Protein Family IF12110

Metagenome Isolate
147 Members
83 Samples
86 Scaffolds
300.18 Avg Length

🧬 Representative Sequence

ID
iso_pr_bacteria|2820581541|2820582493|
Length
345 aa
Sequence
MTVFDEIAPLLSDFLTDEPMKNHTSFRIGGAADILAMPKTSDELIKIFKFCEEKNFPLTILGDGANVLVSDEGIRGVVVFTNKMKEISVRENKIFASAGARLSALAEAACVAGLAGLEFASGIPGTVGGAIFMNAGAFGFDISNFCEHVTLFYENKIVKKSNAEMEFAYRKSFVQRIAHEKIACAKKNSCEEKKLCEENSREENSCEEKKFREENSCVQKNSSSLCEILILDATFSLLRGEPELIREKMRELNGKRKNSQPLEFHSAGSFFKRPEGHYAGKLIEVCGLKGFSVGDAQVSEKHAGFVINRGNATAKNILELMHHVQKTVYEKFGVHLEPEVQMLGF

📊 Sample Types

Isolate 41.5%
Metagenome 58.5%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 59.0%
Apidae 18.1%
Termitidae 14.5%
Kalotermitidae 3.6%
Termopsidae 2.4%
Hodotermitidae 1.2%
Rhinotermitidae 1.2%

