Protein Family IF12137

Metagenome Isolate
153 Members
89 Samples
94 Scaffolds
410.83 Avg Length

🧬 Representative Sequence

ID
iso_pr_bacteria|2820698910|2820701525|
Length
459 aa
Sequence
LAVLYLTAMALIYISLSGIFPHIIPQILCKTIAQPLYWRLDANSKKKAVINMDNARLKKYAELLVRSGGNVQKGQVVVIGCSVDDAYFGRLVQECAYDAGASEVVMDWGDEASARAKFLRADDGIFDDFPQWKVDWYKHYDDKGAVYLRVSSTDPDYLAGVDPNRLRRFSKASGIATKAHSAIMMSNTNRWSVCAIPSPAWAKKVFPNVSEEEAMEKLWAAILKGARADGDNPQTDWEKHKDNFTDRVEYLNKMNFDSLRITTGLGTDITLGLVKNHVWVGGGDTGKDGVPFFPNLPTEEIFTMPDRTRANGRVVASMPLSRMGNLIEGFEMTFKDGLVDSFKAEKNEQALADMLGMDEGAKRLGEVALVTNSSPIGQMGVLFYNTLFDENASAHLALGKAYPNNMKGGDDMTTEKLVEAGGNDSLIHVDFMFGTADMKVIGIGADGTETVFFDNGEFI

📊 Sample Types

Isolate 38.6%
Metagenome 61.4%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 47.7%
Termitidae 16.3%
Blattidae 9.3%
Kalotermitidae 5.8%
Tenebrionidae 5.8%
Formicidae 4.7%
Psyllidae 3.5%
Termopsidae 2.3%
Passalidae 1.2%
Dytiscidae 1.2%
Elmidae 1.2%
Daphniidae 1.2%

