Protein Family IF12163
Metagenome
Isolate
142
Members
61
Samples
129
Scaffolds
290.6
Avg Length
Representative Sequence
- ID
- iso_pr_bacteria|2820788205|2820789116|
- Length
- 325 aa
- Sequence
- MAYVGILTQQRRNNFRSTILLLLFPVLVLVLSYVVYLFAHAHKIQEAGLSWFDAFFLKDFLANVAPFVIGGVAIWFLIAYWGNTTIINNAVHSKPLERKENMRVYNLVENLCMQSGMKMPRVNVIQDNSLNAFASGINEKTYTVTLTTGIIQKLNDQELEGVIAHELMHIKNRDVRLLIISIVFVGIFAFISQIALRMLFFSNMSGGRSSGGGGNRGGGGQALMWLVVIAVAAVGYFFTILMKFAISRKREYMADAGAAEMTRNPHALASALRKISGNPNVDAITREDVAQLFIEHPIAKKKTFMSTLFATHPPIEKRIAVLEAF
Sample Types
Isolate
9.2%
Metagenome
90.8%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
40.0%
Unclassified
25.0%
Kalotermitidae
20.0%
Passalidae
3.3%
Termopsidae
3.3%
Formicidae
3.3%
Rhinotermitidae
3.3%
Hodotermitidae
1.7%
Taxonomy
Archaea
0
Bacteria
138
Eukaryota
0
Viruses
0
Unclassified
4
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820786992 | Unclassified Bacteroidetes Emb289P1bin66 | Isolate | Unclassified |
| 2 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 3 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 4 | 2820795054 | Unclassified Bacteroidetes Cu122P1bin21 | Isolate | Unclassified |
| 5 | 2820748953 | Unclassified Bacteroidetes Nt197P4bin17 | Isolate | Unclassified |
| 6 | 2820755292 | Unclassified Bacteroidetes Nc150P3bin3 | Isolate | Unclassified |
| 7 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 8 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 9 | 2820781750 | Unclassified Bacteroidetes Emb289P3bin89 | Isolate | Unclassified |
| 10 | 2820789850 | Unclassified Bacteroidetes Cu122P3bin3 | Isolate | Unclassified |
| 11 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 12 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 13 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 14 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 15 | 2820772500 | Unclassified Bacteroidetes Lab288P1bin72 | Isolate | Unclassified |
| 16 | 2820785563 | Unclassified Bacteroidetes Emb289P1bin74 | Isolate | Unclassified |
| 17 | 2820792843 | Unclassified Bacteroidetes Cu122P3bin1 | Isolate | Unclassified |
| 18 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 19 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 20 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 21 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 22 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 23 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 24 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 25 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 26 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 27 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 28 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 29 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 30 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 31 | 2820753519 | Unclassified Bacteroidetes Nc150P4bin20 | Isolate | Unclassified |
| 32 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 33 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 34 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 35 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 36 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 37 | 2820770630 | Unclassified Bacteroidetes Lab288P3bin130 | Isolate | Unclassified |
