Protein Family IF12114

Metagenome Isolate
111 Members
48 Samples
96 Scaffolds
590.05 Avg Length

🧬 Representative Sequence

ID
iso_pr_bacteria|2820607737|2820609186|
Length
635 aa
Sequence
MARNRAAHSGRIGQNTGNNATGGNASGGRNRGRGRHGRNSKKDNADTRPKIPMYRVFFYATRFMLSYAPVMFLSVFILGIPFGLAQGLSVFATQNLFDSVEGAITGYSALRTAYLALLALGVIIISREILNGLHSFLYSALFDKIGGGLQRAIHRKMSLIDPVAFENVSFHDDMEKADRGKWSVMGMTCTIWDTLTFYVPYFIFMGFYLHHVSPRFVFAIVLVFLPTLLGQIIHTKIISKFVDVTAPIRREHDFYYNAITNRHYYKETRILGTYGFFLKRYMKMLKDLSRAELSANRKTSFLDLGLSLLSTAGYVGILVMLVSALLSGEISVGAFAAVYGSIGMMFSMMEQVIKHRLGQAAEGMGFAHNFMRFIELPERDGSETTKIDSTQGIEMQNVSFTYPLAENKSIESVNLKIAQGETVAIVGENGAGKSTLVRLMIGLYKPDEGTILFGGADTSQTKLTTIFKNLTGVFQRFQRYHLTLKENIRMGDTSSPETIFESLTQSGLELTPATYPQGEDTMLSREFEGVDLSGGQWQRVAIARGLYRAHNIVVLDEPTAAIDPIEESRIYEKFIEISKNKTAIIVTHRLGSTKIADRVIVMEKGKIVDIGNHDELLSRGGTYAKMFHAQAEWYE

📊 Sample Types

Isolate 13.5%
Metagenome 86.5%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 46.8%
Unclassified 29.8%
Kalotermitidae 12.8%
Passalidae 6.4%
Hodotermitidae 2.1%
Elmidae 2.1%