🌳 Taxonomy

Archaea 1
Bacteria 137
Eukaryota 0
Viruses 0
Unclassified 15

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2940368928 Breznakia sp. PFB2-30 Isolate Blattidae
2 2820385248 Unclassified Firmicutes Nt197P1bin19 Isolate Unclassified
3 2820431532 Unclassified Firmicutes Lab288P3bin230 Isolate Unclassified
4 2820661146 Unclassified Firmicutes Co191P3bin61 Isolate Unclassified
5 2820673891 Unclassified Firmicutes Co191P3bin18 Isolate Unclassified
6 2820676843 Unclassified Firmicutes Co191P3bin17 Isolate Unclassified
7 8012112996 Staphylococcus muscae ATCC 49910 Isolate
8 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
9 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
10 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
11 2940352027 Breznakia sp. PH1-1 Isolate Blattidae
12 2820115951 Unclassified Proteobacteria Emb289P4bin33 Isolate Unclassified
13 2820298281 Unclassified Firmicutes Th196P1bin9 Isolate Unclassified
14 2820537337 Unclassified Firmicutes Lab288P1bin137 Isolate Unclassified
15 2820623020 Unclassified Firmicutes Emb289P1bin126 Isolate Unclassified
16 2820685979 Unclassified Firmicutes Co191P1bin81 Isolate Unclassified
17 2820696217 Unclassified Firmicutes Co191P1bin66 Isolate Unclassified
18 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
19 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
20 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
21 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
22 2820522177 Unclassified Firmicutes Lab288P1bin22 Isolate Unclassified
23 2820541116 Unclassified Firmicutes Lab288P1bin109 Isolate Unclassified
24 2820654856 Unclassified Firmicutes Cu122P1bin2 Isolate Unclassified
25 2820702360 Unclassified Firmicutes Co191P1bin4 Isolate Unclassified
26 644736336 Candidatus Liberibacter asiaticus psy62 Isolate Psyllidae
27 3300002508 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 Metagenome Termitidae
28 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
29 3300007141 Ant gut microbial communities from Cephalotes maculatus, Brazil Metagenome Formicidae
30 2940361758 Breznakia sp. PFB1-14 Isolate Blattidae
31 2820382897 Unclassified Firmicutes Nt197P1bin3 Isolate Unclassified
32 2820535361 Unclassified Firmicutes Lab288P1bin14 Isolate Unclassified
33 2820617402 Unclassified Firmicutes Emb289P1bin131 Isolate Unclassified
34 2820627938 Unclassified Firmicutes Emb289P1bin122 Isolate Unclassified
35 2816332302 Candidatus Liberibacter asiaticus YCPsy Isolate Psyllidae
36 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
37 2820444930 Unclassified Firmicutes Lab288P3bin199 Isolate Unclassified
38 2820630457 Unclassified Firmicutes Emb289P1bin119 Isolate Unclassified
39 3300056790 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) Metagenome Tenebrionidae
40 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
41 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
42 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
43 3300002938 Larval gut metagenome for colony PL005 Metagenome Formicidae
44 8112490586 Staphylococcus muscae CCM 4175 Isolate
45 2873593402 Erysipelothrix sp. HDW6A Isolate Dytiscidae
46 2873597894 Erysipelothrix sp. HDW6B Isolate Unclassified
47 2886876212 Tokpelaia sp. RhiAcro1 Isolate Formicidae
48 2917496769 Staphylococcus muscae DSM 7068 Isolate Unclassified
49 2940359323 Breznakia sp. PFB1-12 Isolate Blattidae
50 2940366561 Breznakia sp. PFB1-4 Isolate Blattidae
51 2740892557 Staphylococcus sp. JDR108L-110-1 Isolate Unclassified
