Protein Family IF12104
Metagenome
Isolate
129
Members
46
Samples
115
Scaffolds
265.82
Avg Length
Representative Sequence
- ID
- iso_pr_bacteria|2820551407|2820554933|
- Length
- 270 aa
- Sequence
- MIIDFHTHIFPDKIAERTIASLFEEAKGIYIPVSDGTVSGLLKNMNEWNIDISIVQPIVTKQSQTKNINEWAAEISRDYTGKIISFGGIFPHTDDYKRDIDFVVSLGLKGLKFHAEYQDFIIDGEKMLKIYDYALSKNLIILHHAGFDPAYPEPFKSNPERFAHIIKKMRGGIIIAAHLGGHAQWDDVEKYLCGTDIYLDTSMGFEYFSKEQFLRIVKNHGSDKILFGSDAPWSNAKTEIEHLKTLSPSEISEAGLNAILSGNAKRILQI
Sample Types
Isolate
10.8%
Metagenome
89.2%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
52.3%
Unclassified
31.8%
Kalotermitidae
11.4%
Termopsidae
2.3%
Passalidae
2.3%
Taxonomy
Archaea
3
Bacteria
114
Eukaryota
0
Viruses
1
Unclassified
11
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820220859 | Unclassified Firmicutes Th196P4bin59 | Isolate | Unclassified |
| 2 | 2820332331 | Unclassified Firmicutes Nt197P3bin75 | Isolate | Unclassified |
| 3 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 4 | 2585428085 | Sporobacter termitidis DSM 10068 | Isolate | Termitidae |
| 5 | 2820227065 | Unclassified Firmicutes Th196P4bin44 | Isolate | Unclassified |
| 6 | 2791354839 | Unclassified Chloroflexi Co191P4bin10 | Isolate | Unclassified |
| 7 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 8 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 9 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 10 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 11 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 12 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 13 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 14 | 2820408893 | Unclassified Firmicutes Lab288P4bin80 | Isolate | Unclassified |
| 15 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 16 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 17 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 18 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 19 | 2820272499 | Unclassified Firmicutes Th196P3bin18 | Isolate | Unclassified |
| 20 | 2820282995 | Unclassified Firmicutes Th196P3bin147 | Isolate | Unclassified |
| 21 | 2820362221 | Unclassified Firmicutes Nt197P3bin116 | Isolate | Unclassified |
| 22 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 23 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 24 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 25 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 26 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 27 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 28 | 2820800812 | Unclassified Actinobacteria Th196P4bin28 | Isolate | Unclassified |
| 29 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 30 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 31 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 32 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 33 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 34 | 2820296961 | Unclassified Firmicutes Th196P3bin102 | Isolate | Unclassified |
