Protein Family IF12163

Metagenome Isolate
142 Members
61 Samples
129 Scaffolds
290.6 Avg Length

🧬 Representative Sequence

ID
iso_pr_bacteria|2820788205|2820789116|
Length
325 aa
Sequence
MAYVGILTQQRRNNFRSTILLLLFPVLVLVLSYVVYLFAHAHKIQEAGLSWFDAFFLKDFLANVAPFVIGGVAIWFLIAYWGNTTIINNAVHSKPLERKENMRVYNLVENLCMQSGMKMPRVNVIQDNSLNAFASGINEKTYTVTLTTGIIQKLNDQELEGVIAHELMHIKNRDVRLLIISIVFVGIFAFISQIALRMLFFSNMSGGRSSGGGGNRGGGGQALMWLVVIAVAAVGYFFTILMKFAISRKREYMADAGAAEMTRNPHALASALRKISGNPNVDAITREDVAQLFIEHPIAKKKTFMSTLFATHPPIEKRIAVLEAF

📊 Sample Types

Isolate 9.2%
Metagenome 90.8%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 40.0%
Unclassified 25.0%
Kalotermitidae 20.0%
Passalidae 3.3%
Termopsidae 3.3%
Formicidae 3.3%
Rhinotermitidae 3.3%
Hodotermitidae 1.7%