52 2820375548 Unclassified Firmicutes Nt197P1bin8 Isolate Unclassified
53 2820615445 Unclassified Firmicutes Emb289P1bin132 Isolate Unclassified
54 2820690275 Unclassified Firmicutes Co191P1bin72 Isolate Unclassified
55 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
56 3300002501 Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 Metagenome Termitidae
57 3300012814 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG Metagenome
58 2940354458 Breznakia sp. PF1-11 Isolate Blattidae
59 2788499854 Breznakia blatticola DSM 28867 Isolate Unclassified
60 2820309449 Unclassified Firmicutes Th196P1bin10 Isolate Unclassified
61 2820380671 Unclassified Firmicutes Nt197P1bin4 Isolate Unclassified
62 2820501819 Unclassified Firmicutes Lab288P1bin51 Isolate Unclassified
63 2820600392 Unclassified Firmicutes Emb289P1bin52 Isolate Unclassified
64 2820607737 Unclassified Firmicutes Emb289P1bin48 Isolate Unclassified
65 2820663833 Unclassified Firmicutes Co191P3bin41 Isolate Unclassified
66 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
67 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
68 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
69 8012942269 Mammaliicoccus lentus UD i2 Isolate Tenebrionidae
70 8063680480 Candidatus Liberibacter asiaticus CoFLP Isolate Psyllidae
71 3300002932 Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 Metagenome Formicidae
72 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
73 2864985977 Staphylococcus hominis S00278 Isolate Elmidae
74 2940356891 Breznakia sp. PFB1-11 Isolate Blattidae
75 2940364193 Breznakia sp. PFB1-19 Isolate Blattidae
76 2556921669 Shinella sp. DD12 Isolate Daphniidae
77 2820285501 Unclassified Firmicutes Th196P3bin142 Isolate Unclassified
78 2820306284 Unclassified Firmicutes Th196P1bin11 Isolate Unclassified
79 2820435670 Unclassified Firmicutes Lab288P3bin217 Isolate Unclassified
80 2820602899 Unclassified Firmicutes Emb289P1bin51 Isolate Unclassified
81 2820698910 Unclassified Firmicutes Co191P1bin64 Isolate Unclassified
82 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
83 3300056857 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) Metagenome Tenebrionidae
84 3300057007 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) Metagenome Tenebrionidae
85 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
86 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
87 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
88 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
89 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_072494 3300042612 Bacteria 10573
2 Ga0562377_0253 3300056842 Unclassified 122534
3 Ga0466714_004038 3300042603 Bacteria 9106
4 Ga0466716_423511 3300042605 Bacteria 3385
5 Ga0123355_10000088 3300009826 Bacteria 97566
6 Ga0123355_10000089 3300009826 Bacteria 96529
7 Ga0123355_10000202 3300009826 Bacteria 74240
8 Ga0123355_10024194 3300009826 Bacteria 9757
9 Ga0123353_10000107 3300010167 Bacteria 96760
10 Ga0466734_010718 3300042623 Bacteria 5417
11 Ga0466711_487741 3300042615 Bacteria 9918
12 JGI24695J34938_10000532 3300002450 Unclassified 36923
13 JGI24700J35501_10930408 3300002508 Bacteria 13706
14 Ga0068305_10008203 3300005083 Bacteria 12453
15 Ga0562379_3216 3300056790 Bacteria 11383
16 Ga0466713_052457 3300042602 Bacteria 82842
17 Ga0123355_10000255 3300009826 Bacteria 68435
18 Ga0123355_10062957 3300009826 Bacteria 5985
19 Ga0123355_10341665 3300009826 Bacteria 1993
20 Ga0123353_10062218 3300010167 Unclassified 5987
21 IMNBL1DRAFT_c0001812 3300000062 Bacteria 15549