🌳 Taxonomy

Archaea 0
Bacteria 104
Eukaryota 0
Viruses 0
Unclassified 7

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
2 2820348946 Unclassified Firmicutes Nt197P3bin47 Isolate Unclassified
3 2820481688 Unclassified Firmicutes Lab288P1bin76 Isolate Unclassified
4 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
5 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
6 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
7 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
8 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
9 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
10 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
11 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
12 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
13 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
14 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
15 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
16 2820301196 Unclassified Firmicutes Th196P1bin8 Isolate Unclassified
17 2820469612 Unclassified Firmicutes Lab288P1bin92 Isolate Unclassified
18 2820702360 Unclassified Firmicutes Co191P1bin4 Isolate Unclassified
19 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
20 3300002508 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 Metagenome Termitidae
21 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
22 2820472365 Unclassified Firmicutes Lab288P1bin87 Isolate Unclassified
23 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
24 3300002501 Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 Metagenome Termitidae
25 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
26 2225789003 Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) Metagenome Passalidae
27 2820267566 Unclassified Firmicutes Th196P3bin33 Isolate Unclassified
28 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
29 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
30 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
31 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
32 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
33 2820309449 Unclassified Firmicutes Th196P1bin10 Isolate Unclassified
34 2820607737 Unclassified Firmicutes Emb289P1bin48 Isolate Unclassified
35 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
36 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
37 2820229114 Unclassified Firmicutes Th196P4bin40 Isolate Unclassified
38 2820636287 Unclassified Firmicutes Emb289P1bin112 Isolate Unclassified
39 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
40 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
41 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
42 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
43 2864981449 Sporosarcina sp. S00266 Isolate Elmidae
44 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
45 2820257794 Unclassified Firmicutes Th196P3bin47 Isolate Unclassified
46 2820329821 Unclassified Firmicutes Nt197P3bin77 Isolate Unclassified
47 2820513949 Unclassified Firmicutes Lab288P1bin39 Isolate Unclassified
48 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0123355_10021930 3300009826 Bacteria 10235
2 Ga0123355_10096637 3300009826 Bacteria 4665
3 Ga0123356_10045495 3300010049 Bacteria 4084
4 Ga0123356_10084898 3300010049 Bacteria 3002
5 JGI24698J34947_10006006 3300002449 Bacteria 6663
6 Ga0123355_10000395 3300009826 Bacteria 56721
7 Ga0123355_10034969 3300009826 Bacteria 8167
8 Ga0123356_10058717 3300010049 Bacteria 3588
9 Ga0123356_10123022 3300010049 Bacteria 2527
10 Ga0123353_10127351 3300010167 Bacteria 4091
11 Ga0123353_10137402 3300010167 Bacteria 3919
12 Ga0466699_193920 3300042597 Bacteria 5401
13 Ga0466706_142380 3300042599 Bacteria 5614
14 Ga0466714_124127 3300042603 Bacteria 10521
15 Ga0466720_149293 3300042607 Bacteria 43020
16 Ga0466721_136506 3300042608 Bacteria 14330
17 Ga0466705_407683 3300042612 Bacteria 5658
18 Ga0123355_10018945 3300009826 Bacteria 10944
19 Ga0123356_10000230 3300010049 Bacteria 65093
20 Ga0123353_10124568 3300010167 Bacteria 4142
21 Ga0466719_192117 3300042606 Bacteria 15988
22 Ga0466720_028407 3300042607 Bacteria 8032
23 JGI24702J35022_10021428 3300002462 Unclassified 3505
24 Ga0466728_116760 3300042620 Unclassified 1744
25 Ga0466728_273067 3300042620 Bacteria 5142
26 Ga0123355_10000032 3300009826 Bacteria 139664
27 Ga0123355_10043774 3300009826 Bacteria 7284
28 Ga0123355_10134856 3300009826 Bacteria 3793
29 Ga0123355_10244546 3300009826 Bacteria 2536
30 Ga0123356_10034753 3300010049 Bacteria 4710
31 Ga0466694_099719 3300042594 Bacteria 3769
32 Ga0466699_017092 3300042597 Bacteria 11915
33 Ga0466704_376516 3300042643 Bacteria 2102
34 Ga0466700_013211 3300042600 Bacteria 12088
35 Ga0466698_029833 3300042610 Bacteria 40118
36 JGI24703J35330_11748332 3300002501 Bacteria 14005
37 JGI24700J35501_10930902 3300002508 Bacteria 37453
38 Ga0072941_1058636 3300005201 Bacteria 12995
39 Ga0466712_083267 3300042614 Bacteria 26241
40 Ga0123355_10000018 3300009826 Bacteria 155505
41 Ga0123355_10014967 3300009826 Bacteria 12159
42 Ga0123355_10046858 3300009826 Bacteria 7029
43 Ga0123355_10077047 3300009826 Bacteria 5330
44 Ga0123355_10108963 3300009826 Bacteria 4334
45 Ga0123356_10006475 3300010049 Bacteria 11801
46 Ga0123356_10121122 3300010049 Bacteria 2545
47 Ga0466699_162137 3300042597 Bacteria 5935
48 Ga0466724_19735 3300042649 Bacteria 6133
49 Ga0466720_051486 3300042607 Bacteria 39048
50 2227275247 2225789004 Unclassified 6863
51 2227458578 2225789004 Bacteria 5371
52 2227502410 2225789004 Bacteria 19128
53 IMNBL1DRAFT_c0000018 3300000062 Bacteria 172634
54 Ga0466705_005170 3300042612 Bacteria 7855
55 Ga0466712_271651 3300042614 Bacteria 2502
56 Ga0466715_046657 3300042616 Unclassified 10257
57 Ga0123355_10002658 3300009826 Bacteria 25377
58 Ga0123355_10072920 3300009826 Bacteria 5504
59 Ga0123355_10102139 3300009826 Bacteria 4510
60 Ga0123355_10162506 3300009826 Bacteria 3360
61 Ga0123356_10105425 3300010049 Bacteria 2712
62 Ga0123353_10017279 3300010167 Bacteria 10595
63 Ga0123354_10178480 3300010882 Bacteria 2435
64 Ga0466706_068109 3300042599 Bacteria 118995
65 Ga0466714_031030 3300042603 Bacteria 17966
66 IMNBL1DRAFT_c0000062 3300000062 Bacteria 97981
67 JGI24698J34947_10001843 3300002449 Bacteria 11307
68 JGI24700J35501_10930857 3300002508 Bacteria 28818
69 Ga0072940_1052271 3300005200 Bacteria 5953
70 Ga0466712_109559 3300042614 Bacteria 24027
71 Ga0466712_173813 3300042614 Bacteria 2920
72 Ga0466715_030584 3300042616 Bacteria 7051
73 Ga0123357_10121500 3300009784 Bacteria 3289
74 Ga0123355_10067291 3300009826 Bacteria 5765
75 Ga0123355_10178291 3300009826 Unclassified 3159
76 Ga0123356_10028883 3300010049 Bacteria 5198
77 Ga0123356_10034301 3300010049 Bacteria 4743
78 Ga0123356_10043552 3300010049 Bacteria 4179
79 Ga0123354_10133253 3300010882 Bacteria 3125
80 Ga0466699_051743 3300042597 Bacteria 3625
81 2227075226 2225789003 Unclassified 11217
82 2227635733 2225789004 Bacteria 11196
83 IMNBL1DRAFT_c0000023 3300000062 Bacteria 146871
84 JGI24703J35330_11741893 3300002501 Bacteria 3611
85 Ga0466712_270650 3300042614 Bacteria 2450
86 Ga0466723_008385 3300042618 Bacteria 4212
87 Ga0466728_051905 3300042620 Bacteria 9584
88 Ga0123355_10003467 3300009826 Bacteria 22603
89 Ga0123356_10095612 3300010049 Bacteria 2840
90 Ga0123353_10124845 3300010167 Bacteria 4137
91 Ga0123353_10340379 3300010167 Bacteria 2266
92 Ga0415639_015441 3300038395 Bacteria 9363
93 Ga0415639_118831 3300038395 Bacteria 9284
94 IMNBL1DRAFT_c0007070 3300000062 Unclassified 5976
95 JGI24695J34938_10001819 3300002450 Bacteria 17419
96 JGI24705J35276_12218423 3300002504 Bacteria 2144