🌳 Taxonomy

Archaea 0
Bacteria 144
Eukaryota 0
Viruses 0
Unclassified 3

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2758568501 Lactobacillus bombicola ESL0228 Isolate Unclassified
2 2758568502 Lactobacillus bombicola ESL0247 Isolate Unclassified
3 2758568503 Lactobacillus bombicola ESL0246 Isolate Unclassified
4 2758568511 Lactobacillus apis ESL0263 Isolate Unclassified
5 2820254385 Unclassified Firmicutes Th196P3bin54 Isolate Unclassified
6 2820285501 Unclassified Firmicutes Th196P3bin142 Isolate Unclassified
7 2820546020 Unclassified Firmicutes Lab288P1bin102 Isolate Unclassified
8 2820620956 Unclassified Firmicutes Emb289P1bin128 Isolate Unclassified
9 8004832522 Lactobacillus sp. ESL0236 Isolate Apidae
10 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
11 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
12 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
13 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
14 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
15 2684622912 Lactobacillus apis Lb_185 Isolate Unclassified
16 2758568506 Lactobacillus bombicola ESL0230 Isolate Unclassified
17 2799112220 Lactobacillus sp. ESL0411 Isolate Unclassified
18 2820380671 Unclassified Firmicutes Nt197P1bin4 Isolate Unclassified
19 2820600392 Unclassified Firmicutes Emb289P1bin52 Isolate Unclassified
20 2820607737 Unclassified Firmicutes Emb289P1bin48 Isolate Unclassified
21 2814123166 Lactobacillus apis LMG 26964 Isolate Apidae
22 3300005721 Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 Metagenome Apidae
23 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
24 2882334426 Lactobacillus sp. 2-3 Isolate Unclassified
25 2758568509 Lactobacillus bombicola ESL0234 Isolate Unclassified
26 2758568510 Lactobacillus bombicola ESL0233 Isolate Unclassified
27 2820360414 Unclassified Firmicutes Nt197P3bin121 Isolate Unclassified
28 2820375548 Unclassified Firmicutes Nt197P1bin8 Isolate Unclassified
29 2820615445 Unclassified Firmicutes Emb289P1bin132 Isolate Unclassified
30 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
31 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
32 3300002501 Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 Metagenome Termitidae
33 2758568504 Lactobacillus bombicola ESL0245 Isolate Unclassified
34 2820378768 Unclassified Firmicutes Nt197P1bin7 Isolate Unclassified
35 2820382897 Unclassified Firmicutes Nt197P1bin3 Isolate Unclassified
36 2820513949 Unclassified Firmicutes Lab288P1bin39 Isolate Unclassified
37 2820693137 Unclassified Firmicutes Co191P1bin70 Isolate Unclassified
38 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
39 2877513988 Lactobacillus kullabergensis ESL0186 Isolate Apidae
40 2799112229 Lactobacillus sp. ESL0413 Isolate Unclassified
41 2799112230 Lactobacillus sp. ESL0416 Isolate Unclassified
42 2820240463 Unclassified Firmicutes Th196P3bin85 Isolate Unclassified
43 2820630457 Unclassified Firmicutes Emb289P1bin119 Isolate Unclassified
44 2785510748 Lactobacillus sp. ESL0409 Isolate Apidae
45 8017440191 Lactobacillus bombicola L5-31 Isolate Apidae
46 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
47 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
48 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
49 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
50 2912324399 Lactobacillus apis ESL0185 Isolate Apidae
51 2820259584 Unclassified Firmicutes Th196P3bin43 Isolate Unclassified
52 2820294436 Unclassified Firmicutes Th196P3bin104 Isolate Unclassified
53 2820581541 Unclassified Firmicutes Emb289P3bin127 Isolate Unclassified
54 2820702360 Unclassified Firmicutes Co191P1bin4 Isolate Unclassified
55 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
56 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
57 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
58 2758568505 Lactobacillus bombicola ESL0225 Isolate Unclassified
59 2820385248 Unclassified Firmicutes Nt197P1bin19 Isolate Unclassified
60 2820516196 Unclassified Firmicutes Lab288P1bin3 Isolate Unclassified
61 2820673891 Unclassified Firmicutes Co191P3bin18 Isolate Unclassified
62 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
63 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
64 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
65 2979949929 Lactobacillus sp. ESL0263 Isolate Apidae
66 2958885890 Lactobacillus sp. ESL0234 Isolate Apidae
67 2961465228 Lactobacillus sp. ESL0233 Isolate Apidae
68 2529293168 Ruminiclostridium cellobioparum termitidis CT1112 Isolate Termitidae
69 2684622911 Lactobacillus kullabergensis Lb_186 Isolate Unclassified
70 2758568507 Lactobacillus bombicola ESL0237 Isolate Unclassified
71 2758568508 Lactobacillus bombicola ESL0236 Isolate Unclassified
72 2820453354 Unclassified Firmicutes Lab288P3bin172 Isolate Unclassified