| 35 | 2820729191 | Unclassified Chloroflexi Th196P4bin49 | Isolate | Unclassified |
| 36 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 37 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 38 | 2820551407 | Unclassified Firmicutes Emb289P4bin38 | Isolate | Unclassified |
| 39 | 2819999932 | Unclassified Synergistetes Th196P4bin51 | Isolate | Unclassified |
| 40 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 41 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 42 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 43 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 44 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 45 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 46 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466697_131209 | 3300042611 | Bacteria | 2809 |
| 2 | Ga0123356_10030715 | 3300010049 | Archaea | 5027 |
| 3 | Ga0123356_10067970 | 3300010049 | Bacteria | 3337 |
| 4 | Ga0123356_10241978 | 3300010049 | Unclassified | 1876 |
| 5 | Ga0123353_10011723 | 3300010167 | Bacteria | 12377 |
| 6 | Ga0466693_059379 | 3300042592 | Bacteria | 1430 |
| 7 | Ga0466734_090378 | 3300042623 | Bacteria | 2278 |
| 8 | Ga0466702_118405 | 3300042635 | Bacteria | 24941 |
| 9 | Ga0466702_141392 | 3300042635 | Bacteria | 4921 |
| 10 | Ga0466704_442002 | 3300042643 | Bacteria | 11691 |
| 11 | Ga0466700_209544 | 3300042600 | Bacteria | 1012 |
| 12 | Ga0466714_017089 | 3300042603 | Bacteria | 3977 |
| 13 | JGI24702J35022_10000177 | 3300002462 | Bacteria | 33679 |
| 14 | JGI24702J35022_10005403 | 3300002462 | Bacteria | 7477 |
| 15 | JGI24702J35022_10102122 | 3300002462 | Bacteria | 1571 |
| 16 | JGI24702J35022_10135874 | 3300002462 | Bacteria | 1368 |
| 17 | Ga0466732_152970 | 3300042656 | Bacteria | 5027 |
| 18 | Ga0466733_014771 | 3300042659 | Bacteria | 2689 |
| 19 | Ga0123357_10036891 | 3300009784 | Bacteria | 6652 |
| 20 | Ga0123356_10061084 | 3300010049 | Bacteria | 3518 |
| 21 | Ga0123356_10135503 | 3300010049 | Bacteria | 2420 |
| 22 | Ga0123353_10495889 | 3300010167 | Bacteria | 1781 |
| 23 | Ga0123353_10677597 | 3300010167 | Bacteria | 1453 |
| 24 | Ga0123353_10903808 | 3300010167 | Bacteria | 1202 |
| 25 | Ga0123354_10023076 | 3300010882 | Bacteria | 9812 |
| 26 | Ga0466699_378680 | 3300042597 | Bacteria | 1339 |
| 27 | Ga0466702_162822 | 3300042635 | Bacteria | 2939 |
| 28 | Ga0466700_246267 | 3300042600 | Bacteria | 1047 |
| 29 | Ga0466707_370458 | 3300042601 | Bacteria | 6394 |
| 30 | Ga0466719_215123 | 3300042606 | Bacteria | 4684 |
| 31 | JGI24696J40584_12956918 | 3300002834 | Archaea | 3282 |
| 32 | Ga0123356_10355433 | 3300010049 | Bacteria | 1590 |
| 33 | Ga0123353_10272803 | 3300010167 | Bacteria | 2604 |