🌳 Taxonomy

Archaea 0
Bacteria 138
Eukaryota 0
Viruses 0
Unclassified 4

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820786992 Unclassified Bacteroidetes Emb289P1bin66 Isolate Unclassified
2 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
3 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
4 2820795054 Unclassified Bacteroidetes Cu122P1bin21 Isolate Unclassified
5 2820748953 Unclassified Bacteroidetes Nt197P4bin17 Isolate Unclassified
6 2820755292 Unclassified Bacteroidetes Nc150P3bin3 Isolate Unclassified
7 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
8 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
9 2820781750 Unclassified Bacteroidetes Emb289P3bin89 Isolate Unclassified
10 2820789850 Unclassified Bacteroidetes Cu122P3bin3 Isolate Unclassified
11 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
12 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
13 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
14 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
15 2820772500 Unclassified Bacteroidetes Lab288P1bin72 Isolate Unclassified
16 2820785563 Unclassified Bacteroidetes Emb289P1bin74 Isolate Unclassified
17 2820792843 Unclassified Bacteroidetes Cu122P3bin1 Isolate Unclassified
18 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
19 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
20 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
21 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
22 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
23 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
24 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
25 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
26 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
27 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
28 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
29 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
30 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
31 2820753519 Unclassified Bacteroidetes Nc150P4bin20 Isolate Unclassified
32 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
33 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
34 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
35 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
36 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
37 2820770630 Unclassified Bacteroidetes Lab288P3bin130 Isolate Unclassified
38 2820746860 Unclassified Bacteroidetes Th196P3bin126 Isolate Unclassified
39 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
40 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
41 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
42 3300007190 Ant gut microbial communities from Cephalotes umbraculatus, Peru Metagenome Formicidae
43 3300007192 Ant gut microbial communities from Cephalotes persimplex, Brazil Metagenome Formicidae
44 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
45 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
46 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
47 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
48 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
49 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
50 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
51 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
52 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
53 2820788205 Unclassified Bacteroidetes Emb289P1bin57 Isolate Unclassified
54 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
55 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
56 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
57 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
58 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
59 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
60 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
61 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466714_125039 3300042603 Bacteria 7321
2 Ga0466716_163513 3300042605 Bacteria 2669
3 Ga0466697_029141 3300042611 Bacteria 3178
4 Ga0466710_004099 3300042613 Bacteria 12802
5 Ga0466696_033318 3300042596 Bacteria 35735
6 Ga0123353_10156265 3300010167 Bacteria 3635
7 Ga0123353_10161637 3300010167 Bacteria 3565
8 Ga0123354_10034525 3300010882 Bacteria 7910
9 Ga0466724_33289 3300042649 Bacteria 3035
10 Ga0466724_60142 3300042649 Bacteria 1161
11 IMNBL1DRAFT_c0021567 3300000062 Bacteria 2574
12 JGI24705J35276_12221929 3300002504 Bacteria 2379
13 Ga0103268_1000167 3300007192 Bacteria 21704
14 Ga0123357_10001449 3300009784 Bacteria 25189
15 Ga0466697_166414 3300042611 Bacteria 1156
16 Ga0466732_345355 3300042656 Bacteria 2002
17 Ga0466706_128456 3300042599 Bacteria 14620
18 Ga0466714_168628 3300042603 Bacteria 36223
19 Ga0466696_097317 3300042596 Bacteria 3082
20 Ga0123355_10010286 3300009826 Bacteria 14314
21 Ga0123353_10003630 3300010167 Bacteria 19565
22 Ga0123353_10025466 3300010167 Bacteria 9016