22 JGI24695J34938_10009135 3300002450 Bacteria 5544
23 JGI24703J35330_11747492 3300002501 Bacteria 7059
24 JGI24700J35501_10930579 3300002508 Bacteria 16090
25 JGI24700J35501_10930588 3300002508 Bacteria 16289
26 Ga0562377_0081 3300056842 Bacteria 350212
27 Ga0123355_10010515 3300009826 Bacteria 14195
28 Ga0123355_10017072 3300009826 Unclassified 11460
29 Ga0415639_011760 3300038395 Bacteria 16179
30 Ga0466699_389868 3300042597 Bacteria 3048
31 CVPL005L_10005166 3300002938 Bacteria 19061
32 Ga0562379_2857 3300056790 Bacteria 13037
33 Ga0562377_0212 3300056842 Unclassified 147500
34 Ga0562376_0228 3300056857 Unclassified 112204
35 Ga0562374_0219 3300057007 Unclassified 121362
36 Ga0123355_10000617 3300009826 Bacteria 48065
37 Ga0123355_10006824 3300009826 Bacteria 16988
38 Ga0123355_10030183 3300009826 Bacteria 8784
39 Ga0123355_10032238 3300009826 Bacteria 8504
40 Ga0123355_10086852 3300009826 Bacteria 4973
41 Ga0123355_10245157 3300009826 Bacteria 2531
42 Ga0123355_10295880 3300009826 Bacteria 2214
43 Ga0123353_10019182 3300010167 Bacteria 10148
44 Ga0466702_405196 3300042635 Bacteria 7505
45 Ga0466725_250362 3300042654 Bacteria 9440
46 Ga0466715_582019 3300042616 Bacteria 46223
47 JGI24703J35330_11746919 3300002501 Unclassified 5837
48 JGI24703J35330_11747912 3300002501 Unclassified 9019
49 Ga0466716_160218 3300042605 Bacteria 6504
50 Ga0123355_10000001 3300009826 Bacteria 286680
51 Ga0123355_10008185 3300009826 Bacteria 15792
52 Ga0123355_10034795 3300009826 Bacteria 8188
53 Ga0123353_10594395 3300010167 Bacteria 1584
54 Ga0415639_026801 3300038395 Bacteria 1870
55 Ga0123357_10004560 3300009784 Unclassified 16312
56 Ga0123355_10000118 3300009826 Bacteria 90212
57 Ga0123355_10009724 3300009826 Bacteria 14660
58 Ga0123355_10220192 3300009826 Bacteria 2731
59 Ga0160453_100308 3300012814 Bacteria 43594
60 Ga0466693_059568 3300042592 Bacteria 2579
61 Ga0466696_446555 3300042596 Bacteria 1829
62 Ga0102738_1000013 3300007141 Bacteria 98326
63 Ga0562374_2014 3300057007 Unclassified 20335
64 Ga0123355_10000234 3300009826 Bacteria 70892
65 Ga0123355_10000288 3300009826 Bacteria 64439
66 Ga0123355_10003011 3300009826 Bacteria 24006
67 Ga0123355_10034002 3300009826 Bacteria 8279
68 Ga0123355_10041254 3300009826 Bacteria 7514
69 Ga0123355_10283672 3300009826 Bacteria 2283
70 Ga0415639_013507 3300038395 Bacteria 6373
71 Ga0415639_049943 3300038395 Bacteria 8080
72 JGI24695J34938_10000434 3300002450 Bacteria 40326
73 JGI24695J34938_10002555 3300002450 Unclassified 13719
74 JGI24695J34938_10060878 3300002450 Unclassified 1609
75 JGI24703J35330_11748212 3300002501 Bacteria 12082
76 CVPL010L_1000001 3300002932 Bacteria 547858
77 Ga0562377_0281 3300056842 Bacteria 109788
78 Ga0562374_0113 3300057007 Unclassified 206970
79 Ga0562374_0156 3300057007 Unclassified 158989
80 Ga0123355_10000302 3300009826 Bacteria 63226
81 Ga0123355_10001116 3300009826 Bacteria 37140
82 Ga0123355_10010571 3300009826 Bacteria 14166
83 Ga0123355_10014676 3300009826 Bacteria 12265
84 Ga0123355_10020668 3300009826 Bacteria 10520
85 Ga0123355_10065749 3300009826 Bacteria 5840
86 Ga0123355_10109295 3300009826 Archaea 4325
87 Ga0123355_10199136 3300009826 Bacteria 2930
88 Ga0123355_10241423 3300009826 Bacteria 2559
89 Ga0123355_10344451 3300009826 Bacteria 1982
90 Ga0123356_10263247 3300010049 Bacteria 1810
91 Ga0466735_175042 3300042624 Bacteria 2136
92 Ga0466727_056530 3300042655 Bacteria 18763
93 Ga0415639_048958 3300038395 Bacteria 10391
94 JGI24695J34938_10000227 3300002450 Bacteria 53237

