Protein Family IF12078
Metagenome
Isolate
114
Members
54
Samples
101
Scaffolds
194.39
Avg Length
Representative Sequence
- ID
- iso_pr_bacteria|2820464928|2820465124|
- Length
- 224 aa
- Sequence
- MTRNTKNTRNTMNILIAGVGGQGSLLASRILGSYYLSQGSMVKVSEVHGMSQRGGSVVTYVRAGERVDSPLVPQGEADLLIGLERLEALRWAPHTKPGGLVVVNTRKILPMPVITGSEAYPEGVEESIEAAGRRVVAIDALSLAQQAGDVRAVNVVMLGVVAKLLGGDRAGWEAAIAACVKPGFLELNLQAFLLGYGYECGHGHGDGYSSAPEGQGGGDPVVLE
Sample Types
Isolate
11.4%
Metagenome
88.6%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
41.5%
Unclassified
28.3%
Kalotermitidae
18.9%
Termopsidae
5.7%
Rhinotermitidae
3.8%
Passalidae
1.9%
Taxonomy
Archaea
1
Bacteria
108
Eukaryota
0
Viruses
0
Unclassified
5
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820275298 | Unclassified Firmicutes Th196P3bin17 | Isolate | Unclassified |
| 2 | 2820333861 | Unclassified Firmicutes Nt197P3bin72 | Isolate | Unclassified |
| 3 | 2820405014 | Unclassified Firmicutes Lab288P4bin88 | Isolate | Unclassified |
| 4 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 5 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 6 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 7 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 8 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 9 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 10 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 11 | 2820075487 | Unclassified Proteobacteria Nt197P3bin122 | Isolate | Unclassified |
| 12 | 2820257794 | Unclassified Firmicutes Th196P3bin47 | Isolate | Unclassified |
| 13 | 2820340373 | Unclassified Firmicutes Nt197P3bin67 | Isolate | Unclassified |
| 14 | 2820464928 | Unclassified Firmicutes Lab288P3bin121 | Isolate | Unclassified |
| 15 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 16 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 17 | 2820046858 | Unclassified Proteobacteria Th196P3bin84 | Isolate | Unclassified |
| 18 | 2820582954 | Unclassified Firmicutes Emb289P3bin119 | Isolate | Unclassified |
| 19 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 20 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 21 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 22 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 23 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 24 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 25 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 26 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 27 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 28 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 29 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 30 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 31 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 32 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 33 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 34 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 35 | 2740892545 | Fibrobacteria bacterium GUT31 IN01_31 | Isolate | Unclassified |