23 Ga0123353_10342180 3300010167 Bacteria 2259
24 Ga0123353_10869107 3300010167 Bacteria 1233
25 Ga0466709_308531 3300042648 Bacteria 53963
26 Ga0466709_365874 3300042648 Bacteria 2270
27 Ga0466725_264121 3300042654 Bacteria 2531
28 Ga0103267_1000060 3300007190 Bacteria 45092
29 Ga0466732_352963 3300042656 Bacteria 4173
30 Ga0466701_103398 3300042598 Unclassified 1101
31 Ga0466707_410294 3300042601 Unclassified 4216
32 Ga0466711_245146 3300042615 Bacteria 2810
33 Ga0466723_149675 3300042618 Bacteria 4431
34 Ga0466694_126624 3300042594 Bacteria 1787
35 Ga0123355_10000859 3300009826 Bacteria 41957
36 Ga0123356_10717132 3300010049 Bacteria 1169
37 Ga0103267_1000035 3300007190 Bacteria 50564
38 Ga0466711_246046 3300042615 Bacteria 2808
39 Ga0466715_439245 3300042616 Bacteria 26781
40 Ga0466729_165434 3300042621 Bacteria 8860
41 Ga0466695_382462 3300042595 Bacteria 20417
42 Ga0123356_10019444 3300010049 Bacteria 6438
43 Ga0123353_10193338 3300010167 Bacteria 3209
44 Ga0123354_10216235 3300010882 Bacteria 2053
45 Ga0466735_085652 3300042624 Bacteria 4832
46 Ga0466703_416796 3300042636 Bacteria 12962
47 Ga0466725_342616 3300042654 Bacteria 2676
48 2227178027 2225789004 Bacteria 8097
49 JGI24702J35022_10005772 3300002462 Bacteria 7217
50 Ga0103267_1000072 3300007190 Bacteria 38062
51 Ga0466732_089580 3300042656 Bacteria 136356
52 Ga0466706_233547 3300042599 Bacteria 4128
53 Ga0466707_071825 3300042601 Bacteria 2249
54 Ga0466707_334151 3300042601 Bacteria 5990
55 Ga0466717_300151 3300042604 Bacteria 2057
56 Ga0466719_079329 3300042606 Bacteria 1288
57 Ga0466719_345884 3300042606 Bacteria 2722
58 Ga0466715_198701 3300042616 Bacteria 12046
59 Ga0466656_186265 3300042550 Bacteria 1054
60 Ga0466692_157631 3300042591 Bacteria 42163
61 Ga0466693_180187 3300042592 Bacteria 2516
62 Ga0123353_10001310 3300010167 Bacteria 30488
63 Ga0123353_10010198 3300010167 Bacteria 13072
64 Ga0123353_10050518 3300010167 Bacteria 6630
65 Ga0123353_10226864 3300010167 Unclassified 2915
66 Ga0466735_148442 3300042624 Bacteria 1593
67 IMNBL1DRAFT_c0005054 3300000062 Bacteria 7682
68 IMNBL1DRAFT_c0033211 3300000062 Bacteria 1850
69 Ga0072941_1567811 3300005201 Bacteria 1947
70 Ga0466697_154143 3300042611 Bacteria 1489
71 Ga0466697_189655 3300042611 Bacteria 2127
72 Ga0466697_208590 3300042611 Bacteria 3956
73 Ga0466732_404712 3300042656 Bacteria 7773
74 Ga0466714_072816 3300042603 Bacteria 12417
75 Ga0466714_142273 3300042603 Bacteria 2529
76 Ga0466719_165624 3300042606 Bacteria 2612
77 Ga0466719_359503 3300042606 Bacteria 2097
78 Ga0466710_088391 3300042613 Bacteria 4346
79 Ga0466712_253796 3300042614 Bacteria 1869
80 Ga0466711_281817 3300042615 Bacteria 6059
81 Ga0466723_260257 3300042618 Bacteria 17300
82 Ga0466657_078821 3300042582 Bacteria 6559
83 Ga0466690_024348 3300042590 Bacteria 16349
84 Ga0466701_000734 3300042598 Bacteria 2774
85 Ga0123354_10130452 3300010882 Bacteria 3178
86 2227080794 2225789004 Bacteria 41653
87 IMNBL1DRAFT_c0000660 3300000062 Bacteria 27588
88 JGI24702J35022_10017958 3300002462 Bacteria 3861
89 Ga0466733_069726 3300042659 Bacteria 17627
90 Ga0466714_048239 3300042603 Bacteria 109405
91 Ga0466714_138101 3300042603 Bacteria 7977
92 Ga0466717_163479 3300042604 Bacteria 2096
93 Ga0466716_038967 3300042605 Bacteria 9075
94 Ga0466721_165783 3300042608 Bacteria 6234
95 Ga0466698_492435 3300042610 Bacteria 3136
96 Ga0466711_038817 3300042615 Bacteria 3413
97 Ga0466656_120776 3300042550 Bacteria 1113
98 Ga0466693_374757 3300042592 Bacteria 2471
99 Ga0123355_10000860 3300009826 Bacteria 41957
100 Ga0123353_10004229 3300010167 Bacteria 18432
101 Ga0123353_10006712 3300010167 Bacteria 15406
102 Ga0123353_10035227 3300010167 Unclassified 7824
103 Ga0123353_10845182 3300010167 Bacteria 1256
104 Ga0466729_290625 3300042621 Bacteria 2998
105 Ga0466735_229456 3300042624 Bacteria 8338
106 Ga0466704_347241 3300042643 Bacteria 5479
107 Ga0466727_062568 3300042655 Bacteria 1150
108 Ga0068305_10036533 3300005083 Bacteria 46563
109 Ga0072941_1440901 3300005201 Bacteria 2937
110 Ga0466697_204158 3300042611 Bacteria 3660
111 Ga0466701_073618 3300042598 Bacteria 2065
112 Ga0466707_335717 3300042601 Bacteria 1600
113 Ga0466698_338259 3300042610 Bacteria 1411
114 Ga0466715_292125 3300042616 Bacteria 7456
115 Ga0466657_034768 3300042582 Bacteria 1762
116 Ga0466657_235385 3300042582 Bacteria 81858
117 Ga0466657_264026 3300042582 Bacteria 11160
118 Ga0466691_021707 3300042593 Bacteria 64874
119 Ga0466691_159487 3300042593 Bacteria 59353
120 Ga0123356_10052393 3300010049 Bacteria 3797
121 Ga0123356_11018481 3300010049 Bacteria 998
122 Ga0123353_10083453 3300010167 Bacteria 5141
123 Ga0123353_10243786 3300010167 Bacteria 2790
124 Ga0466735_074527 3300042624 Bacteria 4658
125 Ga0466704_284718 3300042643 Bacteria 35033
126 Ga0466708_069381 3300042652 Bacteria 17026
127 Ga0466708_097434 3300042652 Bacteria 13111
128 2227619072 2225789004 Bacteria 11846
129 IMNBL1DRAFT_c0008811 3300000062 Bacteria 5083