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300038395 Ga0415639_013507 Ga0415639_013507_41_1105 354
2 3300010167 Ga0123353_10062218 Ga0123353_100622183 379
3 3300009826 Ga0123355_10245157 Ga0123355_102451572 381
4 iso_pr_bacteria 2820615445 2820615832 384
5 3300038395 Ga0415639_011760 Ga0415639_011760_11328_12557 390
6 3300009826 Ga0123355_10008185 Ga0123355_1000818515 396
7 3300009826 Ga0123355_10032238 Ga0123355_100322389 402
8 3300042623 Ga0466734_010718 Ga0466734_010718_1911_3164 402
9 3300009826 Ga0123355_10000234 Ga0123355_1000023475 405
10 iso_pr_bacteria 2820431532 2820432083 406
11 iso_pr_bacteria 2820435670 2820436536 406
12 iso_pr_bacteria 2820501819 2820503944 406
13 iso_pr_bacteria 2820535361 2820535954 406
14 3300009784 Ga0123357_10004560 Ga0123357_100045602 407
15 3300010167 Ga0123353_10000107 Ga0123353_1000010759 407
16 3300042605 Ga0466716_160218 Ga0466716_160218_143_1369 408
17 3300042616 Ga0466715_582019 Ga0466715_582019_33043_34269 408
18 iso_pr_bacteria 2820306284 2820307927 408
19 iso_pr_bacteria 2820444930 2820445701 408
20 iso_pr_bacteria 2820541116 2820543638 408
21 iso_pr_bacteria 2820654856 2820657413 408
22 iso_pr_bacteria 2820676843 2820678061 408
23 iso_pr_bacteria 2820696217 2820697898 408
24 iso_pr_bacteria 2873593402 2873594641 408
25 iso_pr_bacteria 2873597894 2873598990 408
26 3300002450 JGI24695J34938_10000434 JGI24695J34938_1000043420 409
27 3300002450 JGI24695J34938_10000532 JGI24695J34938_1000053232 409
28 3300002508 JGI24700J35501_10930408 JGI24700J35501_109304085 409
29 3300009826 Ga0123355_10014676 Ga0123355_100146769 409
30 3300009826 Ga0123355_10034002 Ga0123355_100340023 409
31 3300009826 Ga0123355_10062957 Ga0123355_100629572 409
32 3300009826 Ga0123355_10220192 Ga0123355_102201924 409
33 3300010167 Ga0123353_10019182 Ga0123353_1001918211 409
34 3300038395 Ga0415639_048958 Ga0415639_048958_3035_4264 409
35 3300042592 Ga0466693_059568 Ga0466693_059568_409_1638 409
36 3300042597 Ga0466699_389868 Ga0466699_389868_1186_2415 409
37 3300042615 Ga0466711_487741 Ga0466711_487741_701_1930 409
38 3300042635 Ga0466702_405196 Ga0466702_405196_1351_2580 409
39 3300056842 Ga0562377_0081 Ga0562377_0081_225682_226911 409
40 iso_pr_bacteria 2820285501 2820288603 409
41 iso_pr_bacteria 2820298281 2820300716 409
42 iso_pr_bacteria 2820375548 2820376787 409
43 iso_pr_bacteria 2820380671 2820381726 409
44 iso_pr_bacteria 2820382897 2820383105 409
45 iso_pr_bacteria 2820385248 2820385650 409
46 iso_pr_bacteria 2820522177 2820522807 409
47 iso_pr_bacteria 2820600392 2820602395 409
48 iso_pr_bacteria 2820607737 2820609291 409
49 iso_pr_bacteria 2820617402 2820617730 409
50 iso_pr_bacteria 2820630457 2820631948 409
51 iso_pr_bacteria 2820661146 2820661332 409
52 iso_pr_bacteria 2820690275 2820691553 409
53 iso_pr_bacteria 2820702360 2820705044 409
54 iso_pr_bacteria 8012942269 8012943109 409
55 3300000062 IMNBL1DRAFT_c0001812 IMNBL1DRAFT_000181215 410
56 3300002450 JGI24695J34938_10000227 JGI24695J34938_100002278 410
57 3300002450 JGI24695J34938_10060878 JGI24695J34938_100608782 410
58 3300002501 JGI24703J35330_11746919 JGI24703J35330_117469196 410
59 3300002501 JGI24703J35330_11747492 JGI24703J35330_117474928 410
60 3300002501 JGI24703J35330_11747912 JGI24703J35330_117479127 410
61 3300002501 JGI24703J35330_11748212 JGI24703J35330_117482123 410
62 3300002508 JGI24700J35501_10930588 JGI24700J35501_109305881 410
63 3300009826 Ga0123355_10000089 Ga0123355_1000008968 410
64 3300009826 Ga0123355_10000118 Ga0123355_1000011886 410
65 3300009826 Ga0123355_10000255 Ga0123355_1000025528 410
66 3300009826 Ga0123355_10000617 Ga0123355_1000061725 410
67 3300009826 Ga0123355_10003011 Ga0123355_100030118 410
68 3300009826 Ga0123355_10006824 Ga0123355_100068245 410
69 3300009826 Ga0123355_10017072 Ga0123355_100170728 410
70 3300009826 Ga0123355_10024194 Ga0123355_1002419410 410
71 3300009826 Ga0123355_10030183 Ga0123355_100301832 410
72 3300009826 Ga0123355_10041254 Ga0123355_100412547 410
73 3300009826 Ga0123355_10086852 Ga0123355_100868522 410
74 3300009826 Ga0123355_10241423 Ga0123355_102414232 410
75 3300009826 Ga0123355_10283672 Ga0123355_102836723 410
76 3300009826 Ga0123355_10341665 Ga0123355_103416651 410
77 3300009826 Ga0123355_10344451 Ga0123355_103444512 410
78 3300010167 Ga0123353_10594395 Ga0123353_105943951 410
