Protein Family IF12152

Metagenome Isolate
130 Members
47 Samples
122 Scaffolds
400.95 Avg Length

🧬 Representative Sequence

ID
iso_pr_bacteria|2820744581|2820746848|
Length
456 aa
Sequence
MKKCFLLMIAVMMFYSCSQKVQENAQWRGENRDGVYHETGLLKEWAAGGPQLLWSFEGLGEGFSSVAVANGKVYVAGMPDDDDLVLFVFDTSGKLLNRKVVGKEWNTSFPGSRCSPLIHEGKLYLGNSLGQLFCLDEATLDEIWKIDAIRDFDGRNIMFGVTENPLIVGDKIFWTPGGVNNNMLALNKDTGELIWSSTGTGTLSTYCSPMFIDGYSVPMVITYMAAEQQQDMGGPGGGFGGPPPGAPGPGGQGGRPGGLGGGGGPGGGPPAARPMQENKLVAFNANTGEVIWTHTQPSGNTINPNTPIYSNGHIFTSTGYGGGSWLLRLIDGGRNVEQVWHNIADNQHHGPVKVGDYVYTTAQTNRGFHCINWKTGETMFRENNHAQGVVIYADGMIYCYDDRGFVSLIKPTTDRFEVVSSFEITLGTNQHWAHPVIRDGVLYIRHGDALMAYKIK

📊 Sample Types

Isolate 3.9%
Metagenome 96.2%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 48.9%
Kalotermitidae 19.1%
Unclassified 12.8%
Rhinotermitidae 6.4%
Termopsidae 6.4%
Passalidae 4.3%
Hodotermitidae 2.1%