| 34 | Ga0123354_10406107 | 3300010882 | Bacteria | 1147 |
| 35 | Ga0264413_141546 | 3300024493 | Bacteria | 7312 |
| 36 | Ga0466693_000110 | 3300042592 | Viruses | 2716 |
| 37 | Ga0466707_070313 | 3300042601 | Bacteria | 7567 |
| 38 | Ga0466714_014339 | 3300042603 | Bacteria | 1495 |
| 39 | Ga0466714_137862 | 3300042603 | Unclassified | 2112 |
| 40 | JGI24702J35022_10024144 | 3300002462 | Bacteria | 3284 |
| 41 | Ga0072941_1229741 | 3300005201 | Bacteria | 5001 |
| 42 | Ga0466697_165516 | 3300042611 | Bacteria | 6085 |
| 43 | Ga0123357_10048804 | 3300009784 | Bacteria | 5736 |
| 44 | Ga0123356_10037937 | 3300010049 | Bacteria | 4492 |
| 45 | Ga0123353_10102951 | 3300010167 | Bacteria | 4602 |
| 46 | Ga0123353_10281943 | 3300010167 | Bacteria | 2551 |
| 47 | Ga0123353_10635791 | 3300010167 | Unclassified | 1515 |
| 48 | Ga0123353_11260997 | 3300010167 | Bacteria | 964 |
| 49 | Ga0123354_10168013 | 3300010882 | Bacteria | 2568 |
| 50 | Ga0123354_10351975 | 3300010882 | Bacteria | 1311 |
| 51 | Ga0466726_166351 | 3300042619 | Bacteria | 13472 |
| 52 | Ga0466698_286511 | 3300042610 | Bacteria | 66842 |
| 53 | 2227522981 | 2225789004 | Bacteria | 3303 |
| 54 | JGI24702J35022_10014300 | 3300002462 | Bacteria | 4379 |
| 55 | JGI24702J35022_10082319 | 3300002462 | Bacteria | 1744 |
| 56 | Ga0466705_007741 | 3300042612 | Bacteria | 21651 |
| 57 | Ga0123357_10030739 | 3300009784 | Bacteria | 7283 |
| 58 | Ga0123357_10146144 | 3300009784 | Bacteria | 2887 |
| 59 | Ga0123356_10183867 | 3300010049 | Bacteria | 2114 |
| 60 | Ga0123353_10068726 | 3300010167 | Bacteria | 5689 |
| 61 | Ga0123353_11039878 | 3300010167 | Bacteria | 1095 |
| 62 | Ga0123354_10153882 | 3300010882 | Bacteria | 2770 |
| 63 | Ga0466657_053669 | 3300042582 | Bacteria | 6340 |
| 64 | Ga0466696_238815 | 3300042596 | Bacteria | 2679 |
| 65 | Ga0466702_196164 | 3300042635 | Bacteria | 1397 |
| 66 | Ga0466700_016959 | 3300042600 | Bacteria | 1815 |
| 67 | Ga0466714_051585 | 3300042603 | Unclassified | 2709 |
| 68 | Ga0466714_143479 | 3300042603 | Bacteria | 11314 |
| 69 | Ga0466721_120579 | 3300042608 | Unclassified | 1673 |
| 70 | JGI24702J35022_10000135 | 3300002462 | Unclassified | 36738 |
| 71 | Ga0466733_055192 | 3300042659 | Bacteria | 2210 |
| 72 | Ga0123356_10004264 | 3300010049 | Bacteria | 14796 |
| 73 | Ga0123353_10116997 | 3300010167 | Bacteria | 4289 |
| 74 | Ga0123353_10181196 | 3300010167 | Unclassified | 3334 |
| 75 | Ga0123353_10357100 | 3300010167 | Bacteria | 2198 |
| 76 | Ga0123353_10710849 | 3300010167 | Unclassified | 1408 |
| 77 | Ga0466702_228102 | 3300042635 | Bacteria | 1522 |
| 78 | Ga0466712_204899 | 3300042614 | Bacteria | 1210 |
| 79 | Ga0466714_085340 | 3300042603 | Bacteria | 3981 |
| 80 | Ga0466714_105381 | 3300042603 | Bacteria | 4973 |
| 81 | Ga0466714_120284 | 3300042603 | Bacteria | 5899 |
| 82 | Ga0466697_059841 | 3300042611 | Bacteria | 1255 |