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042605 Ga0466716_163513 Ga0466716_163513_630_1403 233
2 3300042652 Ga0466708_097434 Ga0466708_097434_5658_6431 234
3 3300042611 Ga0466697_166414 Ga0466697_166414_43_981 259
4 3300042594 Ga0466694_126624 Ga0466694_126624_68_934 262
5 3300042610 Ga0466698_338259 Ga0466698_338259_533_1390 263
6 3300010167 Ga0123353_10156265 Ga0123353_101562652 265
7 3300005201 Ga0072941_1440901 Ga0072941_14409012 266
8 3300010049 Ga0123356_11018481 Ga0123356_110184811 266
9 3300010167 Ga0123353_10025466 Ga0123353_100254669 266
10 3300042593 Ga0466691_159487 Ga0466691_159487_15276_16124 266
11 3300042598 Ga0466701_103398 Ga0466701_103398_94_987 266
12 3300010167 Ga0123353_10035227 Ga0123353_100352278 267
13 3300042608 Ga0466721_165783 Ga0466721_165783_5295_6197 267
14 3300042615 Ga0466711_281817 Ga0466711_281817_3934_4800 267
15 3300009826 Ga0123355_10000860 Ga0123355_1000086024 269
16 3300042614 Ga0466712_253796 Ga0466712_253796_85_1044 269
17 3300010167 Ga0123353_10003630 Ga0123353_100036302 270
18 3300010167 Ga0123353_10845182 Ga0123353_108451822 271
19 3300042550 Ga0466656_186265 Ga0466656_186265_33_923 272
20 3300042604 Ga0466717_300151 Ga0466717_300151_728_1660 272
21 3300042605 Ga0466716_038967 Ga0466716_038967_6177_7082 272
22 3300042592 Ga0466693_180187 Ga0466693_180187_558_1523 273
23 3300042595 Ga0466695_382462 Ga0466695_382462_13500_14450 273
24 3300009826 Ga0123355_10010286 Ga0123355_100102867 274
25 3300010882 Ga0123354_10034525 Ga0123354_100345256 274
26 3300010167 Ga0123353_10869107 Ga0123353_108691072 276
27 3300042592 Ga0466693_374757 Ga0466693_374757_17_973 278
28 2225789004 2227619072 2228196633 279
29 3300009784 Ga0123357_10001449 Ga0123357_1000144918 279
30 3300042624 Ga0466735_074527 Ga0466735_074527_1788_2750 279
31 iso_pr_bacteria 2820748953 2820749560 280
32 3300002462 JGI24702J35022_10017958 JGI24702J35022_100179583 281
33 3300042582 Ga0466657_235385 Ga0466657_235385_14249_15169 281
34 3300042596 Ga0466696_033318 Ga0466696_033318_11694_12632 281
35 3300042606 Ga0466719_345884 Ga0466719_345884_802_1761 281
36 2225789004 2227080794 2227454216 282
37 3300042656 Ga0466732_352963 Ga0466732_352963_1120_2034 282
38 3300042603 Ga0466714_168628 Ga0466714_168628_30327_31262 283
39 3300042604 Ga0466717_163479 Ga0466717_163479_673_1635 283
40 3300042606 Ga0466719_359503 Ga0466719_359503_765_1706 283
41 3300042611 Ga0466697_204158 Ga0466697_204158_1272_2162 283
42 3300002504 JGI24705J35276_12221929 JGI24705J35276_122219293 284
43 3300042598 Ga0466701_073618 Ga0466701_073618_890_1828 284
44 3300042601 Ga0466707_410294 Ga0466707_410294_2184_3152 284
45 3300042624 Ga0466735_229456 Ga0466735_229456_3335_4297 284
46 3300000062 IMNBL1DRAFT_c0005054 IMNBL1DRAFT_00050546 285
47 3300042601 Ga0466707_335717 Ga0466707_335717_145_1113 285
48 3300042603 Ga0466714_125039 Ga0466714_125039_5507_6439 285
