Protein Family IF12078

Metagenome Isolate
114 Members
54 Samples
101 Scaffolds
194.39 Avg Length

🧬 Representative Sequence

ID
iso_pr_bacteria|2820464928|2820465124|
Length
224 aa
Sequence
MTRNTKNTRNTMNILIAGVGGQGSLLASRILGSYYLSQGSMVKVSEVHGMSQRGGSVVTYVRAGERVDSPLVPQGEADLLIGLERLEALRWAPHTKPGGLVVVNTRKILPMPVITGSEAYPEGVEESIEAAGRRVVAIDALSLAQQAGDVRAVNVVMLGVVAKLLGGDRAGWEAAIAACVKPGFLELNLQAFLLGYGYECGHGHGDGYSSAPEGQGGGDPVVLE

📊 Sample Types

Isolate 11.4%
Metagenome 88.6%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 41.5%
Unclassified 28.3%
Kalotermitidae 18.9%
Termopsidae 5.7%
Rhinotermitidae 3.8%
Passalidae 1.9%

🌳 Taxonomy

Archaea 1
Bacteria 108
Eukaryota 0
Viruses 0
Unclassified 5

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820275298 Unclassified Firmicutes Th196P3bin17 Isolate Unclassified
2 2820333861 Unclassified Firmicutes Nt197P3bin72 Isolate Unclassified
3 2820405014 Unclassified Firmicutes Lab288P4bin88 Isolate Unclassified
4 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
5 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
6 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
7 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
8 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
9 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
10 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
11 2820075487 Unclassified Proteobacteria Nt197P3bin122 Isolate Unclassified
12 2820257794 Unclassified Firmicutes Th196P3bin47 Isolate Unclassified
13 2820340373 Unclassified Firmicutes Nt197P3bin67 Isolate Unclassified
14 2820464928 Unclassified Firmicutes Lab288P3bin121 Isolate Unclassified
15 3300005485 Termite gut microbial communities from Costa Rica - P3 luminal contents Metagenome Termitidae
16 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
17 2820046858 Unclassified Proteobacteria Th196P3bin84 Isolate Unclassified
18 2820582954 Unclassified Firmicutes Emb289P3bin119 Isolate Unclassified
19 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
20 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
21 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
22 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
23 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
24 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
25 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
26 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
27 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
28 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
29 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
30 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
31 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
32 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
33 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
34 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
35 2740892545 Fibrobacteria bacterium GUT31 IN01_31 Isolate Unclassified
36 2820644600 Unclassified Firmicutes Cu122P5bin39 Isolate Unclassified
37 2758568796 Unclassified Deltaproteobacteria Th196P3_bin21 Isolate Unclassified
38 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
39 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
40 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
41 2820558799 Unclassified Firmicutes Emb289P3bin74 Isolate Unclassified
42 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
43 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
44 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
45 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
46 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
47 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
48 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
49 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
50 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
51 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
52 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
53 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
54 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_255700 3300042612 Bacteria 1066
2 Ga0466714_018456 3300042603 Bacteria 2022
3 Ga0466712_246930 3300042614 Bacteria 2059
4 Ga0466715_208983 3300042616 Bacteria 6516
5 Ga0466726_109607 3300042619 Bacteria 1555
6 Ga0123356_12614498 3300010049 Bacteria 632
7 Ga0123353_10071323 3300010167 Bacteria 5581