| 38 | 2820746860 | Unclassified Bacteroidetes Th196P3bin126 | Isolate | Unclassified |
| 39 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 40 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 41 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 42 | 3300007190 | Ant gut microbial communities from Cephalotes umbraculatus, Peru | Metagenome | Formicidae |
| 43 | 3300007192 | Ant gut microbial communities from Cephalotes persimplex, Brazil | Metagenome | Formicidae |
| 44 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 45 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 46 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 47 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 48 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 49 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 50 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 51 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 52 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 53 | 2820788205 | Unclassified Bacteroidetes Emb289P1bin57 | Isolate | Unclassified |
| 54 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 55 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 56 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 57 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 58 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 59 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 60 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 61 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466714_125039 | 3300042603 | Bacteria | 7321 |
| 2 | Ga0466716_163513 | 3300042605 | Bacteria | 2669 |
| 3 | Ga0466697_029141 | 3300042611 | Bacteria | 3178 |
| 4 | Ga0466710_004099 | 3300042613 | Bacteria | 12802 |
| 5 | Ga0466696_033318 | 3300042596 | Bacteria | 35735 |
| 6 | Ga0123353_10156265 | 3300010167 | Bacteria | 3635 |
| 7 | Ga0123353_10161637 | 3300010167 | Bacteria | 3565 |
| 8 | Ga0123354_10034525 | 3300010882 | Bacteria | 7910 |
| 9 | Ga0466724_33289 | 3300042649 | Bacteria | 3035 |
| 10 | Ga0466724_60142 | 3300042649 | Bacteria | 1161 |
| 11 | IMNBL1DRAFT_c0021567 | 3300000062 | Bacteria | 2574 |
| 12 | JGI24705J35276_12221929 | 3300002504 | Bacteria | 2379 |
| 13 | Ga0103268_1000167 | 3300007192 | Bacteria | 21704 |
| 14 | Ga0123357_10001449 | 3300009784 | Bacteria | 25189 |
| 15 | Ga0466697_166414 | 3300042611 | Bacteria | 1156 |
| 16 | Ga0466732_345355 | 3300042656 | Bacteria | 2002 |
| 17 | Ga0466706_128456 | 3300042599 | Bacteria | 14620 |
| 18 | Ga0466714_168628 | 3300042603 | Bacteria | 36223 |
| 19 | Ga0466696_097317 | 3300042596 | Bacteria | 3082 |
| 20 | Ga0123355_10010286 | 3300009826 | Bacteria | 14314 |
| 21 | Ga0123353_10003630 | 3300010167 | Bacteria | 19565 |
| 22 | Ga0123353_10025466 | 3300010167 | Bacteria | 9016 |
| 23 | Ga0123353_10342180 | 3300010167 | Bacteria | 2259 |
| 24 | Ga0123353_10869107 | 3300010167 | Bacteria | 1233 |
| 25 | Ga0466709_308531 | 3300042648 | Bacteria | 53963 |
| 26 | Ga0466709_365874 | 3300042648 | Bacteria | 2270 |
| 27 | Ga0466725_264121 | 3300042654 | Bacteria | 2531 |
| 28 | Ga0103267_1000060 | 3300007190 | Bacteria | 45092 |