73 2820488713 Unclassified Firmicutes Lab288P1bin69 Isolate Unclassified
74 2820490862 Unclassified Firmicutes Lab288P1bin64 Isolate Unclassified
75 2820512088 Unclassified Firmicutes Lab288P1bin4 Isolate Unclassified
76 2820533259 Unclassified Firmicutes Lab288P1bin140 Isolate Unclassified
77 2820560510 Unclassified Firmicutes Emb289P3bin72 Isolate Unclassified
78 2820685979 Unclassified Firmicutes Co191P1bin81 Isolate Unclassified
79 8017458139 Lactobacillus johnsonii CRL1647 Isolate Apidae
80 3300000333 Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony Metagenome Apidae
81 2968368220 Lactobacillus bombicola OCC3 Isolate Apidae
82 2971062614 Lactobacillus bombicola BI-4G Isolate Apidae
83 3004719924 Lactobacillus sp. W8174 Isolate Apidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 HBC_ctgsDRAFT_1052828 3300000333 Unclassified 986
2 JGI24703J35330_11746652 3300002501 Bacteria 5485
3 Ga0074278_143879 3300005721 Bacteria 3061
4 Ga0466721_100978 3300042608 Bacteria 228571
5 Ga0123355_10000545 3300009826 Bacteria 50565
6 Ga0123355_10278593 3300009826 Bacteria 2312
7 Ga0123353_10084929 3300010167 Bacteria 5097
8 Ga0415639_005724 3300038395 Bacteria 12757
9 Ga0415639_040536 3300038395 Bacteria 8181
10 Ga0415639_108336 3300038395 Bacteria 1610
11 Ga0068305_10016904 3300005083 Bacteria 88006
12 Ga0074278_152103 3300005721 Bacteria 23008
13 Ga0466721_083763 3300042608 Bacteria 13763
14 Ga0123355_10000417 3300009826 Bacteria 55420
15 Ga0123355_10288115 3300009826 Bacteria 2257
16 Ga0123356_10002078 3300010049 Bacteria 21603
17 Ga0123356_10026130 3300010049 Bacteria 5486
18 Ga0123356_10060362 3300010049 Bacteria 3539
19 Ga0123353_10068676 3300010167 Bacteria 5692
20 Ga0123353_10308844 3300010167 Bacteria 2408
21 Ga0415639_005501 3300038395 Bacteria 17934
22 Ga0415639_029358 3300038395 Bacteria 18403
23 Ga0415639_051553 3300038395 Bacteria 7759
24 JGI24703J35330_11733879 3300002501 Bacteria 2874
25 JGI24703J35330_11748374 3300002501 Bacteria 14872
26 Ga0466706_216145 3300042599 Bacteria 1429
27 Ga0466728_124017 3300042620 Bacteria 4283
28 Ga0466728_128879 3300042620 Bacteria 3499
29 Ga0123355_10042235 3300009826 Bacteria 7422
30 Ga0123355_10107654 3300009826 Bacteria 4366
31 Ga0123353_10000031 3300010167 Bacteria 160211
32 Ga0415639_002004 3300038395 Bacteria 58965
33 Ga0415639_060641 3300038395 Bacteria 3836
34 Ga0466693_198870 3300042592 Bacteria 3394
35 Ga0466705_144292 3300042612 Bacteria 7905
36 JGI24703J35330_11748182 3300002501 Bacteria 11618
37 Ga0466706_016330 3300042599 Bacteria 1295
38 Ga0466713_100568 3300042602 Bacteria 78535
39 Ga0123355_10025924 3300009826 Bacteria 9448
40 Ga0123355_10174142 3300009826 Bacteria 3209
41 Ga0123355_10374865 3300009826 Bacteria 1860
42 Ga0123355_10434003 3300009826 Bacteria 1668
43 Ga0123353_10257547 3300010167 Bacteria 2698
44 Ga0415639_059330 3300038395 Bacteria 3817
45 Ga0466706_085272 3300042599 Bacteria 1924
46 Ga0466700_084561 3300042600 Bacteria 5608
47 Ga0466714_128441 3300042603 Bacteria 5937
48 Ga0466722_084229 3300042609 Bacteria 96990
49 Ga0466728_083691 3300042620 Unclassified 7264
50 Ga0123357_10153548 3300009784 Bacteria 2784
51 Ga0123355_10000480 3300009826 Bacteria 53005
52 Ga0123355_10023101 3300009826 Bacteria 9979
53 Ga0415639_005748 3300038395 Bacteria 5803
54 Ga0466727_150848 3300042655 Bacteria 3969
55 JGI24703J35330_11748731 3300002501 Bacteria 29662
56 Ga0466700_102167 3300042600 Bacteria 1890
57 Ga0466714_006129 3300042603 Bacteria 1265
58 Ga0466726_140068 3300042619 Bacteria 3754
59 Ga0466726_209048 3300042619 Bacteria 1831
60 Ga0123355_10000836 3300009826 Bacteria 42314
61 Ga0123355_10001827 3300009826 Bacteria 29774
62 Ga0123355_10280956 3300009826 Bacteria 2299
63 Ga0123356_10115279 3300010049 Bacteria 2603
64 Ga0415639_005596 3300038395 Unclassified 39897
65 Ga0466693_091172 3300042592 Bacteria 2027
66 Ga0466693_130472 3300042592 Bacteria 1635
67 JGI24695J34938_10000970 3300002450 Bacteria 26148
68 Ga0068305_10046174 3300005083 Bacteria 5078
69 Ga0466721_186361 3300042608 Bacteria 8064
70 Ga0466726_416718 3300042619 Bacteria 8118
71 Ga0123355_10000180 3300009826 Bacteria 77979
72 Ga0123355_10000913 3300009826 Bacteria 40903
73 Ga0123355_10032317 3300009826 Bacteria 8492
74 Ga0123355_10290944 3300009826 Bacteria 2242
75 Ga0123356_10118644 3300010049 Bacteria 2569
76 Ga0415639_005725 3300038395 Bacteria 7233
77 Ga0415639_006261 3300038395 Bacteria 24284
78 Ga0466727_306349 3300042655 Bacteria 6399
79 Ga0466706_171479 3300042599 Bacteria 2768
80 Ga0466711_095413 3300042615 Bacteria 2392
81 Ga0123357_10077853 3300009784 Bacteria 4371
82 Ga0123355_10000173 3300009826 Bacteria 78945
83 Ga0123356_10002775 3300010049 Bacteria 18597
84 Ga0123356_10018589 3300010049 Bacteria 6596
85 Ga0123353_10399230 3300010167 Bacteria 2047
86 Ga0415639_005747 3300038395 Bacteria 29446