49 3300042611 Ga0466697_208590 Ga0466697_208590_508_1395 285
50 3300042616 Ga0466715_198701 Ga0466715_198701_9671_10615 285
51 3300042582 Ga0466657_078821 Ga0466657_078821_2724_3662 286
52 3300007192 Ga0103268_1000167 Ga0103268_10001676 287
53 3300009826 Ga0123355_10000859 Ga0123355_1000085929 287
54 3300042611 Ga0466697_154143 Ga0466697_154143_533_1423 287
55 3300042656 Ga0466732_089580 Ga0466732_089580_63156_64091 287
56 3300007190 Ga0103267_1000072 Ga0103267_100007220 288
57 3300010167 Ga0123353_10342180 Ga0123353_103421803 288
58 3300042618 Ga0466723_260257 Ga0466723_260257_10560_11501 288
59 3300042656 Ga0466732_345355 Ga0466732_345355_836_1789 288
60 3300007190 Ga0103267_1000035 Ga0103267_100003523 289
61 3300007190 Ga0103267_1000060 Ga0103267_100006034 289
62 3300010167 Ga0123353_10010198 Ga0123353_1001019811 289
63 3300010167 Ga0123353_10050518 Ga0123353_100505184 289
64 3300042601 Ga0466707_071825 Ga0466707_071825_287_1252 289
65 3300042611 Ga0466697_189655 Ga0466697_189655_251_1204 289
66 3300042613 Ga0466710_088391 Ga0466710_088391_2732_3601 289
67 3300042621 Ga0466729_165434 Ga0466729_165434_1806_2768 290
68 3300042624 Ga0466735_085652 Ga0466735_085652_1357_2322 290
69 3300042649 Ga0466724_60142 Ga0466724_60142_23_895 290
70 3300010167 Ga0123353_10161637 Ga0123353_101616374 291
71 3300042603 Ga0466714_142273 Ga0466714_142273_1276_2238 291
72 3300042610 Ga0466698_492435 Ga0466698_492435_768_1703 291
73 3300042582 Ga0466657_264026 Ga0466657_264026_8153_9085 292
74 3300042603 Ga0466714_072816 Ga0466714_072816_4912_5877 292
75 3300042655 Ga0466727_062568 Ga0466727_062568_22_990 292
76 2225789004 2227178027 2227594772 293
77 3300010882 Ga0123354_10130452 Ga0123354_101304523 293
78 3300010882 Ga0123354_10216235 Ga0123354_102162352 293
79 3300042593 Ga0466691_021707 Ga0466691_021707_21420_22370 293
80 3300042601 Ga0466707_334151 Ga0466707_334151_3330_4298 293
81 3300042621 Ga0466729_290625 Ga0466729_290625_1622_2590 293
82 3300010167 Ga0123353_10083453 Ga0123353_100834534 294
83 3300010167 Ga0123353_10193338 Ga0123353_101933382 294
84 3300042599 Ga0466706_128456 Ga0466706_128456_5834_6802 295
85 3300042649 Ga0466724_33289 Ga0466724_33289_234_1178 295
86 3300042654 Ga0466725_342616 Ga0466725_342616_706_1662 295
87 3300042656 Ga0466732_404712 Ga0466732_404712_4251_5195 295
88 3300000062 IMNBL1DRAFT_c0033211 IMNBL1DRAFT_00332112 296
89 3300042606 Ga0466719_165624 Ga0466719_165624_1595_2560 296
90 3300042624 Ga0466735_148442 Ga0466735_148442_613_1581 296
91 3300042643 Ga0466704_284718 Ga0466704_284718_22881_23867 296
92 3300042596 Ga0466696_097317 Ga0466696_097317_1403_2350 297
93 3300042611 Ga0466697_029141 Ga0466697_029141_1762_2694 297
94 3300042616 Ga0466715_292125 Ga0466715_292125_1642_2607 297
95 3300042648 Ga0466709_308531 Ga0466709_308531_43214_44173 297
96 3300042654 Ga0466725_264121 Ga0466725_264121_1295_2311 297
