 8102007614 | 8102009687 | 344 |
| 223 | iso_pr_bacteria | 8102026984 | 8102029199 | 344 |
| 224 | iso_pr_bacteria | 8102033761 | 8102036282 | 344 |
| 225 | iso_pr_bacteria | 8102047609 | 8102049823 | 344 |
| 226 | iso_pr_bacteria | 8102067727 | 8102069855 | 344 |
| 227 | iso_pr_bacteria | 8102094248 | 8102096647 | 344 |
| 228 | iso_pr_bacteria | 8102131453 | 8102134290 | 344 |
| 229 | iso_pr_bacteria | 8102174626 | 8102176948 | 344 |
| 230 | iso_pr_bacteria | 8102186987 | 8102189489 | 344 |
| 231 | iso_pr_bacteria | 8102201977 | 8102207160 | 344 |
| 232 | iso_pr_bacteria | 8102264549 | 8102266751 | 344 |
| 233 | iso_pr_bacteria | 8102271933 | 8102274215 | 344 |
| 234 | iso_pr_bacteria | 8102279326 | 8102281484 | 344 |
| 235 | iso_pr_bacteria | 8102286609 | 8102288902 | 344 |
| 236 | iso_pr_bacteria | 8102312426 | 8102318215 | 344 |
| 237 | 3300002931 | CVPL010W_10002167 | CVPL010W_100021676 | 345 |
| 238 | 3300002934 | CVPL005W_1000171 | CVPL005W_100017126 | 345 |
| 239 | 3300007083 | Ga0103261_1000046 | Ga0103261_10000464 | 345 |
| 240 | 3300007139 | Ga0103260_1000027 | Ga0103260_100002743 | 345 |
| 241 | 3300007140 | Ga0102740_1000054 | Ga0102740_100005424 | 345 |
| 242 | 3300007142 | Ga0102737_1008971 | Ga0102737_10089712 | 345 |
| 243 | 3300042616 | Ga0466715_185145 | Ga0466715_185145_3445_4482 | 345 |
| 244 | iso_pr_bacteria | 2820857933 | 2820857938 | 345 |
| 245 | iso_pr_bacteria | 2820882373 | 2820883647 | 345 |
| 246 | 3300009826 | Ga0123355_10000691 | Ga0123355_1000069134 | 346 |
| 247 | 3300010167 | Ga0123353_10000633 | Ga0123353_100006336 | 346 |
| 248 | 3300012847 | Ga0160445_101683 | Ga0160445_1016832 | 346 |
| 249 | 3300042601 | Ga0466707_120789 | Ga0466707_120789_18590_19630 | 346 |
| 250 | iso_pr_bacteria | 2820209022 | 2820209594 | 346 |
| 251 | 3300042619 | Ga0466726_129888 | Ga0466726_129888_3135_4178 | 347 |
| 252 | iso_pr_bacteria | 2820211246 | 2820212660 | 347 |
| 253 | iso_pr_bacteria | 8022096067 | 8022100560 | 348 |
| 254 | iso_pr_bacteria | 8023747282 | 8023750454 | 348 |
| 255 | iso_pr_bacteria | 8024025509 | 8024026220 | 348 |
| 256 | iso_pr_bacteria | 8025723035 | 8025725001 | 348 |
| 257 | iso_pr_bacteria | 8025735396 | 8025736918 | 348 |
| 258 | iso_pr_bacteria | 8069770227 | 8069773399 | 348 |
| 259 | iso_pr_bacteria | 8102169119 | 8102170641 | 348 |
| 260 | iso_pr_bacteria | 8102181083 | 8102183049 | 348 |
| 261 | 3300009460 | Ga0127649_148118 | Ga0127649_1481182 | 349 |
| 262 | iso_pr_bacteria | 8025650824 | 8025653124 | 349 |
| 263 | iso_pr_bacteria | 8025658853 | 8025661275 | 349 |
| 264 | iso_pr_bacteria | 8025671076 | 8025673217 | 349 |
| 265 | iso_pr_bacteria | 8025678175 | 8025680154 | 349 |
| 266 | iso_pr_bacteria | 8025685901 | 8025688532 | 349 |
| 267 | iso_pr_bacteria | 8025694439 | 8025696868 | 349 |
| 268 | iso_pr_bacteria | 8025708040 | 8025710313 | 349 |
| 269 | iso_pr_bacteria | 8078130113 | 8078132224 | 349 |
| 270 | iso_pr_bacteria | 8102102351 | 8102104429 | 349 |
| 271 | iso_pr_bacteria | 8102109360 | 8102111495 | 349 |
| 272 | iso_pr_bacteria | 8102117041 | 8102119093 | 349 |
| 273 | iso_pr_bacteria | 8102124461 | 8102126713 | 349 |
| 274 | iso_pr_bacteria | 8102138357 | 8102140483 | 349 |
| 275 | iso_pr_bacteria | 8102193924 | 8102196196 | 349 |
| 276 | iso_pr_bacteria | 8102208438 | 8102210738 | 349 |