| 29 | Ga0466732_352963 | 3300042656 | Bacteria | 4173 |
| 30 | Ga0466701_103398 | 3300042598 | Unclassified | 1101 |
| 31 | Ga0466707_410294 | 3300042601 | Unclassified | 4216 |
| 32 | Ga0466711_245146 | 3300042615 | Bacteria | 2810 |
| 33 | Ga0466723_149675 | 3300042618 | Bacteria | 4431 |
| 34 | Ga0466694_126624 | 3300042594 | Bacteria | 1787 |
| 35 | Ga0123355_10000859 | 3300009826 | Bacteria | 41957 |
| 36 | Ga0123356_10717132 | 3300010049 | Bacteria | 1169 |
| 37 | Ga0103267_1000035 | 3300007190 | Bacteria | 50564 |
| 38 | Ga0466711_246046 | 3300042615 | Bacteria | 2808 |
| 39 | Ga0466715_439245 | 3300042616 | Bacteria | 26781 |
| 40 | Ga0466729_165434 | 3300042621 | Bacteria | 8860 |
| 41 | Ga0466695_382462 | 3300042595 | Bacteria | 20417 |
| 42 | Ga0123356_10019444 | 3300010049 | Bacteria | 6438 |
| 43 | Ga0123353_10193338 | 3300010167 | Bacteria | 3209 |
| 44 | Ga0123354_10216235 | 3300010882 | Bacteria | 2053 |
| 45 | Ga0466735_085652 | 3300042624 | Bacteria | 4832 |
| 46 | Ga0466703_416796 | 3300042636 | Bacteria | 12962 |
| 47 | Ga0466725_342616 | 3300042654 | Bacteria | 2676 |
| 48 | 2227178027 | 2225789004 | Bacteria | 8097 |
| 49 | JGI24702J35022_10005772 | 3300002462 | Bacteria | 7217 |
| 50 | Ga0103267_1000072 | 3300007190 | Bacteria | 38062 |
| 51 | Ga0466732_089580 | 3300042656 | Bacteria | 136356 |
| 52 | Ga0466706_233547 | 3300042599 | Bacteria | 4128 |
| 53 | Ga0466707_071825 | 3300042601 | Bacteria | 2249 |
| 54 | Ga0466707_334151 | 3300042601 | Bacteria | 5990 |
| 55 | Ga0466717_300151 | 3300042604 | Bacteria | 2057 |
| 56 | Ga0466719_079329 | 3300042606 | Bacteria | 1288 |
| 57 | Ga0466719_345884 | 3300042606 | Bacteria | 2722 |
| 58 | Ga0466715_198701 | 3300042616 | Bacteria | 12046 |
| 59 | Ga0466656_186265 | 3300042550 | Bacteria | 1054 |
| 60 | Ga0466692_157631 | 3300042591 | Bacteria | 42163 |
| 61 | Ga0466693_180187 | 3300042592 | Bacteria | 2516 |
| 62 | Ga0123353_10001310 | 3300010167 | Bacteria | 30488 |
| 63 | Ga0123353_10010198 | 3300010167 | Bacteria | 13072 |
| 64 | Ga0123353_10050518 | 3300010167 | Bacteria | 6630 |
| 65 | Ga0123353_10226864 | 3300010167 | Unclassified | 2915 |
| 66 | Ga0466735_148442 | 3300042624 | Bacteria | 1593 |
| 67 | IMNBL1DRAFT_c0005054 | 3300000062 | Bacteria | 7682 |
| 68 | IMNBL1DRAFT_c0033211 | 3300000062 | Bacteria | 1850 |
| 69 | Ga0072941_1567811 | 3300005201 | Bacteria | 1947 |
| 70 | Ga0466697_154143 | 3300042611 | Bacteria | 1489 |
| 71 | Ga0466697_189655 | 3300042611 | Bacteria | 2127 |
| 72 | Ga0466697_208590 | 3300042611 | Bacteria | 3956 |
| 73 | Ga0466732_404712 | 3300042656 | Bacteria | 7773 |
| 74 | Ga0466714_072816 | 3300042603 | Bacteria | 12417 |
| 75 | Ga0466714_142273 | 3300042603 | Bacteria | 2529 |
| 76 | Ga0466719_165624 | 3300042606 | Bacteria | 2612 |
| 77 | Ga0466719_359503 | 3300042606 | Bacteria | 2097 |
| 78 | Ga0466710_088391 | 3300042613 | Bacteria | 4346 |
| 79 | Ga0466712_253796 | 3300042614 | Bacteria | 1869 |
| 80 | Ga0466711_281817 | 3300042615 | Bacteria | 6059 |
| 81 | Ga0466723_260257 | 3300042618 | Bacteria | 17300 |
| 82 | Ga0466657_078821 | 3300042582 | Bacteria | 6559 |
| 83 | Ga0466690_024348 | 3300042590 | Bacteria | 16349 |