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042643 Ga0466704_376516 Ga0466704_376516_119_1633 504
2 3300042610 Ga0466698_029833 Ga0466698_029833_17702_19516 552
3 3300042620 Ga0466728_116760 Ga0466728_116760_47_1714 555
4 3300042597 Ga0466699_051743 Ga0466699_051743_400_2076 558
5 3300042607 Ga0466720_028407 Ga0466720_028407_4569_6365 559
6 2225789004 2227275247 2227726161 565
7 3300002501 JGI24703J35330_11748332 JGI24703J35330_1174833210 565
8 3300000062 IMNBL1DRAFT_c0000023 IMNBL1DRAFT_000002352 566
9 3300042603 Ga0466714_124127 Ga0466714_124127_336_2105 569
10 3300005201 Ga0072941_1058636 Ga0072941_105863610 570
11 3300042597 Ga0466699_193920 Ga0466699_193920_603_2414 571
12 3300010167 Ga0123353_10124568 Ga0123353_101245683 572
13 3300042608 Ga0466721_136506 Ga0466721_136506_700_2490 572
14 3300010049 Ga0123356_10043552 Ga0123356_100435522 573
15 3300042603 Ga0466714_031030 Ga0466714_031030_1644_3365 573
16 3300042616 Ga0466715_030584 Ga0466715_030584_564_2285 573
17 3300000062 IMNBL1DRAFT_c0007070 IMNBL1DRAFT_00070703 574
18 3300009826 Ga0123355_10077047 Ga0123355_100770473 576
19 3300010049 Ga0123356_10123022 Ga0123356_101230222 576
20 3300038395 Ga0415639_015441 Ga0415639_015441_1137_2870 577
21 3300002462 JGI24702J35022_10021428 JGI24702J35022_100214282 578
22 3300042599 Ga0466706_068109 Ga0466706_068109_91742_93532 579
23 3300009826 Ga0123355_10034969 Ga0123355_100349693 580
24 3300010167 Ga0123353_10137402 Ga0123353_101374022 580
25 3300010049 Ga0123356_10058717 Ga0123356_100587173 581
26 3300042616 Ga0466715_046657 Ga0466715_046657_3129_4910 581
27 2225789004 2227635733 2228222538 583
28 3300009826 Ga0123355_10072920 Ga0123355_100729202 584
29 3300010049 Ga0123356_10034301 Ga0123356_100343013 584
30 3300010049 Ga0123356_10084898 Ga0123356_100848981 584
31 2225789003 2227075226 2227440023 585
32 3300009826 Ga0123355_10244546 Ga0123355_102445462 585
33 3300042594 Ga0466694_099719 Ga0466694_099719_105_1916 585
34 3300000062 IMNBL1DRAFT_c0000018 IMNBL1DRAFT_000001824 586
35 3300002449 JGI24698J34947_10001843 JGI24698J34947_100018433 586
36 3300010882 Ga0123354_10178480 Ga0123354_101784802 586
37 3300002504 JGI24705J35276_12218423 JGI24705J35276_122184231 587
38 3300010167 Ga0123353_10124845 Ga0123353_101248452 587
39 iso_pr_bacteria 2820348946 2820349069 587
40 3300002450 JGI24695J34938_10001819 JGI24695J34938_100018192 588
41 3300009826 Ga0123355_10002658 Ga0123355_1000265816 588
42 3300009826 Ga0123355_10067291 Ga0123355_100672914 588
43 3300009826 Ga0123355_10102139 Ga0123355_101021393 588
44 3300042620 Ga0466728_051905 Ga0466728_051905_1230_3029 588
45 3300009826 Ga0123355_10018945 Ga0123355_100189453 589
46 iso_pr_bacteria 2820229114 2820231112 589
47 3300009826 Ga0123355_10046858 Ga0123355_100468582 590
48 3300010049 Ga0123356_10034753 Ga0123356_100347533 590
49 2225789004 2227458578 2227894302 591
50 3300009826 Ga0123355_10000032 Ga0123355_10000032102 591
51 3300009826 Ga0123355_10043774 Ga0123355_100437745 591
52 3300009826 Ga0123355_10162506 Ga0123355_101625062 591
53 3300042612 Ga0466705_005170 Ga0466705_005170_2062_3837 591
54 iso_pr_bacteria 2820513949 2820515291 591
55 3300009826 Ga0123355_10096637 Ga0123355_100966373 592
56 3300009826 Ga0123355_10134856 Ga0123355_101348562 592
57 iso_pr_bacteria 2820309449 2820311686 592