8 Ga0415639_246877 3300038395 Bacteria 1556
9 Ga0466702_381128 3300042635 Bacteria 12078
10 Ga0466704_413063 3300042643 Bacteria 63892
11 IMNBL1DRAFT_c0009529 3300000062 Bacteria 4783
12 Ga0466714_063264 3300042603 Bacteria 1015
13 Ga0466714_086764 3300042603 Bacteria 3191
14 Ga0466714_161515 3300042603 Bacteria 9552
15 Ga0466717_169132 3300042604 Bacteria 8144
16 Ga0466717_289119 3300042604 Bacteria 1140
17 Ga0466719_301385 3300042606 Bacteria 4747
18 Ga0466711_509859 3300042615 Bacteria 33464
19 Ga0466726_419523 3300042619 Bacteria 7122
20 Ga0123357_10053751 3300009784 Bacteria 5433
21 Ga0123356_10732417 3300010049 Bacteria 1158
22 Ga0123353_10001178 3300010167 Bacteria 31959
23 Ga0466691_211915 3300042593 Bacteria 2787
24 Ga0466694_344002 3300042594 Bacteria 10733
25 Ga0466699_409260 3300042597 Bacteria 1897
26 Ga0466729_212879 3300042621 Bacteria 4904
27 Ga0466731_291675 3300042622 Bacteria 23645
28 Ga0466704_542574 3300042643 Bacteria 3155
29 JGI24698J34947_10154214 3300002449 Bacteria 949
30 Ga0466705_270390 3300042612 Bacteria 2748
31 Ga0466700_030082 3300042600 Bacteria 6618
32 Ga0123355_11094562 3300009826 Unclassified 830
33 Ga0123356_11045393 3300010049 Bacteria 986
34 Ga0123353_10449764 3300010167 Bacteria 1897
35 Ga0123353_10584154 3300010167 Bacteria 1602
36 Ga0466699_120015 3300042597 Bacteria 2156
37 IMNBL1DRAFT_c0021854 3300000062 Bacteria 2548
38 Ga0068305_10055005 3300005083 Bacteria 3147
39 Ga0072941_1017283 3300005201 Bacteria 20025
40 Ga0466714_118682 3300042603 Bacteria 31973
41 Ga0466719_138918 3300042606 Bacteria 11115
42 Ga0466712_162591 3300042614 Bacteria 5594
43 Ga0466726_056935 3300042619 Bacteria 54876
44 Ga0123357_10171281 3300009784 Bacteria 2567
45 Ga0123356_10217728 3300010049 Bacteria 1963
46 Ga0123356_10270329 3300010049 Bacteria 1789
47 Ga0123353_10444312 3300010167 Bacteria 1912
48 Ga0415639_043029 3300038395 Bacteria 5945
49 Ga0415639_081038 3300038395 Bacteria 1674
50 Ga0466696_162861 3300042596 Bacteria 14437
51 Ga0466699_087650 3300042597 Bacteria 2968
52 Ga0466735_101487 3300042624 Bacteria 4778
53 Ga0466703_034875 3300042636 Bacteria 17341
54 JGI24705J35276_12223100 3300002504 Unclassified 2478
55 Ga0074263_103575 3300005485 Bacteria 2063
56 Ga0466726_303883 3300042619 Bacteria 1159
57 Ga0123355_10195363 3300009826 Unclassified 2969
58 Ga0123356_10243620 3300010049 Bacteria 1870
59 Ga0123353_10006771 3300010167 Bacteria 15355
60 Ga0123353_10020977 3300010167 Bacteria 9783
61 Ga0123353_10349258 3300010167 Bacteria 2230
62 Ga0415639_011849 3300038395 Bacteria 3610
63 Ga0415639_044691 3300038395 Bacteria 4323
64 Ga0415639_247332 3300038395 Bacteria 1775
65 Ga0466693_011923 3300042592 Bacteria 3084
66 JGI24698J34947_10064875 3300002449 Bacteria 1783
67 Ga0072941_1027318 3300005201 Bacteria 20365
68 Ga0072941_1027319 3300005201 Bacteria 24197
69 Ga0466705_385246 3300042612 Bacteria 20984
70 Ga0466700_323724 3300042600 Bacteria 4406
71 Ga0466707_106507 3300042601 Archaea 1336
72 Ga0466714_128309 3300042603 Bacteria 1221
73 Ga0123353_11074318 3300010167 Bacteria 1072
74 Ga0123353_11926866 3300010167 Bacteria 728
75 Ga0123354_10084647 3300010882 Unclassified 4451
76 Ga0415639_014674 3300038395 Bacteria 42449
77 Ga0415639_118424 3300038395 Bacteria 2196
78 Ga0466693_446955 3300042592 Bacteria 1628
79 Ga0466702_293206 3300042635 Bacteria 1778
80 Ga0466702_373755 3300042635 Bacteria 3748
81 Ga0466727_319554 3300042655 Bacteria 4912
82 IMNBL1DRAFT_c0001984 3300000062 Bacteria 14728
83 JGI24702J35022_10013714 3300002462 Bacteria 4482
84 Ga0466701_072679 3300042598 Bacteria 1443
85 Ga0466711_430250 3300042615 Bacteria 2049
86 Ga0466726_010908 3300042619 Bacteria 7490
87 Ga0123355_10082000 3300009826 Bacteria 5146
88 Ga0123356_10001192 3300010049 Bacteria 28796
89 Ga0123356_10036818 3300010049 Bacteria 4568
90 Ga0123356_10044637 3300010049 Bacteria 4126
91 Ga0123356_10323631 3300010049 Bacteria 1656
92 Ga0123353_10196160 3300010167 Bacteria 3182
93 Ga0415639_158077 3300038395 Bacteria 2052
94 Ga0466690_147273 3300042590 Bacteria 3801
95 Ga0466709_072996 3300042648 Bacteria 25987
96 JGI24699J35502_11130488 3300002509 Unclassified 5133
97 Ga0068305_10277115 3300005083 Bacteria 8058
98 Ga0466722_095943 3300042609 Bacteria 2531
99 Ga0466697_010606 3300042611 Bacteria 1234
100 Ga0123356_10626531 3300010049 Bacteria 1242
101 Ga0123353_10369437 3300010167 Bacteria 2151