🌳 Taxonomy

Archaea 0
Bacteria 121
Eukaryota 0
Viruses 0
Unclassified 9

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820788205 Unclassified Bacteroidetes Emb289P1bin57 Isolate Unclassified
2 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
3 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
4 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
5 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
6 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
7 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
8 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
9 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
10 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
11 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
12 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
13 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
14 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
15 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
16 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
17 2820746860 Unclassified Bacteroidetes Th196P3bin126 Isolate Unclassified
18 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
19 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
20 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
21 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
22 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
23 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
24 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
25 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
26 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
27 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
28 2820781750 Unclassified Bacteroidetes Emb289P3bin89 Isolate Unclassified
29 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
30 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
31 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
32 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
33 2820767225 Unclassified Bacteroidetes Lab288P3bin34 Isolate Unclassified
34 2820744581 Unclassified Bacteroidetes Th196P3bin138 Isolate Unclassified
35 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
36 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
37 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
38 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
39 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
40 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
41 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
42 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
43 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
44 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
45 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
46 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
47 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466700_452825 3300042600 Bacteria 2890
2 Ga0123353_10006551 3300010167 Bacteria 15523
3 Ga0123353_10357369 3300010167 Bacteria 2197
4 Ga0466657_190877 3300042582 Bacteria 1803
5 Ga0466703_311342 3300042636 Bacteria 9501
6 Ga0466709_007878 3300042648 Bacteria 27583
7 2227153021 2225789004 Bacteria 8525
8 Ga0466729_001938 3300042621 Bacteria 30694
9 Ga0466706_032989 3300042599 Bacteria 1914
10 Ga0123355_10000223 3300009826 Bacteria 71620
11 Ga0123356_10082615 3300010049 Bacteria 3042
12 Ga0123356_10223172 3300010049 Bacteria 1942
13 Ga0123354_10139768 3300010882 Bacteria 3003
14 Ga0466733_017527 3300042659 Bacteria 9196
15 Ga0466657_171011 3300042582 Bacteria 10313
16 Ga0466709_136607 3300042648 Bacteria 19456
17 Ga0466708_000881 3300042652 Bacteria 14731
18 Ga0466718_151193 3300042617 Bacteria 1791
19 Ga0466700_241730 3300042600 Bacteria 13617
20 Ga0466700_489296 3300042600 Bacteria 3077
21 Ga0466714_092220 3300042603 Bacteria 69067
22 Ga0466716_035836 3300042605 Bacteria 6905
23 Ga0466716_495785 3300042605 Bacteria 9655
24 Ga0466722_037159 3300042609 Bacteria 4216
25 Ga0123355_10035710 3300009826 Unclassified 8080
26 Ga0123353_10012897 3300010167 Bacteria 11925
27 Ga0123353_10055046 3300010167 Bacteria 6362
28 Ga0123354_10259554 3300010882 Bacteria 1739
29 Ga0123354_10300751 3300010882 Bacteria 1518
30 Ga0466657_261521 3300042582 Bacteria 3938
31 Ga0466695_000941 3300042595 Bacteria 8780