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 iso_pr_bacteria 2820615445 2820615732 276
2 3300042599 Ga0466706_171479 Ga0466706_171479_1354_2190 278
3 3300009826 Ga0123355_10000913 Ga0123355_100009135 280
4 3300009826 Ga0123355_10290944 Ga0123355_102909441 281
5 3300042655 Ga0466727_306349 Ga0466727_306349_2334_3179 281
6 3300038395 Ga0415639_040536 Ga0415639_040536_4459_5319 286
7 3300038395 Ga0415639_059330 Ga0415639_059330_2127_2990 287
8 iso_pr_bacteria 2820375548 2820377205 287
9 3300002501 JGI24703J35330_11748182 JGI24703J35330_117481824 288
10 3300038395 Ga0415639_005596 Ga0415639_005596_34153_35028 291
11 3300009826 Ga0123355_10000180 Ga0123355_1000018021 292
12 3300038395 Ga0415639_108336 Ga0415639_108336_157_1035 292
13 iso_pr_bacteria 2820693137 2820694297 292
14 3300042600 Ga0466700_084561 Ga0466700_084561_3531_4412 293
15 iso_pr_bacteria 2820285501 2820287963 293
16 iso_pr_bacteria 2820490862 2820492748 293
17 iso_pr_bacteria 2820673891 2820675730 293
18 iso_pr_bacteria 2820685979 2820688144 293
19 3300002450 JGI24695J34938_10000970 JGI24695J34938_100009708 294
20 3300042592 Ga0466693_091172 Ga0466693_091172_508_1392 294
21 3300042599 Ga0466706_085272 Ga0466706_085272_270_1154 294
22 3300042603 Ga0466714_006129 Ga0466714_006129_311_1195 294
23 3300042603 Ga0466714_128441 Ga0466714_128441_134_1018 294
24 3300042608 Ga0466721_100978 Ga0466721_100978_178582_179466 294
25 iso_pr_bacteria 2820630457 2820630764 294
26 3300009826 Ga0123355_10000480 Ga0123355_1000048037 295
27 3300038395 Ga0415639_005501 Ga0415639_005501_5428_6315 295
28 3300038395 Ga0415639_005724 Ga0415639_005724_8235_9122 295
29 3300042599 Ga0466706_016330 Ga0466706_016330_75_962 295
30 3300042600 Ga0466700_102167 Ga0466700_102167_398_1285 295
31 iso_pr_bacteria 2820702360 2820705598 295
32 3300009826 Ga0123355_10000173 Ga0123355_1000017349 296
33 3300010167 Ga0123353_10399230 Ga0123353_103992302 296
34 3300038395 Ga0415639_005725 Ga0415639_005725_4778_5668 296
35 iso_pr_bacteria 2820380671 2820380719 296
36 3300002501 JGI24703J35330_11733879 JGI24703J35330_117338794 297
37 3300009826 Ga0123355_10374865 Ga0123355_103748652 297
38 3300010167 Ga0123353_10068676 Ga0123353_100686764 297
39 3300038395 Ga0415639_002004 Ga0415639_002004_37088_37981 297
40 3300038395 Ga0415639_060641 Ga0415639_060641_145_1038 297
41 iso_pr_bacteria 2820240463 2820242457 297
42 iso_pr_bacteria 2820607737 2820607953 297
43 3300009826 Ga0123355_10001827 Ga0123355_1000182731 298
44 3300038395 Ga0415639_006261 Ga0415639_006261_13339_14235 298
45 iso_pr_bacteria 2820453354 2820453404 298
46 3300009826 Ga0123355_10174142 Ga0123355_101741422 299
47 3300010167 Ga0123353_10000031 Ga0123353_1000003152 299
48 iso_pr_bacteria 2684622911 2686073447 299
49 iso_pr_bacteria 2684622912 2686075231 299
50 iso_pr_bacteria 2758568501 2760245606 299
51 iso_pr_bacteria 2758568502 2760247236 299
52 iso_pr_bacteria 2758568503 2760248898 299
53 iso_pr_bacteria 2758568504 2760250560 299
54 iso_pr_bacteria 2758568505 2760251588 299
55 iso_pr_bacteria 2758568506 2760253309 299
56 iso_pr_bacteria 2758568507 2760254963 299
57 iso_pr_bacteria 2758568508 2760256662 299
58 iso_pr_bacteria 2758568509 2760258361 299
59 iso_pr_bacteria 2758568510 2760260078 299
60 iso_pr_bacteria 2758568511 2760261807 299
61 iso_pr_bacteria 2785510748 2785747021 299
62 iso_pr_bacteria 2799112220 2799191179 299
63 iso_pr_bacteria 2799112229 2799228969 299
64 iso_pr_bacteria 2799112230 2799231299 299
65 iso_pr_bacteria 2814123166 2815022172 299
66 iso_pr_bacteria 2820385248 2820387242 299
67 iso_pr_bacteria 2820516196 2820516348 299
68 iso_pr_bacteria 2820546020 2820546867 299
69 iso_pr_bacteria 2877513988 2877514699 299
70 iso_pr_bacteria 2882334426 2882335159 299
71 iso_pr_bacteria 2912324399 2912324969 299
72 iso_pr_bacteria 2958885890 2958886420 299
73 iso_pr_bacteria 2961465228 2961465770 299
74 iso_pr_bacteria 2968368220 2968369553 299
75 iso_pr_bacteria 2971062614 2971062706 299
76 iso_pr_bacteria 2979949929 2979950545 299