| 84 | Ga0466701_000734 | 3300042598 | Bacteria | 2774 |
| 85 | Ga0123354_10130452 | 3300010882 | Bacteria | 3178 |
| 86 | 2227080794 | 2225789004 | Bacteria | 41653 |
| 87 | IMNBL1DRAFT_c0000660 | 3300000062 | Bacteria | 27588 |
| 88 | JGI24702J35022_10017958 | 3300002462 | Bacteria | 3861 |
| 89 | Ga0466733_069726 | 3300042659 | Bacteria | 17627 |
| 90 | Ga0466714_048239 | 3300042603 | Bacteria | 109405 |
| 91 | Ga0466714_138101 | 3300042603 | Bacteria | 7977 |
| 92 | Ga0466717_163479 | 3300042604 | Bacteria | 2096 |
| 93 | Ga0466716_038967 | 3300042605 | Bacteria | 9075 |
| 94 | Ga0466721_165783 | 3300042608 | Bacteria | 6234 |
| 95 | Ga0466698_492435 | 3300042610 | Bacteria | 3136 |
| 96 | Ga0466711_038817 | 3300042615 | Bacteria | 3413 |
| 97 | Ga0466656_120776 | 3300042550 | Bacteria | 1113 |
| 98 | Ga0466693_374757 | 3300042592 | Bacteria | 2471 |
| 99 | Ga0123355_10000860 | 3300009826 | Bacteria | 41957 |
| 100 | Ga0123353_10004229 | 3300010167 | Bacteria | 18432 |
| 101 | Ga0123353_10006712 | 3300010167 | Bacteria | 15406 |
| 102 | Ga0123353_10035227 | 3300010167 | Unclassified | 7824 |
| 103 | Ga0123353_10845182 | 3300010167 | Bacteria | 1256 |
| 104 | Ga0466729_290625 | 3300042621 | Bacteria | 2998 |
| 105 | Ga0466735_229456 | 3300042624 | Bacteria | 8338 |
| 106 | Ga0466704_347241 | 3300042643 | Bacteria | 5479 |
| 107 | Ga0466727_062568 | 3300042655 | Bacteria | 1150 |
| 108 | Ga0068305_10036533 | 3300005083 | Bacteria | 46563 |
| 109 | Ga0072941_1440901 | 3300005201 | Bacteria | 2937 |
| 110 | Ga0466697_204158 | 3300042611 | Bacteria | 3660 |
| 111 | Ga0466701_073618 | 3300042598 | Bacteria | 2065 |
| 112 | Ga0466707_335717 | 3300042601 | Bacteria | 1600 |
| 113 | Ga0466698_338259 | 3300042610 | Bacteria | 1411 |
| 114 | Ga0466715_292125 | 3300042616 | Bacteria | 7456 |
| 115 | Ga0466657_034768 | 3300042582 | Bacteria | 1762 |
| 116 | Ga0466657_235385 | 3300042582 | Bacteria | 81858 |
| 117 | Ga0466657_264026 | 3300042582 | Bacteria | 11160 |
| 118 | Ga0466691_021707 | 3300042593 | Bacteria | 64874 |
| 119 | Ga0466691_159487 | 3300042593 | Bacteria | 59353 |
| 120 | Ga0123356_10052393 | 3300010049 | Bacteria | 3797 |
| 121 | Ga0123356_11018481 | 3300010049 | Bacteria | 998 |
| 122 | Ga0123353_10083453 | 3300010167 | Bacteria | 5141 |
| 123 | Ga0123353_10243786 | 3300010167 | Bacteria | 2790 |
| 124 | Ga0466735_074527 | 3300042624 | Bacteria | 4658 |
| 125 | Ga0466704_284718 | 3300042643 | Bacteria | 35033 |
| 126 | Ga0466708_069381 | 3300042652 | Bacteria | 17026 |
| 127 | Ga0466708_097434 | 3300042652 | Bacteria | 13111 |
| 128 | 2227619072 | 2225789004 | Bacteria | 11846 |
| 129 | IMNBL1DRAFT_c0008811 | 3300000062 | Bacteria | 5083 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042605 | Ga0466716_163513 | Ga0466716_163513_630_1403 | 233 |
| 2 | 3300042652 | Ga0466708_097434 | Ga0466708_097434_5658_6431 | 234 |
| 3 | 3300042611 | Ga0466697_166414 | Ga0466697_166414_43_981 | 259 |
| 4 | 3300042594 | Ga0466694_126624 | Ga0466694_126624_68_934 | 262 |
| 5 | 3300042610 | Ga0466698_338259 | Ga0466698_338259_533_1390 | 263 |
| 6 | 3300010167 | Ga0123353_10156265 | Ga0123353_101562652 | 265 |
| 7 | 3300005201 | Ga0072941_1440901 | Ga0072941_14409012 | 266 |