32 Ga0466696_161473 3300042596 Bacteria 25807
33 2227632951 2225789004 Bacteria 11318
34 IMNBL1DRAFT_c0003908 3300000062 Bacteria 9230
35 JGI24702J35022_10010405 3300002462 Bacteria 5198
36 JGI24702J35022_10050151 3300002462 Unclassified 2223
37 Ga0466710_081215 3300042613 Unclassified 1469
38 Ga0466701_034474 3300042598 Bacteria 3067
39 Ga0466714_055553 3300042603 Bacteria 9474
40 Ga0466722_181839 3300042609 Bacteria 5306
41 Ga0123356_10024551 3300010049 Unclassified 5671
42 Ga0123353_10108000 3300010167 Bacteria 4485
43 Ga0123353_10324425 3300010167 Bacteria 2335
44 Ga0123353_10552339 3300010167 Bacteria 1661
45 Ga0466733_111953 3300042659 Unclassified 2627
46 Ga0466656_255799 3300042550 Bacteria 11450
47 Ga0466691_083787 3300042593 Bacteria 17745
48 Ga0466725_277592 3300042654 Bacteria 6551
49 IMNBL1DRAFT_c0000723 3300000062 Bacteria 26182
50 IMNBL1DRAFT_c0024491 3300000062 Bacteria 2339
51 Ga0466710_128980 3300042613 Bacteria 16866
52 Ga0466700_031678 3300042600 Bacteria 10420
53 Ga0466722_191964 3300042609 Bacteria 2354
54 Ga0466722_210653 3300042609 Bacteria 14336
55 Ga0123353_10000490 3300010167 Bacteria 48867
56 Ga0123353_10235643 3300010167 Bacteria 2849
57 Ga0123354_10103090 3300010882 Bacteria 3839
58 Ga0466697_139692 3300042611 Bacteria 246544
59 Ga0466656_302559 3300042550 Bacteria 5732
60 Ga0466690_010061 3300042590 Bacteria 20480
61 Ga0466693_269738 3300042592 Bacteria 2150
62 Ga0466695_248372 3300042595 Bacteria 6392
63 Ga0466731_045040 3300042622 Bacteria 6317
64 Ga0466731_278919 3300042622 Bacteria 1565
65 Ga0466735_180334 3300042624 Bacteria 1489
66 Ga0466708_172855 3300042652 Bacteria 2580
67 2227573522 2225789004 Bacteria 2590
68 JGI24702J35022_10005275 3300002462 Bacteria 7579
69 Ga0068302_10243383 3300005071 Unclassified 1780
70 Ga0466711_267834 3300042615 Bacteria 3491
71 Ga0466700_156172 3300042600 Bacteria 109805
72 Ga0466707_222820 3300042601 Bacteria 15913
73 Ga0123356_10042745 3300010049 Bacteria 4219
74 Ga0123356_10046340 3300010049 Bacteria 4045
75 Ga0123356_10140289 3300010049 Unclassified 2383
76 Ga0123356_10153291 3300010049 Bacteria 2291
77 Ga0123356_10388647 3300010049 Bacteria 1530
78 Ga0123353_10191105 3300010167 Bacteria 3231
79 Ga0123353_10703252 3300010167 Bacteria 1418
80 Ga0466697_087784 3300042611 Bacteria 15141
81 Ga0466657_165814 3300042582 Bacteria 4692
82 Ga0466657_349967 3300042582 Bacteria 5743
83 Ga0466696_058212 3300042596 Bacteria 2732
84 Ga0466701_001783 3300042598 Bacteria 2597
85 Ga0466729_238277 3300042621 Unclassified 1586
86 Ga0466735_087289 3300042624 Bacteria 4248
87 Ga0466727_040742 3300042655 Bacteria 14140
88 JGI24702J35022_10004701 3300002462 Bacteria 8087
89 JGI24696J40584_12960167 3300002834 Bacteria 6478
90 Ga0466723_277765 3300042618 Bacteria 43175
91 Ga0466701_088237 3300042598 Bacteria 1473
92 Ga0466707_370882 3300042601 Bacteria 8893
93 Ga0466714_033102 3300042603 Bacteria 2235
94 Ga0123356_10158974 3300010049 Bacteria 2254
95 Ga0123356_10365065 3300010049 Bacteria 1572
96 Ga0123353_10113791 3300010167 Bacteria 4356
97 Ga0123353_10386202 3300010167 Bacteria 2091
98 Ga0415639_066537 3300038395 Bacteria 1451
99 Ga0466656_367470 3300042550 Bacteria 1892
100 Ga0466692_029801 3300042591 Bacteria 11515
101 Ga0466708_378326 3300042652 Bacteria 4089
102 Ga0466725_369481 3300042654 Bacteria 29015
103 JGI24698J34947_10049564 3300002449 Bacteria 2121
104 JGI24702J35022_10005343 3300002462 Bacteria 7525
105 JGI24702J35022_10007608 3300002462 Bacteria 6197
106 JGI24702J35022_10016592 3300002462 Bacteria 4035
107 JGI24702J35022_10033938 3300002462 Bacteria 2729
108 JGI24705J35276_12234008 3300002504 Bacteria 5194
109 Ga0068302_10003034 3300005071 Bacteria 2259
110 Ga0466711_063690 3300042615 Unclassified 2508
111 Ga0466729_164932 3300042621 Bacteria 1488
112 Ga0466701_053165 3300042598 Bacteria 1868
113 Ga0466700_387488 3300042600 Bacteria 3718
114 Ga0466714_124101 3300042603 Bacteria 30720
115 Ga0123357_10268055 3300009784 Bacteria 1790
116 Ga0123353_10125002 3300010167 Bacteria 4134
117 Ga0466657_214583 3300042582 Bacteria 1705
118 Ga0466695_299578 3300042595 Bacteria 10314
119 Ga0466696_203556 3300042596 Bacteria 11539
120 Ga0466708_071403 3300042652 Bacteria 33717
121 Ga0466708_101326 3300042652 Bacteria 13268
122 JGI24702J35022_10002842 3300002462 Bacteria 10490