77 iso_pr_bacteria 3004719924 3004721461 299
78 iso_pr_bacteria 8004832522 8004833050 299
79 iso_pr_bacteria 8017440191 8017441776 299
80 3300000333 HBC_ctgsDRAFT_1052828 HBC_ctgsDRAFT_10528281 300
81 3300002501 JGI24703J35330_11748731 JGI24703J35330_1174873114 300
82 3300005721 Ga0074278_143879 Ga0074278_1438793 300
83 3300005721 Ga0074278_152103 Ga0074278_1521034 300
84 3300009826 Ga0123355_10025924 Ga0123355_100259242 300
85 3300009826 Ga0123355_10278593 Ga0123355_102785933 300
86 3300009826 Ga0123355_10434003 Ga0123355_104340032 300
87 3300042592 Ga0466693_198870 Ga0466693_198870_1870_2772 300
88 3300042602 Ga0466713_100568 Ga0466713_100568_6792_7694 300
89 iso_pr_bacteria 2820382897 2820383545 300
90 iso_pr_bacteria 2820488713 2820489867 300
91 iso_pr_bacteria 2820512088 2820513761 300
92 3300002501 JGI24703J35330_11748374 JGI24703J35330_117483749 301
93 3300009784 Ga0123357_10153548 Ga0123357_101535483 301
94 3300009826 Ga0123355_10288115 Ga0123355_102881152 301
95 3300042609 Ga0466722_084229 Ga0466722_084229_92319_93224 301
96 iso_pr_bacteria 2820533259 2820533529 301
97 iso_pr_bacteria 8017458139 8017460174 301
98 3300009784 Ga0123357_10077853 Ga0123357_100778532 302
99 3300010049 Ga0123356_10118644 Ga0123356_101186441 302
100 3300042615 Ga0466711_095413 Ga0466711_095413_672_1580 302
101 iso_pr_bacteria 2820360414 2820361650 302
102 iso_pr_bacteria 2820513949 2820514020 302
103 3300009826 Ga0123355_10000417 Ga0123355_1000041741 303
104 3300038395 Ga0415639_005747 Ga0415639_005747_3292_4203 303
105 3300038395 Ga0415639_005748 Ga0415639_005748_366_1277 303
106 3300042619 Ga0466726_140068 Ga0466726_140068_47_958 303
107 iso_pr_bacteria 2820560510 2820562816 303
108 3300009826 Ga0123355_10042235 Ga0123355_100422357 304
109 3300010049 Ga0123356_10002078 Ga0123356_1000207811 304
110 3300010167 Ga0123353_10084929 Ga0123353_100849293 304
111 3300042592 Ga0466693_130472 Ga0466693_130472_40_954 304
112 3300042619 Ga0466726_416718 Ga0466726_416718_2106_3020 304
113 iso_pr_bacteria 2529293168 2531456196 304
114 iso_pr_bacteria 2820259584 2820260282 304
115 iso_pr_bacteria 2820620956 2820621811 304
116 3300009826 Ga0123355_10000545 Ga0123355_1000054512 305
117 3300009826 Ga0123355_10000836 Ga0123355_1000083626 305
118 3300010167 Ga0123353_10308844 Ga0123353_103088441 305
119 3300042608 Ga0466721_186361 Ga0466721_186361_6978_7895 305
120 iso_pr_bacteria 2820600392 2820600502 305
121 3300005083 Ga0068305_10016904 Ga0068305_100169049 306
122 3300009826 Ga0123355_10107654 Ga0123355_101076542 306
123 3300042608 Ga0466721_083763 Ga0466721_083763_2860_3780 306
124 3300042612 Ga0466705_144292 Ga0466705_144292_3236_4156 306
125 3300042619 Ga0466726_209048 Ga0466726_209048_655_1575 306
126 3300042655 Ga0466727_150848 Ga0466727_150848_372_1292 306
127 iso_pr_bacteria 2820294436 2820295163 307
128 3300005083 Ga0068305_10046174 Ga0068305_100461742 308
129 3300038395 Ga0415639_029358 Ga0415639_029358_2995_3921 308
130 3300042620 Ga0466728_083691 Ga0466728_083691_419_1345 308
131 3300042620 Ga0466728_128879 Ga0466728_128879_835_1761 308
132 3300009826 Ga0123355_10032317 Ga0123355_100323173 309
133 3300038395 Ga0415639_051553 Ga0415639_051553_3184_4113 309
134 3300009826 Ga0123355_10280956 Ga0123355_102809562 310
135 3300010049 Ga0123356_10026130 Ga0123356_100261302 310
136 iso_pr_bacteria 2820378768 2820379900 310
137 3300002501 JGI24703J35330_11746652 JGI24703J35330_117466525 311
138 3300010049 Ga0123356_10115279 Ga0123356_101152792 311
139 iso_pr_bacteria 2820254385 2820255651 311
140 3300010049 Ga0123356_10002775 Ga0123356_1000277512 312
141 3300010049 Ga0123356_10018589 Ga0123356_100185894 312
142 3300010049 Ga0123356_10060362 Ga0123356_100603622 312
143 3300042599 Ga0466706_216145 Ga0466706_216145_296_1234 312
144 3300042620 Ga0466728_124017 Ga0466728_124017_1182_2126 314
145 3300010167 Ga0123353_10257547 Ga0123353_102575472 322
146 3300009826 Ga0123355_10023101 Ga0123355_100231017 327
147 iso_pr_bacteria 2820581541 2820582493 345