| 36 | 2820644600 | Unclassified Firmicutes Cu122P5bin39 | Isolate | Unclassified |
| 37 | 2758568796 | Unclassified Deltaproteobacteria Th196P3_bin21 | Isolate | Unclassified |
| 38 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 39 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 40 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 41 | 2820558799 | Unclassified Firmicutes Emb289P3bin74 | Isolate | Unclassified |
| 42 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 43 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 44 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 45 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 46 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 47 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 48 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 49 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 50 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 51 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 52 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 53 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 54 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_255700 | 3300042612 | Bacteria | 1066 |
| 2 | Ga0466714_018456 | 3300042603 | Bacteria | 2022 |
| 3 | Ga0466712_246930 | 3300042614 | Bacteria | 2059 |
| 4 | Ga0466715_208983 | 3300042616 | Bacteria | 6516 |
| 5 | Ga0466726_109607 | 3300042619 | Bacteria | 1555 |
| 6 | Ga0123356_12614498 | 3300010049 | Bacteria | 632 |
| 7 | Ga0123353_10071323 | 3300010167 | Bacteria | 5581 |
| 8 | Ga0415639_246877 | 3300038395 | Bacteria | 1556 |
| 9 | Ga0466702_381128 | 3300042635 | Bacteria | 12078 |
| 10 | Ga0466704_413063 | 3300042643 | Bacteria | 63892 |
| 11 | IMNBL1DRAFT_c0009529 | 3300000062 | Bacteria | 4783 |
| 12 | Ga0466714_063264 | 3300042603 | Bacteria | 1015 |
| 13 | Ga0466714_086764 | 3300042603 | Bacteria | 3191 |
| 14 | Ga0466714_161515 | 3300042603 | Bacteria | 9552 |
| 15 | Ga0466717_169132 | 3300042604 | Bacteria | 8144 |
| 16 | Ga0466717_289119 | 3300042604 | Bacteria | 1140 |
| 17 | Ga0466719_301385 | 3300042606 | Bacteria | 4747 |
| 18 | Ga0466711_509859 | 3300042615 | Bacteria | 33464 |
| 19 | Ga0466726_419523 | 3300042619 | Bacteria | 7122 |
| 20 | Ga0123357_10053751 | 3300009784 | Bacteria | 5433 |
| 21 | Ga0123356_10732417 | 3300010049 | Bacteria | 1158 |
| 22 | Ga0123353_10001178 | 3300010167 | Bacteria | 31959 |
| 23 | Ga0466691_211915 | 3300042593 | Bacteria | 2787 |
| 24 | Ga0466694_344002 | 3300042594 | Bacteria | 10733 |
| 25 | Ga0466699_409260 | 3300042597 | Bacteria | 1897 |
| 26 | Ga0466729_212879 | 3300042621 | Bacteria | 4904 |
| 27 | Ga0466731_291675 | 3300042622 | Bacteria | 23645 |
| 28 | Ga0466704_542574 | 3300042643 | Bacteria | 3155 |
| 29 | JGI24698J34947_10154214 | 3300002449 | Bacteria | 949 |
| 30 | Ga0466705_270390 | 3300042612 | Bacteria | 2748 |