| 83 | Ga0123357_10341842 | 3300009784 | Archaea | 1446 |
| 84 | Ga0123356_10248844 | 3300010049 | Bacteria | 1854 |
| 85 | Ga0123356_10249185 | 3300010049 | Bacteria | 1853 |
| 86 | Ga0123356_10622210 | 3300010049 | Bacteria | 1245 |
| 87 | Ga0123356_10991587 | 3300010049 | Bacteria | 1010 |
| 88 | Ga0123353_10183487 | 3300010167 | Bacteria | 3310 |
| 89 | Ga0123353_10221894 | 3300010167 | Bacteria | 2954 |
| 90 | Ga0123353_10251968 | 3300010167 | Bacteria | 2734 |
| 91 | Ga0123353_10301809 | 3300010167 | Bacteria | 2443 |
| 92 | Ga0123354_10219985 | 3300010882 | Unclassified | 2021 |
| 93 | Ga0466731_315241 | 3300042622 | Bacteria | 1288 |
| 94 | Ga0466702_109156 | 3300042635 | Bacteria | 7744 |
| 95 | Ga0466702_111703 | 3300042635 | Bacteria | 5642 |
| 96 | Ga0466702_111764 | 3300042635 | Bacteria | 2920 |
| 97 | Ga0466702_449094 | 3300042635 | Bacteria | 6499 |
| 98 | Ga0466704_186712 | 3300042643 | Bacteria | 6167 |
| 99 | Ga0466710_105767 | 3300042613 | Bacteria | 10561 |
| 100 | Ga0466714_073378 | 3300042603 | Bacteria | 1481 |
| 101 | JGI24702J35022_10000147 | 3300002462 | Bacteria | 35962 |
| 102 | Ga0123357_10013285 | 3300009784 | Unclassified | 10673 |
| 103 | Ga0123356_10005057 | 3300010049 | Bacteria | 13516 |
| 104 | Ga0123353_10186350 | 3300010167 | Bacteria | 3281 |
| 105 | Ga0123353_11052000 | 3300010167 | Bacteria | 1087 |
| 106 | Ga0466693_094994 | 3300042592 | Bacteria | 2029 |
| 107 | Ga0466699_006244 | 3300042597 | Bacteria | 1812 |
| 108 | Ga0466731_049158 | 3300042622 | Bacteria | 1680 |
| 109 | Ga0466702_029237 | 3300042635 | Bacteria | 4519 |
| 110 | Ga0466702_059723 | 3300042635 | Bacteria | 1774 |
| 111 | Ga0466715_426614 | 3300042616 | Bacteria | 43225 |
| 112 | Ga0466718_123306 | 3300042617 | Bacteria | 3123 |
| 113 | Ga0466714_091019 | 3300042603 | Unclassified | 1455 |
| 114 | JGI24702J35022_10015138 | 3300002462 | Bacteria | 4249 |
| 115 | JGI24702J35022_10104204 | 3300002462 | Bacteria | 1556 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042597 | Ga0466699_006244 | Ga0466699_006244_535_1254 | 239 |
| 2 | 3300042592 | Ga0466693_094994 | Ga0466693_094994_363_1103 | 246 |
| 3 | 3300042623 | Ga0466734_090378 | Ga0466734_090378_1514_2254 | 246 |
| 4 | 3300042603 | Ga0466714_091019 | Ga0466714_091019_29_823 | 248 |
| 5 | 3300042635 | Ga0466702_111703 | Ga0466702_111703_3740_4486 | 248 |
| 6 | 3300010167 | Ga0123353_10272803 | Ga0123353_102728032 | 250 |
| 7 | 3300042597 | Ga0466699_378680 | Ga0466699_378680_14_769 | 251 |
| 8 | 3300009784 | Ga0123357_10013285 | Ga0123357_100132852 | 258 |
| 9 | 3300042643 | Ga0466704_442002 | Ga0466704_442002_1329_2117 | 262 |
| 10 | 2225789004 | 2227522981 | 2228028163 | 263 |
| 11 | 3300010049 | Ga0123356_10622210 | Ga0123356_106222102 | 263 |
| 12 | 3300042603 | Ga0466714_051585 | Ga0466714_051585_1768_2559 | 263 |