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF02873 MurB_C UDP-N-acetylenolpyruvoylglucosamine reductase, C-terminal domain 245 343 0.98
PF01565 FAD_binding_4 FAD binding domain 33 150 0.87

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF02873 GO:0008762 UDP-N-acetylmuramate dehydrogenase activity MF
PF01565 GO:0050660 flavin adenine dinucleotide binding MF

🏗️ Structural Annotation – Top 5 Hits

IDDescriptionScoreStartEnd
4pyt-assembly1.cif.gz_A Crystal structure of a MurB family EP-UDP-N-acetylglucosamine reductase 0.951 3 345
1hsk-assembly1.cif.gz_A CRYSTAL STRUCTURE OF S. AUREUS MURB 0.946 3 345
3tx1-assembly1.cif.gz_A X-ray crystal structure of Listeria monocytogenes EGD-e UDP-N-acetylenolpyruvylglucosamine reductase (MurB) 0.946 13 345
2gqu-assembly1.cif.gz_A Crystal Structure of UDP-N-Acetylenolpyruvylglucosamine Reductase (MurB) from Thermus caldophilus 0.904 13 343
5jzx-assembly3.cif.gz_E Crystal Structure of UDP-N-acetylenolpyruvoylglucosamine reductase (MurB) from Mycobacterium tuberculosis 0.827 11 345
IDDescriptionScoreStartEndSuperfamily
3tx1A03 Alpha Beta;Alpha-Beta Complex;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 1;UDP-N-acetylenolpyruvoylglucosamine reductase, C-terminal domain 0.9872 261 345 3.90.78.10
3tx1A01 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 0.9638 13 85 3.30.43.10
4pytA01 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 0.9543 3 80 3.30.43.10
4pytA02 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; 0.935 86 260 3.30.465.10
3tx1A02 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; 0.9326 86 260 3.30.465.10
IDDescriptionScoreStartEndGO Terms
AF-X1F496-F1-model_v4 UDP-N-acetylenolpyruvoylglucosamine reductase C-terminal domain-containing protein 0.9945 268 345 GO:0005829
GO:0050660
GO:0008762
GO:0071555

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.86 0.91 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.