| 31 | Ga0466700_030082 | 3300042600 | Bacteria | 6618 |
| 32 | Ga0123355_11094562 | 3300009826 | Unclassified | 830 |
| 33 | Ga0123356_11045393 | 3300010049 | Bacteria | 986 |
| 34 | Ga0123353_10449764 | 3300010167 | Bacteria | 1897 |
| 35 | Ga0123353_10584154 | 3300010167 | Bacteria | 1602 |
| 36 | Ga0466699_120015 | 3300042597 | Bacteria | 2156 |
| 37 | IMNBL1DRAFT_c0021854 | 3300000062 | Bacteria | 2548 |
| 38 | Ga0068305_10055005 | 3300005083 | Bacteria | 3147 |
| 39 | Ga0072941_1017283 | 3300005201 | Bacteria | 20025 |
| 40 | Ga0466714_118682 | 3300042603 | Bacteria | 31973 |
| 41 | Ga0466719_138918 | 3300042606 | Bacteria | 11115 |
| 42 | Ga0466712_162591 | 3300042614 | Bacteria | 5594 |
| 43 | Ga0466726_056935 | 3300042619 | Bacteria | 54876 |
| 44 | Ga0123357_10171281 | 3300009784 | Bacteria | 2567 |
| 45 | Ga0123356_10217728 | 3300010049 | Bacteria | 1963 |
| 46 | Ga0123356_10270329 | 3300010049 | Bacteria | 1789 |
| 47 | Ga0123353_10444312 | 3300010167 | Bacteria | 1912 |
| 48 | Ga0415639_043029 | 3300038395 | Bacteria | 5945 |
| 49 | Ga0415639_081038 | 3300038395 | Bacteria | 1674 |
| 50 | Ga0466696_162861 | 3300042596 | Bacteria | 14437 |
| 51 | Ga0466699_087650 | 3300042597 | Bacteria | 2968 |
| 52 | Ga0466735_101487 | 3300042624 | Bacteria | 4778 |
| 53 | Ga0466703_034875 | 3300042636 | Bacteria | 17341 |
| 54 | JGI24705J35276_12223100 | 3300002504 | Unclassified | 2478 |
| 55 | Ga0074263_103575 | 3300005485 | Bacteria | 2063 |
| 56 | Ga0466726_303883 | 3300042619 | Bacteria | 1159 |
| 57 | Ga0123355_10195363 | 3300009826 | Unclassified | 2969 |
| 58 | Ga0123356_10243620 | 3300010049 | Bacteria | 1870 |
| 59 | Ga0123353_10006771 | 3300010167 | Bacteria | 15355 |
| 60 | Ga0123353_10020977 | 3300010167 | Bacteria | 9783 |
| 61 | Ga0123353_10349258 | 3300010167 | Bacteria | 2230 |
| 62 | Ga0415639_011849 | 3300038395 | Bacteria | 3610 |
| 63 | Ga0415639_044691 | 3300038395 | Bacteria | 4323 |
| 64 | Ga0415639_247332 | 3300038395 | Bacteria | 1775 |
| 65 | Ga0466693_011923 | 3300042592 | Bacteria | 3084 |
| 66 | JGI24698J34947_10064875 | 3300002449 | Bacteria | 1783 |
| 67 | Ga0072941_1027318 | 3300005201 | Bacteria | 20365 |
| 68 | Ga0072941_1027319 | 3300005201 | Bacteria | 24197 |
| 69 | Ga0466705_385246 | 3300042612 | Bacteria | 20984 |
| 70 | Ga0466700_323724 | 3300042600 | Bacteria | 4406 |
| 71 | Ga0466707_106507 | 3300042601 | Archaea | 1336 |
| 72 | Ga0466714_128309 | 3300042603 | Bacteria | 1221 |
| 73 | Ga0123353_11074318 | 3300010167 | Bacteria | 1072 |
| 74 | Ga0123353_11926866 | 3300010167 | Bacteria | 728 |
| 75 | Ga0123354_10084647 | 3300010882 | Unclassified | 4451 |
| 76 | Ga0415639_014674 | 3300038395 | Bacteria | 42449 |
| 77 | Ga0415639_118424 | 3300038395 | Bacteria | 2196 |
| 78 | Ga0466693_446955 | 3300042592 | Bacteria | 1628 |
| 79 | Ga0466702_293206 | 3300042635 | Bacteria | 1778 |
| 80 | Ga0466702_373755 | 3300042635 | Bacteria | 3748 |