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042592 Ga0466693_269738 Ga0466693_269738_1162_2133 306
2 3300010167 Ga0123353_10055046 Ga0123353_100550462 368
3 3300042599 Ga0466706_032989 Ga0466706_032989_369_1571 373
4 3300002462 JGI24702J35022_10005343 JGI24702J35022_100053435 375
5 3300002462 JGI24702J35022_10010405 JGI24702J35022_100104053 376
6 3300010167 Ga0123353_10108000 Ga0123353_101080002 377
7 3300002462 JGI24702J35022_10004701 JGI24702J35022_100047018 379
8 2225789004 2227632951 2228218120 380
9 3300002462 JGI24702J35022_10033938 JGI24702J35022_100339383 381
10 3300002462 JGI24702J35022_10050151 JGI24702J35022_100501512 382
11 3300010049 Ga0123356_10158974 Ga0123356_101589742 382
12 3300010167 Ga0123353_10191105 Ga0123353_101911052 382
13 3300042595 Ga0466695_299578 Ga0466695_299578_328_1548 382
14 3300042598 Ga0466701_088237 Ga0466701_088237_14_1240 382
15 3300000062 IMNBL1DRAFT_c0003908 IMNBL1DRAFT_00039088 383
16 3300000062 IMNBL1DRAFT_c0024491 IMNBL1DRAFT_00244911 383
17 3300010049 Ga0123356_10223172 Ga0123356_102231722 383
18 3300042550 Ga0466656_255799 Ga0466656_255799_1180_2397 384
19 3300002462 JGI24702J35022_10005275 JGI24702J35022_100052752 385
20 3300002834 JGI24696J40584_12960167 JGI24696J40584_129601671 385
21 3300010167 Ga0123353_10703252 Ga0123353_107032522 385
22 3300042596 Ga0466696_161473 Ga0466696_161473_9181_10389 385
23 3300042598 Ga0466701_053165 Ga0466701_053165_89_1297 385
24 3300042603 Ga0466714_055553 Ga0466714_055553_632_1837 385
25 3300042617 Ga0466718_151193 Ga0466718_151193_131_1333 385
26 3300042624 Ga0466735_180334 Ga0466735_180334_132_1337 385
27 3300010167 Ga0123353_10552339 Ga0123353_105523391 386
28 3300010882 Ga0123354_10139768 Ga0123354_101397683 386
29 3300000062 IMNBL1DRAFT_c0000723 IMNBL1DRAFT_000072313 387
30 3300042582 Ga0466657_190877 Ga0466657_190877_347_1561 388
31 3300042600 Ga0466700_031678 Ga0466700_031678_1093_2304 388
32 3300010882 Ga0123354_10300751 Ga0123354_103007512 389
33 3300010167 Ga0123353_10113791 Ga0123353_101137912 390
34 3300042595 Ga0466695_248372 Ga0466695_248372_1906_3126 391
35 3300042609 Ga0466722_181839 Ga0466722_181839_494_1669 391
36 3300042609 Ga0466722_191964 Ga0466722_191964_69_1244 391
37 3300010049 Ga0123356_10153291 Ga0123356_101532912 392
38 3300010882 Ga0123354_10103090 Ga0123354_101030902 393
39 3300042603 Ga0466714_092220 Ga0466714_092220_39341_40546 393
40 3300042582 Ga0466657_165814 Ga0466657_165814_1918_3165 394
41 3300042611 Ga0466697_139692 Ga0466697_139692_217907_219157 395
42 3300002462 JGI24702J35022_10016592 JGI24702J35022_100165924 397
43 3300042600 Ga0466700_452825 Ga0466700_452825_546_1805 397
44 3300042613 Ga0466710_128980 Ga0466710_128980_420_1670 397
45 3300002462 JGI24702J35022_10007608 JGI24702J35022_100076082 398
46 3300010882 Ga0123354_10259554 Ga0123354_102595542 399
47 3300042609 Ga0466722_210653 Ga0466722_210653_7363_8562 399
48 3300042591 Ga0466692_029801 Ga0466692_029801_9725_10927 400
49 3300042596 Ga0466696_058212 Ga0466696_058212_1365_2567 400
50 3300042611 Ga0466697_087784 Ga0466697_087784_13122_14324 400
51 3300042615 Ga0466711_267834 Ga0466711_267834_2192_3394 400
52 3300005071 Ga0068302_10243383 Ga0068302_102433831 401
53 3300010167 Ga0123353_10125002 Ga0123353_101250021 401
54 3300042550 Ga0466656_302559 Ga0466656_302559_697_1965 401
55 3300042596 Ga0466696_203556 Ga0466696_203556_8387_9592 401
56 3300042600 Ga0466700_387488 Ga0466700_387488_1041_2246 401
57 3300042609 Ga0466722_037159 Ga0466722_037159_2039_3244 401
58 3300042618 Ga0466723_277765 Ga0466723_277765_1265_2470 401
59 3300042636 Ga0466703_311342 Ga0466703_311342_389_1594 401
60 iso_pr_bacteria 2820767225 2820767972 401
61 2225789004 2227153021 2227559571 402
62 2225789004 2227573522 2228120274 402
63 3300042582 Ga0466657_261521 Ga0466657_261521_1490_2740 402
64 3300042598 Ga0466701_001783 Ga0466701_001783_497_1705 402
65 3300042601 Ga0466707_222820 Ga0466707_222820_9555_10763 402