| 8 | 3300010049 | Ga0123356_11018481 | Ga0123356_110184811 | 266 |
| 9 | 3300010167 | Ga0123353_10025466 | Ga0123353_100254669 | 266 |
| 10 | 3300042593 | Ga0466691_159487 | Ga0466691_159487_15276_16124 | 266 |
| 11 | 3300042598 | Ga0466701_103398 | Ga0466701_103398_94_987 | 266 |
| 12 | 3300010167 | Ga0123353_10035227 | Ga0123353_100352278 | 267 |
| 13 | 3300042608 | Ga0466721_165783 | Ga0466721_165783_5295_6197 | 267 |
| 14 | 3300042615 | Ga0466711_281817 | Ga0466711_281817_3934_4800 | 267 |
| 15 | 3300009826 | Ga0123355_10000860 | Ga0123355_1000086024 | 269 |
| 16 | 3300042614 | Ga0466712_253796 | Ga0466712_253796_85_1044 | 269 |
| 17 | 3300010167 | Ga0123353_10003630 | Ga0123353_100036302 | 270 |
| 18 | 3300010167 | Ga0123353_10845182 | Ga0123353_108451822 | 271 |
| 19 | 3300042550 | Ga0466656_186265 | Ga0466656_186265_33_923 | 272 |
| 20 | 3300042604 | Ga0466717_300151 | Ga0466717_300151_728_1660 | 272 |
| 21 | 3300042605 | Ga0466716_038967 | Ga0466716_038967_6177_7082 | 272 |
| 22 | 3300042592 | Ga0466693_180187 | Ga0466693_180187_558_1523 | 273 |
| 23 | 3300042595 | Ga0466695_382462 | Ga0466695_382462_13500_14450 | 273 |
| 24 | 3300009826 | Ga0123355_10010286 | Ga0123355_100102867 | 274 |
| 25 | 3300010882 | Ga0123354_10034525 | Ga0123354_100345256 | 274 |
| 26 | 3300010167 | Ga0123353_10869107 | Ga0123353_108691072 | 276 |
| 27 | 3300042592 | Ga0466693_374757 | Ga0466693_374757_17_973 | 278 |
| 28 | 2225789004 | 2227619072 | 2228196633 | 279 |
| 29 | 3300009784 | Ga0123357_10001449 | Ga0123357_1000144918 | 279 |
| 30 | 3300042624 | Ga0466735_074527 | Ga0466735_074527_1788_2750 | 279 |
| 31 | iso_pr_bacteria | 2820748953 | 2820749560 | 280 |
| 32 | 3300002462 | JGI24702J35022_10017958 | JGI24702J35022_100179583 | 281 |
| 33 | 3300042582 | Ga0466657_235385 | Ga0466657_235385_14249_15169 | 281 |
| 34 | 3300042596 | Ga0466696_033318 | Ga0466696_033318_11694_12632 | 281 |
| 35 | 3300042606 | Ga0466719_345884 | Ga0466719_345884_802_1761 | 281 |
| 36 | 2225789004 | 2227080794 | 2227454216 | 282 |
| 37 | 3300042656 | Ga0466732_352963 | Ga0466732_352963_1120_2034 | 282 |
| 38 | 3300042603 | Ga0466714_168628 | Ga0466714_168628_30327_31262 | 283 |
| 39 | 3300042604 | Ga0466717_163479 | Ga0466717_163479_673_1635 | 283 |
| 40 | 3300042606 | Ga0466719_359503 | Ga0466719_359503_765_1706 | 283 |
| 41 | 3300042611 | Ga0466697_204158 | Ga0466697_204158_1272_2162 | 283 |
| 42 | 3300002504 | JGI24705J35276_12221929 | JGI24705J35276_122219293 | 284 |
| 43 | 3300042598 | Ga0466701_073618 | Ga0466701_073618_890_1828 | 284 |
| 44 | 3300042601 | Ga0466707_410294 | Ga0466707_410294_2184_3152 | 284 |
| 45 | 3300042624 | Ga0466735_229456 | Ga0466735_229456_3335_4297 | 284 |
| 46 | 3300000062 | IMNBL1DRAFT_c0005054 | IMNBL1DRAFT_00050546 | 285 |
| 47 | 3300042601 | Ga0466707_335717 | Ga0466707_335717_145_1113 | 285 |
| 48 | 3300042603 | Ga0466714_125039 | Ga0466714_125039_5507_6439 | 285 |
| 49 | 3300042611 | Ga0466697_208590 | Ga0466697_208590_508_1395 | 285 |
| 50 | 3300042616 | Ga0466715_198701 | Ga0466715_198701_9671_10615 | 285 |
| 51 | 3300042582 | Ga0466657_078821 | Ga0466657_078821_2724_3662 | 286 |
| 52 | 3300007192 | Ga0103268_1000167 | Ga0103268_10001676 | 287 |
| 53 | 3300009826 | Ga0123355_10000859 | Ga0123355_1000085929 | 287 |