| 81 | Ga0466727_319554 | 3300042655 | Bacteria | 4912 |
| 82 | IMNBL1DRAFT_c0001984 | 3300000062 | Bacteria | 14728 |
| 83 | JGI24702J35022_10013714 | 3300002462 | Bacteria | 4482 |
| 84 | Ga0466701_072679 | 3300042598 | Bacteria | 1443 |
| 85 | Ga0466711_430250 | 3300042615 | Bacteria | 2049 |
| 86 | Ga0466726_010908 | 3300042619 | Bacteria | 7490 |
| 87 | Ga0123355_10082000 | 3300009826 | Bacteria | 5146 |
| 88 | Ga0123356_10001192 | 3300010049 | Bacteria | 28796 |
| 89 | Ga0123356_10036818 | 3300010049 | Bacteria | 4568 |
| 90 | Ga0123356_10044637 | 3300010049 | Bacteria | 4126 |
| 91 | Ga0123356_10323631 | 3300010049 | Bacteria | 1656 |
| 92 | Ga0123353_10196160 | 3300010167 | Bacteria | 3182 |
| 93 | Ga0415639_158077 | 3300038395 | Bacteria | 2052 |
| 94 | Ga0466690_147273 | 3300042590 | Bacteria | 3801 |
| 95 | Ga0466709_072996 | 3300042648 | Bacteria | 25987 |
| 96 | JGI24699J35502_11130488 | 3300002509 | Unclassified | 5133 |
| 97 | Ga0068305_10277115 | 3300005083 | Bacteria | 8058 |
| 98 | Ga0466722_095943 | 3300042609 | Bacteria | 2531 |
| 99 | Ga0466697_010606 | 3300042611 | Bacteria | 1234 |
| 100 | Ga0123356_10626531 | 3300010049 | Bacteria | 1242 |
| 101 | Ga0123353_10369437 | 3300010167 | Bacteria | 2151 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042635 | Ga0466702_373755 | Ga0466702_373755_2002_2553 | 183 |
| 2 | 3300042600 | Ga0466700_030082 | Ga0466700_030082_1471_2025 | 184 |
| 3 | 3300042619 | Ga0466726_010908 | Ga0466726_010908_5943_6503 | 186 |
| 4 | 3300042601 | Ga0466707_106507 | Ga0466707_106507_609_1172 | 187 |
| 5 | 3300010049 | Ga0123356_10626531 | Ga0123356_106265312 | 188 |
| 6 | 3300005201 | Ga0072941_1017283 | Ga0072941_101728321 | 189 |
| 7 | 3300009784 | Ga0123357_10053751 | Ga0123357_100537515 | 189 |
| 8 | 3300010167 | Ga0123353_10449764 | Ga0123353_104497642 | 189 |
| 9 | 3300042619 | Ga0466726_419523 | Ga0466726_419523_1281_1850 | 189 |
| 10 | iso_pr_bacteria | 2820257794 | 2820258785 | 189 |
| 11 | iso_pr_bacteria | 2820333861 | 2820334400 | 189 |
| 12 | 3300005083 | Ga0068305_10055005 | Ga0068305_100550053 | 190 |
| 13 | 3300010049 | Ga0123356_11045393 | Ga0123356_110453932 | 190 |
| 14 | 3300010167 | Ga0123353_10349258 | Ga0123353_103492581 | 190 |
| 15 | 3300038395 | Ga0415639_014674 | Ga0415639_014674_24877_25449 | 190 |
| 16 | 3300038395 | Ga0415639_081038 | Ga0415639_081038_1040_1612 | 190 |
| 17 | 3300042615 | Ga0466711_509859 | Ga0466711_509859_27994_28566 | 190 |
| 18 | 3300042616 | Ga0466715_208983 | Ga0466715_208983_4473_5045 | 190 |
| 19 | 3300042619 | Ga0466726_056935 | Ga0466726_056935_17275_17847 | 190 |
| 20 | 3300010049 | Ga0123356_10217728 | Ga0123356_102177281 | 191 |
| 21 | 3300010049 | Ga0123356_10243620 | Ga0123356_102436202 | 191 |
| 22 | 3300010049 | Ga0123356_10270329 | Ga0123356_102703292 | 191 |
| 23 | 3300010049 | Ga0123356_10323631 | Ga0123356_103236312 | 191 |
| 24 | 3300010167 | Ga0123353_10006771 | Ga0123353_100067717 | 191 |