66 3300042605 Ga0466716_035836 Ga0466716_035836_2810_4018 402
67 3300042615 Ga0466711_063690 Ga0466711_063690_111_1319 402
68 3300042624 Ga0466735_087289 Ga0466735_087289_319_1527 402
69 3300042648 Ga0466709_136607 Ga0466709_136607_6598_7806 402
70 3300042652 Ga0466708_000881 Ga0466708_000881_477_1685 402
71 3300042652 Ga0466708_101326 Ga0466708_101326_10945_12153 402
72 3300042652 Ga0466708_172855 Ga0466708_172855_463_1671 402
73 3300042659 Ga0466733_111953 Ga0466733_111953_1045_2253 402
74 iso_pr_bacteria 2820781750 2820783209 402
75 iso_pr_bacteria 2820788205 2820788705 402
76 3300002449 JGI24698J34947_10049564 JGI24698J34947_100495641 403
77 3300009826 Ga0123355_10000223 Ga0123355_100002236 403
78 3300038395 Ga0415639_066537 Ga0415639_066537_25_1236 403
79 3300042593 Ga0466691_083787 Ga0466691_083787_12684_13895 403
80 3300042605 Ga0466716_495785 Ga0466716_495785_5328_6539 403
81 3300042621 Ga0466729_164932 Ga0466729_164932_179_1390 403
82 3300042621 Ga0466729_238277 Ga0466729_238277_43_1254 403
83 3300042622 Ga0466731_278919 Ga0466731_278919_230_1441 403
84 3300042652 Ga0466708_378326 Ga0466708_378326_1865_3076 403
85 3300042654 Ga0466725_369481 Ga0466725_369481_16849_18060 403
86 3300009784 Ga0123357_10268055 Ga0123357_102680551 404
87 3300009826 Ga0123355_10035710 Ga0123355_100357105 404
88 3300042648 Ga0466709_007878 Ga0466709_007878_649_1911 404
89 3300042652 Ga0466708_071403 Ga0466708_071403_1964_3178 404
90 3300042621 Ga0466729_001938 Ga0466729_001938_11379_12596 405
91 3300005071 Ga0068302_10003034 Ga0068302_100030342 406
92 3300010049 Ga0123356_10046340 Ga0123356_100463404 406
93 3300042601 Ga0466707_370882 Ga0466707_370882_2348_3568 406
94 3300042655 Ga0466727_040742 Ga0466727_040742_4551_5771 406
95 3300010049 Ga0123356_10082615 Ga0123356_100826153 407
96 3300042621 Ga0466729_001938 Ga0466729_001938_10152_11375 407
97 3300042603 Ga0466714_033102 Ga0466714_033102_729_1955 408
98 3300042654 Ga0466725_277592 Ga0466725_277592_4628_5914 409
99 3300042550 Ga0466656_367470 Ga0466656_367470_75_1307 410
100 3300042622 Ga0466731_045040 Ga0466731_045040_4735_6015 410
101 3300042603 Ga0466714_124101 Ga0466714_124101_8998_10284 411
102 3300042582 Ga0466657_349967 Ga0466657_349967_3808_5046 412
103 3300042624 Ga0466735_087289 Ga0466735_087289_1524_2762 412
104 3300010167 Ga0123353_10386202 Ga0123353_103862022 413
105 3300042582 Ga0466657_171011 Ga0466657_171011_3024_4265 413
106 3300042600 Ga0466700_156172 Ga0466700_156172_94201_95442 413
107 3300042598 Ga0466701_034474 Ga0466701_034474_1593_2942 414
108 3300042600 Ga0466700_241730 Ga0466700_241730_2169_3413 414
109 3300002504 JGI24705J35276_12234008 JGI24705J35276_122340083 415
110 3300010049 Ga0123356_10365065 Ga0123356_103650652 415
111 3300042590 Ga0466690_010061 Ga0466690_010061_15738_16985 415
112 3300010167 Ga0123353_10357369 Ga0123353_103573691 416
113 iso_pr_bacteria 2820746860 2820747901 416
114 3300010049 Ga0123356_10388647 Ga0123356_103886472 418
115 3300010049 Ga0123356_10024551 Ga0123356_100245513 420
116 3300010049 Ga0123356_10140289 Ga0123356_101402891 420
117 3300042600 Ga0466700_156172 Ga0466700_156172_95459_96724 421
118 3300002462 JGI24702J35022_10002842 JGI24702J35022_100028429 424
119 3300042582 Ga0466657_214583 Ga0466657_214583_351_1625 424
120 3300042659 Ga0466733_017527 Ga0466733_017527_2889_4166 425
121 3300010167 Ga0123353_10006551 Ga0123353_100065519 426
122 3300042613 Ga0466710_081215 Ga0466710_081215_116_1396 426
123 3300010167 Ga0123353_10235643 Ga0123353_102356432 427
124 3300010049 Ga0123356_10042745 Ga0123356_100427453 430
125 3300042600 Ga0466700_489296 Ga0466700_489296_1580_2923 430
126 3300010167 Ga0123353_10324425 Ga0123353_103244252 431
127 3300010167 Ga0123353_10012897 Ga0123353_100128971 435
128 3300010167 Ga0123353_10000490 Ga0123353_1000049018 443
129 3300042595 Ga0466695_000941 Ga0466695_000941_5508_6941 444
130 iso_pr_bacteria 2820744581 2820746848 456