| 13 | 3300002462 | JGI24702J35022_10102122 | JGI24702J35022_101021222 | 264 |
| 14 | 3300002462 | JGI24702J35022_10135874 | JGI24702J35022_101358742 | 264 |
| 15 | 3300010049 | Ga0123356_10183867 | Ga0123356_101838672 | 264 |
| 16 | 3300010049 | Ga0123356_10241978 | Ga0123356_102419781 | 264 |
| 17 | 3300010167 | Ga0123353_10011723 | Ga0123353_100117236 | 264 |
| 18 | 3300010167 | Ga0123353_10635791 | Ga0123353_106357912 | 264 |
| 19 | 3300042582 | Ga0466657_053669 | Ga0466657_053669_593_1387 | 264 |
| 20 | 3300042592 | Ga0466693_000110 | Ga0466693_000110_1121_1915 | 264 |
| 21 | 3300042596 | Ga0466696_238815 | Ga0466696_238815_919_1713 | 264 |
| 22 | 3300042600 | Ga0466700_016959 | Ga0466700_016959_632_1426 | 264 |
| 23 | 3300042600 | Ga0466700_246267 | Ga0466700_246267_67_861 | 264 |
| 24 | 3300042601 | Ga0466707_070313 | Ga0466707_070313_5211_6005 | 264 |
| 25 | 3300042603 | Ga0466714_014339 | Ga0466714_014339_451_1245 | 264 |
| 26 | 3300042603 | Ga0466714_017089 | Ga0466714_017089_302_1096 | 264 |
| 27 | 3300042603 | Ga0466714_073378 | Ga0466714_073378_466_1260 | 264 |
| 28 | 3300042603 | Ga0466714_085340 | Ga0466714_085340_2657_3451 | 264 |
| 29 | 3300042603 | Ga0466714_120284 | Ga0466714_120284_1896_2690 | 264 |
| 30 | 3300042603 | Ga0466714_143479 | Ga0466714_143479_146_940 | 264 |
| 31 | 3300042608 | Ga0466721_120579 | Ga0466721_120579_584_1378 | 264 |
| 32 | 3300042611 | Ga0466697_059841 | Ga0466697_059841_370_1164 | 264 |
| 33 | 3300042611 | Ga0466697_131209 | Ga0466697_131209_1479_2273 | 264 |
| 34 | 3300042611 | Ga0466697_165516 | Ga0466697_165516_2869_3663 | 264 |
| 35 | 3300042613 | Ga0466710_105767 | Ga0466710_105767_6880_7674 | 264 |
| 36 | 3300042614 | Ga0466712_204899 | Ga0466712_204899_270_1064 | 264 |
| 37 | 3300042619 | Ga0466726_166351 | Ga0466726_166351_8403_9197 | 264 |
| 38 | 3300042635 | Ga0466702_029237 | Ga0466702_029237_813_1607 | 264 |
| 39 | 3300042635 | Ga0466702_059723 | Ga0466702_059723_455_1249 | 264 |
| 40 | 3300042635 | Ga0466702_109156 | Ga0466702_109156_855_1649 | 264 |
| 41 | 3300042635 | Ga0466702_111764 | Ga0466702_111764_504_1298 | 264 |
| 42 | 3300042635 | Ga0466702_118405 | Ga0466702_118405_6387_7181 | 264 |
| 43 | 3300042635 | Ga0466702_141392 | Ga0466702_141392_4011_4805 | 264 |
| 44 | 3300042635 | Ga0466702_228102 | Ga0466702_228102_500_1294 | 264 |
| 45 | 3300042659 | Ga0466733_055192 | Ga0466733_055192_590_1384 | 264 |
| 46 | iso_pr_bacteria | 2585428085 | 2587836562 | 264 |
| 47 | iso_pr_bacteria | 2820220859 | 2820221554 | 264 |
| 48 | iso_pr_bacteria | 2820227065 | 2820228053 | 264 |
| 49 | iso_pr_bacteria | 2820282995 | 2820285338 | 264 |
| 50 | iso_pr_bacteria | 2820296961 | 2820297931 | 264 |
| 51 | iso_pr_bacteria | 2820729191 | 2820729364 | 264 |
| 52 | iso_pr_bacteria | 2820800812 | 2820801774 | 264 |
| 53 | 3300002462 | JGI24702J35022_10000135 | JGI24702J35022_1000013535 | 265 |