| 25 | 3300010167 | Ga0123353_10196160 | Ga0123353_101961602 | 191 |
| 26 | 3300042603 | Ga0466714_118682 | Ga0466714_118682_9503_10078 | 191 |
| 27 | 3300042609 | Ga0466722_095943 | Ga0466722_095943_1021_1596 | 191 |
| 28 | 3300042619 | Ga0466726_303883 | Ga0466726_303883_18_593 | 191 |
| 29 | 3300042655 | Ga0466727_319554 | Ga0466727_319554_555_1130 | 191 |
| 30 | iso_pr_bacteria | 2758568796 | 2761047675 | 191 |
| 31 | iso_pr_bacteria | 2820405014 | 2820406431 | 191 |
| 32 | 3300000062 | IMNBL1DRAFT_c0021854 | IMNBL1DRAFT_00218542 | 192 |
| 33 | 3300002504 | JGI24705J35276_12223100 | JGI24705J35276_122231002 | 192 |
| 34 | 3300009784 | Ga0123357_10171281 | Ga0123357_101712813 | 192 |
| 35 | 3300009826 | Ga0123355_10082000 | Ga0123355_100820006 | 192 |
| 36 | 3300009826 | Ga0123355_10195363 | Ga0123355_101953634 | 192 |
| 37 | 3300009826 | Ga0123355_11094562 | Ga0123355_110945621 | 192 |
| 38 | 3300010049 | Ga0123356_10732417 | Ga0123356_107324172 | 192 |
| 39 | 3300010049 | Ga0123356_12614498 | Ga0123356_126144981 | 192 |
| 40 | 3300010167 | Ga0123353_10020977 | Ga0123353_1002097710 | 192 |
| 41 | 3300010167 | Ga0123353_11074318 | Ga0123353_110743182 | 192 |
| 42 | 3300010882 | Ga0123354_10084647 | Ga0123354_100846474 | 192 |
| 43 | 3300038395 | Ga0415639_011849 | Ga0415639_011849_1619_2197 | 192 |
| 44 | 3300038395 | Ga0415639_246877 | Ga0415639_246877_292_870 | 192 |
| 45 | 3300042592 | Ga0466693_446955 | Ga0466693_446955_197_775 | 192 |
| 46 | 3300042600 | Ga0466700_323724 | Ga0466700_323724_1150_1728 | 192 |
| 47 | 3300042603 | Ga0466714_018456 | Ga0466714_018456_615_1193 | 192 |
| 48 | 3300042603 | Ga0466714_086764 | Ga0466714_086764_2289_2867 | 192 |
| 49 | 3300042603 | Ga0466714_161515 | Ga0466714_161515_929_1507 | 192 |
| 50 | 3300042604 | Ga0466717_169132 | Ga0466717_169132_343_921 | 192 |
| 51 | 3300042615 | Ga0466711_430250 | Ga0466711_430250_246_824 | 192 |
| 52 | 3300042635 | Ga0466702_293206 | Ga0466702_293206_58_636 | 192 |
| 53 | 3300000062 | IMNBL1DRAFT_c0001984 | IMNBL1DRAFT_00019845 | 193 |
| 54 | 3300002449 | JGI24698J34947_10154214 | JGI24698J34947_101542142 | 193 |
| 55 | 3300002462 | JGI24702J35022_10013714 | JGI24702J35022_100137142 | 193 |
| 56 | 3300002509 | JGI24699J35502_11130488 | JGI24699J35502_111304886 | 193 |
| 57 | 3300010049 | Ga0123356_10044637 | Ga0123356_100446372 | 193 |
| 58 | 3300010167 | Ga0123353_10001178 | Ga0123353_1000117819 | 193 |
| 59 | 3300038395 | Ga0415639_043029 | Ga0415639_043029_2492_3073 | 193 |
| 60 | 3300038395 | Ga0415639_118424 | Ga0415639_118424_1356_1937 | 193 |
| 61 | 3300042604 | Ga0466717_289119 | Ga0466717_289119_457_1038 | 193 |
| 62 | 3300042612 | Ga0466705_385246 | Ga0466705_385246_13155_13736 | 193 |
| 63 | 3300042643 | Ga0466704_413063 | Ga0466704_413063_39638_40219 | 193 |
| 64 | iso_pr_bacteria | 2820340373 | 2820341418 | 193 |
| 65 | 3300000062 | IMNBL1DRAFT_c0009529 | IMNBL1DRAFT_00095292 | 194 |