97 3300000062 IMNBL1DRAFT_c0008811 IMNBL1DRAFT_00088114 298
98 3300010049 Ga0123356_10717132 Ga0123356_107171322 298
99 3300010167 Ga0123353_10004229 Ga0123353_1000422912 298
100 3300042599 Ga0466706_233547 Ga0466706_233547_50_982 298
101 3300042603 Ga0466714_048239 Ga0466714_048239_43872_44819 298
102 3300042616 Ga0466715_439245 Ga0466715_439245_13268_14164 298
103 3300042643 Ga0466704_347241 Ga0466704_347241_744_1694 298
104 3300005201 Ga0072941_1567811 Ga0072941_15678113 299
105 3300042615 Ga0466711_038817 Ga0466711_038817_1050_2000 299
106 3300042648 Ga0466709_365874 Ga0466709_365874_326_1318 299
107 3300042582 Ga0466657_034768 Ga0466657_034768_61_1029 300
108 3300042613 Ga0466710_004099 Ga0466710_004099_77_1237 300
109 3300042636 Ga0466703_416796 Ga0466703_416796_507_1490 300
110 3300000062 IMNBL1DRAFT_c0000660 IMNBL1DRAFT_00006608 301
111 3300000062 IMNBL1DRAFT_c0021567 IMNBL1DRAFT_00215674 301
112 3300042606 Ga0466719_079329 Ga0466719_079329_67_1053 301
113 3300042652 Ga0466708_069381 Ga0466708_069381_14969_15934 302
114 3300042598 Ga0466701_000734 Ga0466701_000734_754_1686 303
115 3300010167 Ga0123353_10006712 Ga0123353_100067126 304
116 3300042618 Ga0466723_149675 Ga0466723_149675_2907_3881 304
117 3300042550 Ga0466656_120776 Ga0466656_120776_107_1075 305
118 3300042615 Ga0466711_246046 Ga0466711_246046_369_1340 305
119 3300042603 Ga0466714_138101 Ga0466714_138101_3707_4675 306
120 3300002462 JGI24702J35022_10005772 JGI24702J35022_100057725 307
121 3300005083 Ga0068305_10036533 Ga0068305_1003653315 307
122 3300042615 Ga0466711_245146 Ga0466711_245146_369_1340 307
123 3300010167 Ga0123353_10001310 Ga0123353_1000131017 308
124 3300042659 Ga0466733_069726 Ga0466733_069726_15927_16892 308
125 iso_pr_bacteria 2820789850 2820792637 310
126 iso_pr_bacteria 2820792843 2820792847 310
127 iso_pr_bacteria 2820795054 2820796301 310
128 iso_pr_bacteria 2820753519 2820753988 311
129 iso_pr_bacteria 2820755292 2820756403 311
130 3300010167 Ga0123353_10243786 Ga0123353_102437864 314
131 3300042590 Ga0466690_024348 Ga0466690_024348_14381_15334 317
132 3300042591 Ga0466692_157631 Ga0466692_157631_38003_39013 317
133 iso_pr_bacteria 2820772500 2820772955 317
134 iso_pr_bacteria 2820781750 2820782880 317
135 3300010049 Ga0123356_10019444 Ga0123356_100194444 318
136 3300010167 Ga0123353_10226864 Ga0123353_102268643 318
137 iso_pr_bacteria 2820770630 2820772058 318
138 iso_pr_bacteria 2820746860 2820748369 320
139 3300010049 Ga0123356_10052393 Ga0123356_100523933 322
140 iso_pr_bacteria 2820786992 2820787109 323
141 iso_pr_bacteria 2820785563 2820786641 324
142 iso_pr_bacteria 2820788205 2820789116 325

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01435 Peptidase_M48 Peptidase family M48 100 323 0.85
PF05569 Peptidase_M56 BlaR1 peptidase M56 143 190 0.8

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.72 0.76 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.