| 54 | 3300042611 | Ga0466697_154143 | Ga0466697_154143_533_1423 | 287 |
| 55 | 3300042656 | Ga0466732_089580 | Ga0466732_089580_63156_64091 | 287 |
| 56 | 3300007190 | Ga0103267_1000072 | Ga0103267_100007220 | 288 |
| 57 | 3300010167 | Ga0123353_10342180 | Ga0123353_103421803 | 288 |
| 58 | 3300042618 | Ga0466723_260257 | Ga0466723_260257_10560_11501 | 288 |
| 59 | 3300042656 | Ga0466732_345355 | Ga0466732_345355_836_1789 | 288 |
| 60 | 3300007190 | Ga0103267_1000035 | Ga0103267_100003523 | 289 |
| 61 | 3300007190 | Ga0103267_1000060 | Ga0103267_100006034 | 289 |
| 62 | 3300010167 | Ga0123353_10010198 | Ga0123353_1001019811 | 289 |
| 63 | 3300010167 | Ga0123353_10050518 | Ga0123353_100505184 | 289 |
| 64 | 3300042601 | Ga0466707_071825 | Ga0466707_071825_287_1252 | 289 |
| 65 | 3300042611 | Ga0466697_189655 | Ga0466697_189655_251_1204 | 289 |
| 66 | 3300042613 | Ga0466710_088391 | Ga0466710_088391_2732_3601 | 289 |
| 67 | 3300042621 | Ga0466729_165434 | Ga0466729_165434_1806_2768 | 290 |
| 68 | 3300042624 | Ga0466735_085652 | Ga0466735_085652_1357_2322 | 290 |
| 69 | 3300042649 | Ga0466724_60142 | Ga0466724_60142_23_895 | 290 |
| 70 | 3300010167 | Ga0123353_10161637 | Ga0123353_101616374 | 291 |
| 71 | 3300042603 | Ga0466714_142273 | Ga0466714_142273_1276_2238 | 291 |
| 72 | 3300042610 | Ga0466698_492435 | Ga0466698_492435_768_1703 | 291 |
| 73 | 3300042582 | Ga0466657_264026 | Ga0466657_264026_8153_9085 | 292 |
| 74 | 3300042603 | Ga0466714_072816 | Ga0466714_072816_4912_5877 | 292 |
| 75 | 3300042655 | Ga0466727_062568 | Ga0466727_062568_22_990 | 292 |
| 76 | 2225789004 | 2227178027 | 2227594772 | 293 |
| 77 | 3300010882 | Ga0123354_10130452 | Ga0123354_101304523 | 293 |
| 78 | 3300010882 | Ga0123354_10216235 | Ga0123354_102162352 | 293 |
| 79 | 3300042593 | Ga0466691_021707 | Ga0466691_021707_21420_22370 | 293 |
| 80 | 3300042601 | Ga0466707_334151 | Ga0466707_334151_3330_4298 | 293 |
| 81 | 3300042621 | Ga0466729_290625 | Ga0466729_290625_1622_2590 | 293 |
| 82 | 3300010167 | Ga0123353_10083453 | Ga0123353_100834534 | 294 |
| 83 | 3300010167 | Ga0123353_10193338 | Ga0123353_101933382 | 294 |
| 84 | 3300042599 | Ga0466706_128456 | Ga0466706_128456_5834_6802 | 295 |
| 85 | 3300042649 | Ga0466724_33289 | Ga0466724_33289_234_1178 | 295 |
| 86 | 3300042654 | Ga0466725_342616 | Ga0466725_342616_706_1662 | 295 |
| 87 | 3300042656 | Ga0466732_404712 | Ga0466732_404712_4251_5195 | 295 |
| 88 | 3300000062 | IMNBL1DRAFT_c0033211 | IMNBL1DRAFT_00332112 | 296 |
| 89 | 3300042606 | Ga0466719_165624 | Ga0466719_165624_1595_2560 | 296 |
| 90 | 3300042624 | Ga0466735_148442 | Ga0466735_148442_613_1581 | 296 |
| 91 | 3300042643 | Ga0466704_284718 | Ga0466704_284718_22881_23867 | 296 |
| 92 | 3300042596 | Ga0466696_097317 | Ga0466696_097317_1403_2350 | 297 |
| 93 | 3300042611 | Ga0466697_029141 | Ga0466697_029141_1762_2694 | 297 |
| 94 | 3300042616 | Ga0466715_292125 | Ga0466715_292125_1642_2607 | 297 |
| 95 | 3300042648 | Ga0466709_308531 | Ga0466709_308531_43214_44173 | 297 |
| 96 | 3300042654 | Ga0466725_264121 | Ga0466725_264121_1295_2311 | 297 |
| 97 | 3300000062 | IMNBL1DRAFT_c0008811 | IMNBL1DRAFT_00088114 | 298 |