| 66 | 3300002449 | JGI24698J34947_10064875 | JGI24698J34947_100648752 | 194 |
| 67 | 3300005083 | Ga0068305_10277115 | Ga0068305_102771155 | 194 |
| 68 | 3300010167 | Ga0123353_10369437 | Ga0123353_103694372 | 194 |
| 69 | 3300010167 | Ga0123353_11926866 | Ga0123353_119268662 | 194 |
| 70 | 3300038395 | Ga0415639_044691 | Ga0415639_044691_1639_2223 | 194 |
| 71 | 3300038395 | Ga0415639_158077 | Ga0415639_158077_951_1535 | 194 |
| 72 | 3300038395 | Ga0415639_247332 | Ga0415639_247332_295_879 | 194 |
| 73 | 3300042598 | Ga0466701_072679 | Ga0466701_072679_179_763 | 194 |
| 74 | 3300042603 | Ga0466714_063264 | Ga0466714_063264_418_1002 | 194 |
| 75 | 3300042603 | Ga0466714_128309 | Ga0466714_128309_616_1200 | 194 |
| 76 | 3300042624 | Ga0466735_101487 | Ga0466735_101487_2670_3254 | 194 |
| 77 | 3300042635 | Ga0466702_381128 | Ga0466702_381128_92_676 | 194 |
| 78 | 3300042648 | Ga0466709_072996 | Ga0466709_072996_17853_18437 | 194 |
| 79 | iso_pr_bacteria | 2820275298 | 2820276816 | 194 |
| 80 | 3300005485 | Ga0074263_103575 | Ga0074263_1035753 | 195 |
| 81 | 3300010167 | Ga0123353_10444312 | Ga0123353_104443122 | 195 |
| 82 | 3300042597 | Ga0466699_087650 | Ga0466699_087650_1281_1868 | 195 |
| 83 | 3300042606 | Ga0466719_138918 | Ga0466719_138918_5776_6363 | 195 |
| 84 | 3300042592 | Ga0466693_011923 | Ga0466693_011923_2164_2754 | 196 |
| 85 | 3300042593 | Ga0466691_211915 | Ga0466691_211915_1235_1825 | 196 |
| 86 | 3300042596 | Ga0466696_162861 | Ga0466696_162861_11644_12234 | 196 |
| 87 | 3300042606 | Ga0466719_301385 | Ga0466719_301385_1108_1698 | 196 |
| 88 | 3300042612 | Ga0466705_255700 | Ga0466705_255700_415_1005 | 196 |
| 89 | 3300042619 | Ga0466726_109607 | Ga0466726_109607_903_1493 | 196 |
| 90 | iso_pr_bacteria | 2740892545 | 2743907658 | 196 |
| 91 | iso_pr_bacteria | 2820558799 | 2820559715 | 196 |
| 92 | 3300005201 | Ga0072941_1027318 | Ga0072941_10273182 | 197 |
| 93 | 3300010049 | Ga0123356_10001192 | Ga0123356_100011924 | 197 |
| 94 | 3300010167 | Ga0123353_10584154 | Ga0123353_105841542 | 197 |
| 95 | 3300042597 | Ga0466699_409260 | Ga0466699_409260_190_783 | 197 |
| 96 | 3300042614 | Ga0466712_162591 | Ga0466712_162591_4352_4945 | 197 |
| 97 | 3300042614 | Ga0466712_246930 | Ga0466712_246930_141_734 | 197 |
| 98 | iso_pr_bacteria | 2820075487 | 2820075572 | 197 |
| 99 | 3300010167 | Ga0123353_10071323 | Ga0123353_100713233 | 198 |
| 100 | 3300042597 | Ga0466699_120015 | Ga0466699_120015_1149_1745 | 198 |
| 101 | 3300042611 | Ga0466697_010606 | Ga0466697_010606_330_926 | 198 |
| 102 | iso_pr_bacteria | 2820582954 | 2820583622 | 200 |
| 103 | 3300010049 | Ga0123356_10036818 | Ga0123356_100368185 | 201 |
| 104 | 3300042621 | Ga0466729_212879 | Ga0466729_212879_1038_1643 | 201 |
| 105 | 3300042636 | Ga0466703_034875 | Ga0466703_034875_7678_8286 | 202 |
| 106 | 3300042612 | Ga0466705_270390 | Ga0466705_270390_48_665 | 205 |
| 107 | 3300042643 | Ga0466704_542574 | Ga0466704_542574_1949_2569 | 206 |