| 54 | 3300002462 | JGI24702J35022_10000147 | JGI24702J35022_1000014725 | 265 |
| 55 | 3300002462 | JGI24702J35022_10000177 | JGI24702J35022_100001776 | 265 |
| 56 | 3300002462 | JGI24702J35022_10015138 | JGI24702J35022_100151383 | 265 |
| 57 | 3300002462 | JGI24702J35022_10024144 | JGI24702J35022_100241441 | 265 |
| 58 | 3300002462 | JGI24702J35022_10082319 | JGI24702J35022_100823192 | 265 |
| 59 | 3300005201 | Ga0072941_1229741 | Ga0072941_12297414 | 265 |
| 60 | 3300009784 | Ga0123357_10030739 | Ga0123357_100307392 | 265 |
| 61 | 3300009784 | Ga0123357_10146144 | Ga0123357_101461442 | 265 |
| 62 | 3300010049 | Ga0123356_10005057 | Ga0123356_100050577 | 265 |
| 63 | 3300010049 | Ga0123356_10030715 | Ga0123356_100307155 | 265 |
| 64 | 3300010049 | Ga0123356_10037937 | Ga0123356_100379374 | 265 |
| 65 | 3300010049 | Ga0123356_10067970 | Ga0123356_100679702 | 265 |
| 66 | 3300010049 | Ga0123356_10135503 | Ga0123356_101355032 | 265 |
| 67 | 3300010049 | Ga0123356_10248844 | Ga0123356_102488442 | 265 |
| 68 | 3300010049 | Ga0123356_10991587 | Ga0123356_109915871 | 265 |
| 69 | 3300010167 | Ga0123353_10116997 | Ga0123353_101169974 | 265 |
| 70 | 3300010167 | Ga0123353_10181196 | Ga0123353_101811963 | 265 |
| 71 | 3300010167 | Ga0123353_10221894 | Ga0123353_102218942 | 265 |
| 72 | 3300010167 | Ga0123353_10301809 | Ga0123353_103018093 | 265 |
| 73 | 3300010167 | Ga0123353_10495889 | Ga0123353_104958891 | 265 |
| 74 | 3300010167 | Ga0123353_10677597 | Ga0123353_106775972 | 265 |
| 75 | 3300010167 | Ga0123353_10903808 | Ga0123353_109038081 | 265 |
| 76 | 3300010167 | Ga0123353_11039878 | Ga0123353_110398782 | 265 |
| 77 | 3300010167 | Ga0123353_11052000 | Ga0123353_110520001 | 265 |
| 78 | 3300010882 | Ga0123354_10219985 | Ga0123354_102199852 | 265 |
| 79 | 3300010882 | Ga0123354_10351975 | Ga0123354_103519752 | 265 |
| 80 | 3300010882 | Ga0123354_10406107 | Ga0123354_104061072 | 265 |
| 81 | 3300024493 | Ga0264413_141546 | Ga0264413_1415468 | 265 |
| 82 | 3300042600 | Ga0466700_209544 | Ga0466700_209544_70_867 | 265 |
| 83 | 3300042603 | Ga0466714_105381 | Ga0466714_105381_367_1164 | 265 |
| 84 | 3300042606 | Ga0466719_215123 | Ga0466719_215123_3271_4068 | 265 |
| 85 | 3300042612 | Ga0466705_007741 | Ga0466705_007741_20350_21147 | 265 |
| 86 | 3300042622 | Ga0466731_049158 | Ga0466731_049158_560_1357 | 265 |
| 87 | 3300042622 | Ga0466731_315241 | Ga0466731_315241_449_1246 | 265 |
| 88 | 3300042635 | Ga0466702_196164 | Ga0466702_196164_206_1003 | 265 |
| 89 | 3300042643 | Ga0466704_186712 | Ga0466704_186712_4466_5263 | 265 |
| 90 | 3300042659 | Ga0466733_014771 | Ga0466733_014771_1185_1982 | 265 |
| 91 | 3300010049 | Ga0123356_10004264 | Ga0123356_100042642 | 266 |
| 92 | 3300010049 | Ga0123356_10061084 | Ga0123356_100610843 | 266 |
| 93 | 3300010049 | Ga0123356_10249185 | Ga0123356_102491853 | 266 |