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042635 Ga0466702_373755 Ga0466702_373755_2002_2553 183
2 3300042600 Ga0466700_030082 Ga0466700_030082_1471_2025 184
3 3300042619 Ga0466726_010908 Ga0466726_010908_5943_6503 186
4 3300042601 Ga0466707_106507 Ga0466707_106507_609_1172 187
5 3300010049 Ga0123356_10626531 Ga0123356_106265312 188
6 3300005201 Ga0072941_1017283 Ga0072941_101728321 189
7 3300009784 Ga0123357_10053751 Ga0123357_100537515 189
8 3300010167 Ga0123353_10449764 Ga0123353_104497642 189
9 3300042619 Ga0466726_419523 Ga0466726_419523_1281_1850 189
10 iso_pr_bacteria 2820257794 2820258785 189
11 iso_pr_bacteria 2820333861 2820334400 189
12 3300005083 Ga0068305_10055005 Ga0068305_100550053 190
13 3300010049 Ga0123356_11045393 Ga0123356_110453932 190
14 3300010167 Ga0123353_10349258 Ga0123353_103492581 190
15 3300038395 Ga0415639_014674 Ga0415639_014674_24877_25449 190
16 3300038395 Ga0415639_081038 Ga0415639_081038_1040_1612 190
17 3300042615 Ga0466711_509859 Ga0466711_509859_27994_28566 190
18 3300042616 Ga0466715_208983 Ga0466715_208983_4473_5045 190
19 3300042619 Ga0466726_056935 Ga0466726_056935_17275_17847 190
20 3300010049 Ga0123356_10217728 Ga0123356_102177281 191
21 3300010049 Ga0123356_10243620 Ga0123356_102436202 191
22 3300010049 Ga0123356_10270329 Ga0123356_102703292 191
23 3300010049 Ga0123356_10323631 Ga0123356_103236312 191
24 3300010167 Ga0123353_10006771 Ga0123353_100067717 191
25 3300010167 Ga0123353_10196160 Ga0123353_101961602 191
26 3300042603 Ga0466714_118682 Ga0466714_118682_9503_10078 191
27 3300042609 Ga0466722_095943 Ga0466722_095943_1021_1596 191
28 3300042619 Ga0466726_303883 Ga0466726_303883_18_593 191
29 3300042655 Ga0466727_319554 Ga0466727_319554_555_1130 191
30 iso_pr_bacteria 2758568796 2761047675 191
31 iso_pr_bacteria 2820405014 2820406431 191
32 3300000062 IMNBL1DRAFT_c0021854 IMNBL1DRAFT_00218542 192
33 3300002504 JGI24705J35276_12223100 JGI24705J35276_122231002 192
34 3300009784 Ga0123357_10171281 Ga0123357_101712813 192
35 3300009826 Ga0123355_10082000 Ga0123355_100820006 192
36 3300009826 Ga0123355_10195363 Ga0123355_101953634 192
37 3300009826 Ga0123355_11094562 Ga0123355_110945621 192
38 3300010049 Ga0123356_10732417 Ga0123356_107324172 192
39 3300010049 Ga0123356_12614498 Ga0123356_126144981 192
40 3300010167 Ga0123353_10020977 Ga0123353_1002097710 192
41 3300010167 Ga0123353_11074318 Ga0123353_110743182 192
42 3300010882 Ga0123354_10084647 Ga0123354_100846474 192
43 3300038395 Ga0415639_011849 Ga0415639_011849_1619_2197 192
44 3300038395 Ga0415639_246877 Ga0415639_246877_292_870 192
45 3300042592 Ga0466693_446955 Ga0466693_446955_197_775 192
46 3300042600 Ga0466700_323724 Ga0466700_323724_1150_1728 192
47 3300042603 Ga0466714_018456 Ga0466714_018456_615_1193 192
48 3300042603 Ga0466714_086764 Ga0466714_086764_2289_2867 192
49 3300042603 Ga0466714_161515 Ga0466714_161515_929_1507 192
50 3300042604 Ga0466717_169132 Ga0466717_169132_343_921 192
51 3300042615 Ga0466711_430250 Ga0466711_430250_246_824 192
52 3300042635 Ga0466702_293206 Ga0466702_293206_58_636 192
53 3300000062 IMNBL1DRAFT_c0001984 IMNBL1DRAFT_00019845 193
54 3300002449 JGI24698J34947_10154214 JGI24698J34947_101542142 193
55 3300002462 JGI24702J35022_10013714 JGI24702J35022_100137142 193
56 3300002509 JGI24699J35502_11130488 JGI24699J35502_111304886 193
57 3300010049 Ga0123356_10044637 Ga0123356_100446372 193
58 3300010167 Ga0123353_10001178 Ga0123353_1000117819 193
59 3300038395 Ga0415639_043029 Ga0415639_043029_2492_3073 193