58 3300002508 JGI24700J35501_10930902 JGI24700J35501_1093090237 593
59 3300042614 Ga0466712_109559 Ga0466712_109559_5784_7565 593
60 3300042618 Ga0466723_008385 Ga0466723_008385_2205_3986 593
61 iso_pr_bacteria 2820702360 2820705195 593
62 3300002449 JGI24698J34947_10006006 JGI24698J34947_100060062 594
63 3300042606 Ga0466719_192117 Ga0466719_192117_6539_8323 594
64 3300042612 Ga0466705_407683 Ga0466705_407683_681_2465 594
65 3300042614 Ga0466712_083267 Ga0466712_083267_5967_7751 594
66 3300042620 Ga0466728_273067 Ga0466728_273067_894_2678 594
67 iso_pr_bacteria 2820301196 2820302270 594
68 iso_pr_bacteria 2820481688 2820483110 594
69 iso_pr_bacteria 2820636287 2820637199 594
70 3300002508 JGI24700J35501_10930857 JGI24700J35501_1093085724 595
71 3300005200 Ga0072940_1052271 Ga0072940_10522712 595
72 3300009784 Ga0123357_10121500 Ga0123357_101215001 595
73 3300009826 Ga0123355_10178291 Ga0123355_101782912 595
74 3300038395 Ga0415639_118831 Ga0415639_118831_1633_3420 595
75 3300042614 Ga0466712_173813 Ga0466712_173813_188_1975 595
76 3300042614 Ga0466712_271651 Ga0466712_271651_538_2325 595
77 iso_pr_bacteria 2820329821 2820331091 595
78 iso_pr_bacteria 2864981449 2864985957 595
79 3300042607 Ga0466720_051486 Ga0466720_051486_4030_5844 596
80 iso_pr_bacteria 2820472365 2820474217 596
81 3300009826 Ga0123355_10021930 Ga0123355_100219303 597
82 3300010049 Ga0123356_10028883 Ga0123356_100288834 597
83 3300010049 Ga0123356_10121122 Ga0123356_101211222 597
84 3300042607 Ga0466720_149293 Ga0466720_149293_27015_28808 597
85 3300002501 JGI24703J35330_11741893 JGI24703J35330_117418932 598
86 3300009826 Ga0123355_10000395 Ga0123355_1000039536 598
87 3300010167 Ga0123353_10017279 Ga0123353_100172793 598
88 iso_pr_bacteria 2820469612 2820470800 598
89 3300009826 Ga0123355_10000018 Ga0123355_100000187 600
90 3300010049 Ga0123356_10006475 Ga0123356_100064756 600
91 2225789004 2227502410 2227986630 601
92 3300000062 IMNBL1DRAFT_c0000062 IMNBL1DRAFT_000006281 602
93 3300009826 Ga0123355_10003467 Ga0123355_100034676 602
94 3300010049 Ga0123356_10045495 Ga0123356_100454953 603
95 3300042597 Ga0466699_017092 Ga0466699_017092_2734_4545 603
96 3300042600 Ga0466700_013211 Ga0466700_013211_8035_9846 603
97 3300042649 Ga0466724_19735 Ga0466724_19735_558_2369 603
98 3300042614 Ga0466712_270650 Ga0466712_270650_538_2355 605
99 3300010049 Ga0123356_10000230 Ga0123356_100002302 606
100 3300010049 Ga0123356_10105425 Ga0123356_101054252 608
101 iso_pr_bacteria 2820257794 2820258275 609
102 iso_pr_bacteria 2820267566 2820267962 609
103 3300009826 Ga0123355_10014967 Ga0123355_100149672 611
104 3300010167 Ga0123353_10340379 Ga0123353_103403791 612
105 3300010167 Ga0123353_10127351 Ga0123353_101273512 613
106 3300010049 Ga0123356_10095612 Ga0123356_100956122 616
107 3300009826 Ga0123355_10108963 Ga0123355_101089632 618
108 3300010882 Ga0123354_10133253 Ga0123354_101332534 622
109 3300042599 Ga0466706_142380 Ga0466706_142380_2593_4464 623
110 3300042597 Ga0466699_162137 Ga0466699_162137_515_2470 632
111 iso_pr_bacteria 2820607737 2820609186 635

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00005 ABC_tran ABC transporter 411 560 0.85

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.79 0.83 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.