| 94 | 3300010882 | Ga0123354_10168013 | Ga0123354_101680133 | 266 |
| 95 | 3300042601 | Ga0466707_370458 | Ga0466707_370458_5539_6339 | 266 |
| 96 | 3300042616 | Ga0466715_426614 | Ga0466715_426614_15828_16628 | 266 |
| 97 | 3300042635 | Ga0466702_449094 | Ga0466702_449094_5582_6382 | 266 |
| 98 | iso_pr_bacteria | 2819999932 | 2820000986 | 266 |
| 99 | 3300002462 | JGI24702J35022_10005403 | JGI24702J35022_100054031 | 267 |
| 100 | 3300002462 | JGI24702J35022_10014300 | JGI24702J35022_100143002 | 267 |
| 101 | 3300009784 | Ga0123357_10036891 | Ga0123357_100368913 | 267 |
| 102 | 3300010167 | Ga0123353_10186350 | Ga0123353_101863502 | 267 |
| 103 | 3300010167 | Ga0123353_10357100 | Ga0123353_103571001 | 267 |
| 104 | iso_pr_bacteria | 2791354839 | 2791679419 | 267 |
| 105 | iso_pr_bacteria | 2820362221 | 2820364384 | 267 |
| 106 | 3300002462 | JGI24702J35022_10104204 | JGI24702J35022_101042042 | 268 |
| 107 | 3300002834 | JGI24696J40584_12956918 | JGI24696J40584_129569182 | 268 |
| 108 | 3300042592 | Ga0466693_059379 | Ga0466693_059379_152_958 | 268 |
| 109 | 3300042610 | Ga0466698_286511 | Ga0466698_286511_7429_8235 | 268 |
| 110 | 3300042635 | Ga0466702_162822 | Ga0466702_162822_1498_2304 | 268 |
| 111 | iso_pr_bacteria | 2820332331 | 2820332998 | 268 |
| 112 | 3300009784 | Ga0123357_10341842 | Ga0123357_103418422 | 269 |
| 113 | 3300010167 | Ga0123353_10251968 | Ga0123353_102519684 | 269 |
| 114 | 3300010167 | Ga0123353_10281943 | Ga0123353_102819432 | 269 |
| 115 | 3300010049 | Ga0123356_10355433 | Ga0123356_103554332 | 270 |
| 116 | iso_pr_bacteria | 2820551407 | 2820554933 | 270 |
| 117 | 3300010167 | Ga0123353_10068726 | Ga0123353_100687261 | 271 |
| 118 | 3300010167 | Ga0123353_11260997 | Ga0123353_112609971 | 271 |
| 119 | 3300010882 | Ga0123354_10153882 | Ga0123354_101538824 | 271 |
| 120 | 3300042603 | Ga0466714_137862 | Ga0466714_137862_690_1517 | 275 |
| 121 | 3300010167 | Ga0123353_10710849 | Ga0123353_107108492 | 278 |
| 122 | 3300042617 | Ga0466718_123306 | Ga0466718_123306_1935_2771 | 278 |
| 123 | iso_pr_bacteria | 2820272499 | 2820272760 | 279 |
| 124 | 3300010167 | Ga0123353_10102951 | Ga0123353_101029512 | 280 |
| 125 | 3300010167 | Ga0123353_10183487 | Ga0123353_101834872 | 283 |
| 126 | iso_pr_bacteria | 2820408893 | 2820409208 | 283 |
| 127 | 3300010882 | Ga0123354_10023076 | Ga0123354_100230768 | 297 |
| 128 | 3300042656 | Ga0466732_152970 | Ga0466732_152970_1151_2047 | 298 |
| 129 | 3300009784 | Ga0123357_10048804 | Ga0123357_100488048 | 308 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF04909 | Amidohydro_2 | Amidohydrolase | 3 | 268 | 0.75 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF04909 | GO:0016787 | hydrolase activity | MF |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.95 | 0.95 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.