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF13360 PQQ_2 PQQ-like domain 276 379 0.85

🏗️ Structural Annotation – Top 5 Hits

IDDescriptionScoreStartEnd
2yms-assembly1.cif.gz_B Structure and assembly of a b-propeller with nine blades and a new conserved repetitive sequence motif 0.852 64 146
2yms-assembly1.cif.gz_D Structure and assembly of a b-propeller with nine blades and a new conserved repetitive sequence motif 0.844 114 196
6y7o-assembly2.cif.gz_B The complex between the eight-bladed symmetrical designer protein Tako8 and the silicotungstic acid Keggin (STA) 0.797 53 456
6y7o-assembly3.cif.gz_C The complex between the eight-bladed symmetrical designer protein Tako8 and the silicotungstic acid Keggin (STA) 0.797 53 456
6g6n-assembly3.cif.gz_C Crystal structure of the computationally designed Tako8 protein in C2 0.791 53 455
IDDescriptionScoreStartEndSuperfamily
2ymsB00 Mainly Beta;Beta Barrel;Thrombin, subunit H; 0.8515 64 146 2.40.10.480
2ymsD00 Mainly Beta;Beta Barrel;Thrombin, subunit H; 0.8435 114 196 2.40.10.480
af_Q86TI4_245_352_2.40.128.630 Mainly Beta;Beta Barrel;Lipocalin; 0.81 70 188 2.40.128.630
af_A0A0R0GM76_87_239_2.110.10.10 Mainly Beta;4 Propeller;Hemopexin;Hemopexin-like domain 0.7886 71 152 2.110.10.10
af_F1QAL1_59_162_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.7854 71 147 2.130.10.10
IDDescriptionScoreStartEndGO Terms
AF-A0A1F3F5K5-F1-model_v4 Uncharacterized/unreviewed 0.9768 81 456
AF-A0A0F9EIJ0-F1-model_v4 Pyrrolo-quinoline quinone repeat domain-containing protein 0.9736 25 455

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.85 0.91 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.