| 98 | 3300010049 | Ga0123356_10717132 | Ga0123356_107171322 | 298 |
| 99 | 3300010167 | Ga0123353_10004229 | Ga0123353_1000422912 | 298 |
| 100 | 3300042599 | Ga0466706_233547 | Ga0466706_233547_50_982 | 298 |
| 101 | 3300042603 | Ga0466714_048239 | Ga0466714_048239_43872_44819 | 298 |
| 102 | 3300042616 | Ga0466715_439245 | Ga0466715_439245_13268_14164 | 298 |
| 103 | 3300042643 | Ga0466704_347241 | Ga0466704_347241_744_1694 | 298 |
| 104 | 3300005201 | Ga0072941_1567811 | Ga0072941_15678113 | 299 |
| 105 | 3300042615 | Ga0466711_038817 | Ga0466711_038817_1050_2000 | 299 |
| 106 | 3300042648 | Ga0466709_365874 | Ga0466709_365874_326_1318 | 299 |
| 107 | 3300042582 | Ga0466657_034768 | Ga0466657_034768_61_1029 | 300 |
| 108 | 3300042613 | Ga0466710_004099 | Ga0466710_004099_77_1237 | 300 |
| 109 | 3300042636 | Ga0466703_416796 | Ga0466703_416796_507_1490 | 300 |
| 110 | 3300000062 | IMNBL1DRAFT_c0000660 | IMNBL1DRAFT_00006608 | 301 |
| 111 | 3300000062 | IMNBL1DRAFT_c0021567 | IMNBL1DRAFT_00215674 | 301 |
| 112 | 3300042606 | Ga0466719_079329 | Ga0466719_079329_67_1053 | 301 |
| 113 | 3300042652 | Ga0466708_069381 | Ga0466708_069381_14969_15934 | 302 |
| 114 | 3300042598 | Ga0466701_000734 | Ga0466701_000734_754_1686 | 303 |
| 115 | 3300010167 | Ga0123353_10006712 | Ga0123353_100067126 | 304 |
| 116 | 3300042618 | Ga0466723_149675 | Ga0466723_149675_2907_3881 | 304 |
| 117 | 3300042550 | Ga0466656_120776 | Ga0466656_120776_107_1075 | 305 |
| 118 | 3300042615 | Ga0466711_246046 | Ga0466711_246046_369_1340 | 305 |
| 119 | 3300042603 | Ga0466714_138101 | Ga0466714_138101_3707_4675 | 306 |
| 120 | 3300002462 | JGI24702J35022_10005772 | JGI24702J35022_100057725 | 307 |
| 121 | 3300005083 | Ga0068305_10036533 | Ga0068305_1003653315 | 307 |
| 122 | 3300042615 | Ga0466711_245146 | Ga0466711_245146_369_1340 | 307 |
| 123 | 3300010167 | Ga0123353_10001310 | Ga0123353_1000131017 | 308 |
| 124 | 3300042659 | Ga0466733_069726 | Ga0466733_069726_15927_16892 | 308 |
| 125 | iso_pr_bacteria | 2820789850 | 2820792637 | 310 |
| 126 | iso_pr_bacteria | 2820792843 | 2820792847 | 310 |
| 127 | iso_pr_bacteria | 2820795054 | 2820796301 | 310 |
| 128 | iso_pr_bacteria | 2820753519 | 2820753988 | 311 |
| 129 | iso_pr_bacteria | 2820755292 | 2820756403 | 311 |
| 130 | 3300010167 | Ga0123353_10243786 | Ga0123353_102437864 | 314 |
| 131 | 3300042590 | Ga0466690_024348 | Ga0466690_024348_14381_15334 | 317 |
| 132 | 3300042591 | Ga0466692_157631 | Ga0466692_157631_38003_39013 | 317 |
| 133 | iso_pr_bacteria | 2820772500 | 2820772955 | 317 |
| 134 | iso_pr_bacteria | 2820781750 | 2820782880 | 317 |
| 135 | 3300010049 | Ga0123356_10019444 | Ga0123356_100194444 | 318 |
| 136 | 3300010167 | Ga0123353_10226864 | Ga0123353_102268643 | 318 |
| 137 | iso_pr_bacteria | 2820770630 | 2820772058 | 318 |
| 138 | iso_pr_bacteria | 2820746860 | 2820748369 | 320 |
| 139 | 3300010049 | Ga0123356_10052393 | Ga0123356_100523933 | 322 |
| 140 | iso_pr_bacteria | 2820786992 | 2820787109 | 323 |
| 141 | iso_pr_bacteria | 2820785563 | 2820786641 | 324 |
| 142 | iso_pr_bacteria | 2820788205 | 2820789116 | 325 |
Functional Annotation
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.72 | 0.76 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.