79 3300038395 Ga0415639_026801 Ga0415639_026801_474_1706 410
80 3300038395 Ga0415639_049943 Ga0415639_049943_3542_4774 410
81 3300042603 Ga0466714_004038 Ga0466714_004038_4284_5516 410
82 3300042605 Ga0466716_423511 Ga0466716_423511_2002_3234 410
83 3300042612 Ga0466705_072494 Ga0466705_072494_209_1441 410
84 3300042624 Ga0466735_175042 Ga0466735_175042_236_1468 410
85 3300042655 Ga0466727_056530 Ga0466727_056530_8504_9736 410
86 iso_pr_bacteria 2820501819 2820503943 410
87 iso_pr_bacteria 2820623020 2820623326 410
88 iso_pr_bacteria 2820627938 2820627957 410
89 iso_pr_bacteria 2820673891 2820676449 410
90 iso_pr_bacteria 2820685979 2820687697 410
91 3300002450 JGI24695J34938_10002555 JGI24695J34938_100025554 411
92 3300002450 JGI24695J34938_10009135 JGI24695J34938_100091352 411
93 3300009826 Ga0123355_10000088 Ga0123355_1000008888 411
94 3300009826 Ga0123355_10000202 Ga0123355_1000020262 411
95 3300009826 Ga0123355_10000302 Ga0123355_1000030211 411
96 3300009826 Ga0123355_10010515 Ga0123355_100105156 411
97 3300009826 Ga0123355_10010571 Ga0123355_100105714 411
98 3300009826 Ga0123355_10020668 Ga0123355_1002066810 411
99 3300009826 Ga0123355_10034795 Ga0123355_100347953 411
100 3300009826 Ga0123355_10199136 Ga0123355_101991362 411
101 3300042654 Ga0466725_250362 Ga0466725_250362_3298_4533 411
102 3300056790 Ga0562379_3216 Ga0562379_3216_3485_4720 411
103 iso_pr_bacteria 2788499854 2788760286 411
104 iso_pr_bacteria 2820602899 2820603276 411
105 iso_pr_bacteria 2940352027 2940352461 411
106 iso_pr_bacteria 2940354458 2940354892 411
107 iso_pr_bacteria 2940356891 2940357326 411
108 iso_pr_bacteria 2940359323 2940359602 411
109 iso_pr_bacteria 2940361758 2940362192 411
110 iso_pr_bacteria 2940364193 2940364627 411
111 iso_pr_bacteria 2940366561 2940367957 411
112 iso_pr_bacteria 2940368928 2940369206 411
113 3300009826 Ga0123355_10001116 Ga0123355_100011169 412
114 3300056842 Ga0562377_0212 Ga0562377_0212_128897_130135 412
115 3300056842 Ga0562377_0253 Ga0562377_0253_98993_100231 412
116 3300056857 Ga0562376_0228 Ga0562376_0228_96159_97397 412
117 3300057007 Ga0562374_0113 Ga0562374_0113_186516_187754 412
118 3300057007 Ga0562374_0156 Ga0562374_0156_19018_20256 412
119 3300057007 Ga0562374_0219 Ga0562374_0219_14968_16206 412
120 3300057007 Ga0562374_2014 Ga0562374_2014_6531_7769 412
121 iso_pr_bacteria 2740892557 2743950971 412
122 iso_pr_bacteria 2820309449 2820310633 412
123 iso_pr_bacteria 2917496769 2917498251 412
124 iso_pr_bacteria 8012112996 8012113827 412
125 iso_pr_bacteria 8112490586 8112491871 412
126 3300002508 JGI24700J35501_10930579 JGI24700J35501_1093057912 413
127 3300056790 Ga0562379_2857 Ga0562379_2857_9418_10659 413
128 3300012814 Ga0160453_100308 Ga0160453_10030818 414
129 iso_pr_bacteria 2820535361 2820535955 414
130 3300056842 Ga0562377_0281 Ga0562377_0281_105782_107029 415
131 iso_pr_bacteria 2864985977 2864988268 415
132 3300002932 CVPL010L_1000001 CVPL010L_1000001291 416
133 3300002938 CVPL005L_10005166 CVPL005L_100051665 416
134 3300007141 Ga0102738_1000013 Ga0102738_100001388 416
135 3300009826 Ga0123355_10000001 Ga0123355_1000000120 416
136 iso_pr_bacteria 2820537337 2820537687 416
137 3300005083 Ga0068305_10008203 Ga0068305_1000820310 417
138 iso_pr_bacteria 2556921669 2558276704 417
139 iso_pr_bacteria 2820115951 2820119695 417
140 iso_pr_bacteria 2816332302 2817500098 418
141 iso_pr_bacteria 2886876212 2886876428 418
142 iso_pr_bacteria 644736336 644908640 418
143 iso_pr_bacteria 8063680480 8063680905 418
144 3300010049 Ga0123356_10263247 Ga0123356_102632472 420
145 3300042602 Ga0466713_052457 Ga0466713_052457_72660_73925 421
146 3300009826 Ga0123355_10009724 Ga0123355_1000972414 422
147 3300009826 Ga0123355_10295880 Ga0123355_102958802 422
148 3300009826 Ga0123355_10065749 Ga0123355_100657496 428
149 3300042596 Ga0466696_446555 Ga0466696_446555_453_1751 432
150 3300009826 Ga0123355_10000288 Ga0123355_1000028810 438
151 3300009826 Ga0123355_10109295 Ga0123355_101092952 439
152 iso_pr_bacteria 2820663833 2820666215 459
153 iso_pr_bacteria 2820698910 2820701525 459

🧩 MSA Aligner

Download FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF02073 Peptidase_M29 Thermophilic metalloprotease (M29) 55 458 1

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.