| 277 | iso_pr_bacteria | 8102216467 | 8102218896 | 349 |
| 278 | iso_pr_bacteria | 8102223607 | 8102225748 | 349 |
| 279 | iso_pr_bacteria | 8102230706 | 8102233337 | 349 |
| 280 | iso_pr_bacteria | 8102239244 | 8102241222 | 349 |
| 281 | iso_pr_bacteria | 8102251710 | 8102254132 | 349 |
| 282 | 3300012849 | Ga0160447_100617 | Ga0160447_10061712 | 350 |
| 283 | iso_pr_bacteria | 2597489944 | 2598058206 | 351 |
| 284 | iso_pr_bacteria | 8024019580 | 8024020407 | 351 |
| 285 | 3300012805 | Ga0160464_100356 | Ga0160464_10035611 | 352 |
| 286 | 3300042601 | Ga0466707_181989 | Ga0466707_181989_21_1079 | 352 |
| 287 | iso_pr_bacteria | 8023752828 | 8023754462 | 352 |
| 288 | iso_pr_bacteria | 8024014383 | 8024016358 | 352 |
| 289 | iso_pr_bacteria | 8024044713 | 8024046785 | 352 |
| 290 | iso_pr_bacteria | 8025666332 | 8025668328 | 352 |
| 291 | iso_pr_bacteria | 8069775773 | 8069777407 | 352 |
| 292 | iso_pr_bacteria | 8102020860 | 8102023297 | 352 |
| 293 | iso_pr_bacteria | 8102054868 | 8102056918 | 352 |
| 294 | iso_pr_bacteria | 8102081745 | 8102083901 | 352 |
| 295 | iso_pr_bacteria | 8102246966 | 8102248962 | 352 |
| 296 | 3300010167 | Ga0123353_10119576 | Ga0123353_101195764 | 353 |
| 297 | 3300042596 | Ga0466696_311240 | Ga0466696_311240_183_1244 | 353 |
| 298 | iso_pr_bacteria | 2636415586 | 2637167098 | 354 |
| 299 | iso_pr_bacteria | 2820811576 | 2820812026 | 354 |
| 300 | 3300009826 | Ga0123355_10000351 | Ga0123355_1000035146 | 356 |
| 301 | iso_pr_bacteria | 8023724303 | 8023730192 | 356 |
| 302 | iso_pr_bacteria | 8023757577 | 8023763466 | 356 |
| 303 | iso_pr_bacteria | 8023764196 | 8023770447 | 356 |
| 304 | iso_pr_bacteria | 8024001094 | 8024003191 | 356 |
| 305 | iso_pr_bacteria | 8025747911 | 8025750161 | 356 |
| 306 | iso_pr_bacteria | 8025756023 | 8025758272 | 356 |
| 307 | iso_pr_bacteria | 8069755105 | 8069757355 | 356 |
| 308 | iso_pr_bacteria | 8102041249 | 8102043334 | 356 |
| 309 | iso_pr_bacteria | 8102060671 | 8102062937 | 356 |
| 310 | iso_pr_bacteria | 8102074813 | 8102077010 | 356 |
| 311 | iso_pr_bacteria | 8102087471 | 8102089582 | 356 |
| 312 | iso_pr_bacteria | 8102145433 | 8102151322 | 356 |
| 313 | iso_pr_bacteria | 8102152052 | 8102158303 | 356 |
| 314 | iso_pr_bacteria | 8102161003 | 8102167062 | 356 |
| 315 | 3300042602 | Ga0466713_010364 | Ga0466713_010364_8315_9400 | 361 |
| 316 | 3300042625 | Ga0466730_091158 | Ga0466730_091158_81722_82855 | 366 |
| 317 | 3300042619 | Ga0466726_347306 | Ga0466726_347306_184_1299 | 371 |
| 318 | 3300042604 | Ga0466717_313059 | Ga0466717_313059_3020_4222 | 375 |
| 319 | 3300009784 | Ga0123357_10210877 | Ga0123357_102108772 | 378 |
| 320 | iso_pr_bacteria | 2820813074 | 2820813365 | 400 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01370 | Epimerase | NAD dependent epimerase/dehydratase family | 18 | 271 | 0.94 |
| PF04321 | RmlD_sub_bind | RmlD substrate binding domain | 18 | 178 | 0.92 |
| PF16363 | GDP_Man_Dehyd | GDP-mannose 4,6 dehydratase | 19 | 259 | 0.9 |
| PF02719 | Polysacc_synt_2 | Polysaccharide biosynthesis protein | 18 | 200 | 0.83 |
| PF00106 | adh_short | short chain dehydrogenase | 17 | 119 | 0.82 |
| PF01073 | 3Beta_HSD | 3-beta hydroxysteroid dehydrogenase/isomerase family | 19 | 178 | 0.81 |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.86 | 0.91 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.