| 108 | iso_pr_bacteria | 2820046858 | 2820047798 | 206 |
| 109 | 3300042594 | Ga0466694_344002 | Ga0466694_344002_5526_6155 | 209 |
| 110 | 3300042590 | Ga0466690_147273 | Ga0466690_147273_2494_3126 | 210 |
| 111 | 3300005201 | Ga0072941_1027319 | Ga0072941_10273197 | 211 |
| 112 | iso_pr_bacteria | 2820644600 | 2820645847 | 214 |
| 113 | 3300042622 | Ga0466731_291675 | Ga0466731_291675_17242_17901 | 219 |
| 114 | iso_pr_bacteria | 2820464928 | 2820465124 | 224 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01558 | POR | Pyruvate ferredoxin/flavodoxin oxidoreductase | 20 | 196 | 0.98 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF01558 | GO:0016903 | oxidoreductase activity, acting on the aldehyde or oxo group of donors | MF |
Structural Annotation β Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3on3-assembly3.cif.gz_B | The crystal structure of keto/oxoacid ferredoxin oxidoreductase, gamma subunit from Geobacter sulfurreducens PCA | 0.856 | 10 | 196 |
| 3on3-assembly2.cif.gz_A | The crystal structure of keto/oxoacid ferredoxin oxidoreductase, gamma subunit from Geobacter sulfurreducens PCA | 0.841 | 12 | 196 |
| 3g2e-assembly1.cif.gz_D | Structure of putative OORC subunit of 2-oxoglutarate:acceptor oxidoreductase from Campylobacter jejuni | 0.829 | 10 | 195 |
| 3g2e-assembly1.cif.gz_C | Structure of putative OORC subunit of 2-oxoglutarate:acceptor oxidoreductase from Campylobacter jejuni | 0.827 | 10 | 195 |
| 3g2e-assembly1.cif.gz_A | Structure of putative OORC subunit of 2-oxoglutarate:acceptor oxidoreductase from Campylobacter jejuni | 0.791 | 18 | 195 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3on3A00 | Alpha Beta;3-Layer(aba) Sandwich;Pyruvate-ferredoxin Oxidoreductase; domain 3;Pyruvate-ferredoxin oxidoreductase, PFOR, domain III | 0.8276 | 12 | 192 | 3.40.920.10 |
| 3g2eC00 | Alpha Beta;3-Layer(aba) Sandwich;Pyruvate-ferredoxin Oxidoreductase; domain 3;Pyruvate-ferredoxin oxidoreductase, PFOR, domain III | 0.827 | 10 | 195 | 3.40.920.10 |
| af_Q57717_1_177_3.40.920.10 | Alpha Beta;3-Layer(aba) Sandwich;Pyruvate-ferredoxin Oxidoreductase; domain 3;Pyruvate-ferredoxin oxidoreductase, PFOR, domain III | 0.8027 | 12 | 196 | 3.40.920.10 |
| 2raaA00 | Alpha Beta;3-Layer(aba) Sandwich;Pyruvate-ferredoxin Oxidoreductase; domain 3;Pyruvate-ferredoxin oxidoreductase, PFOR, domain III | 0.7657 | 9 | 196 | 3.40.920.10 |
| af_Q2FZ05_1_182_3.40.920.10 | Alpha Beta;3-Layer(aba) Sandwich;Pyruvate-ferredoxin Oxidoreductase; domain 3;Pyruvate-ferredoxin oxidoreductase, PFOR, domain III | 0.7652 | 11 | 196 | 3.40.920.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7V7AHV9-F1-model_v4 | Uncharacterized/unreviewed | 0.9541 | 21 | 199 | |
| AF-A0A7X7DQN3-F1-model_v4 | Uncharacterized/unreviewed | 0.9502 | 12 | 198 |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.81 | 0.88 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.