60 3300038395 Ga0415639_118424 Ga0415639_118424_1356_1937 193
61 3300042604 Ga0466717_289119 Ga0466717_289119_457_1038 193
62 3300042612 Ga0466705_385246 Ga0466705_385246_13155_13736 193
63 3300042643 Ga0466704_413063 Ga0466704_413063_39638_40219 193
64 iso_pr_bacteria 2820340373 2820341418 193
65 3300000062 IMNBL1DRAFT_c0009529 IMNBL1DRAFT_00095292 194
66 3300002449 JGI24698J34947_10064875 JGI24698J34947_100648752 194
67 3300005083 Ga0068305_10277115 Ga0068305_102771155 194
68 3300010167 Ga0123353_10369437 Ga0123353_103694372 194
69 3300010167 Ga0123353_11926866 Ga0123353_119268662 194
70 3300038395 Ga0415639_044691 Ga0415639_044691_1639_2223 194
71 3300038395 Ga0415639_158077 Ga0415639_158077_951_1535 194
72 3300038395 Ga0415639_247332 Ga0415639_247332_295_879 194
73 3300042598 Ga0466701_072679 Ga0466701_072679_179_763 194
74 3300042603 Ga0466714_063264 Ga0466714_063264_418_1002 194
75 3300042603 Ga0466714_128309 Ga0466714_128309_616_1200 194
76 3300042624 Ga0466735_101487 Ga0466735_101487_2670_3254 194
77 3300042635 Ga0466702_381128 Ga0466702_381128_92_676 194
78 3300042648 Ga0466709_072996 Ga0466709_072996_17853_18437 194
79 iso_pr_bacteria 2820275298 2820276816 194
80 3300005485 Ga0074263_103575 Ga0074263_1035753 195
81 3300010167 Ga0123353_10444312 Ga0123353_104443122 195
82 3300042597 Ga0466699_087650 Ga0466699_087650_1281_1868 195
83 3300042606 Ga0466719_138918 Ga0466719_138918_5776_6363 195
84 3300042592 Ga0466693_011923 Ga0466693_011923_2164_2754 196
85 3300042593 Ga0466691_211915 Ga0466691_211915_1235_1825 196
86 3300042596 Ga0466696_162861 Ga0466696_162861_11644_12234 196
87 3300042606 Ga0466719_301385 Ga0466719_301385_1108_1698 196
88 3300042612 Ga0466705_255700 Ga0466705_255700_415_1005 196
89 3300042619 Ga0466726_109607 Ga0466726_109607_903_1493 196
90 iso_pr_bacteria 2740892545 2743907658 196
91 iso_pr_bacteria 2820558799 2820559715 196
92 3300005201 Ga0072941_1027318 Ga0072941_10273182 197
93 3300010049 Ga0123356_10001192 Ga0123356_100011924 197
94 3300010167 Ga0123353_10584154 Ga0123353_105841542 197
95 3300042597 Ga0466699_409260 Ga0466699_409260_190_783 197
96 3300042614 Ga0466712_162591 Ga0466712_162591_4352_4945 197
97 3300042614 Ga0466712_246930 Ga0466712_246930_141_734 197
98 iso_pr_bacteria 2820075487 2820075572 197
99 3300010167 Ga0123353_10071323 Ga0123353_100713233 198
100 3300042597 Ga0466699_120015 Ga0466699_120015_1149_1745 198
101 3300042611 Ga0466697_010606 Ga0466697_010606_330_926 198
102 iso_pr_bacteria 2820582954 2820583622 200
103 3300010049 Ga0123356_10036818 Ga0123356_100368185 201
104 3300042621 Ga0466729_212879 Ga0466729_212879_1038_1643 201
105 3300042636 Ga0466703_034875 Ga0466703_034875_7678_8286 202
106 3300042612 Ga0466705_270390 Ga0466705_270390_48_665 205
107 3300042643 Ga0466704_542574 Ga0466704_542574_1949_2569 206
108 iso_pr_bacteria 2820046858 2820047798 206
109 3300042594 Ga0466694_344002 Ga0466694_344002_5526_6155 209
110 3300042590 Ga0466690_147273 Ga0466690_147273_2494_3126 210
111 3300005201 Ga0072941_1027319 Ga0072941_10273197 211
112 iso_pr_bacteria 2820644600 2820645847 214
113 3300042622 Ga0466731_291675 Ga0466731_291675_17242_17901 219
114 iso_pr_bacteria 2820464928 2820465124 224

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01558 POR Pyruvate ferredoxin/flavodoxin oxidoreductase 20 196 0.98

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF01558 GO:0016903 oxidoreductase activity, acting on the aldehyde or oxo group of donors MF

🏗️ Structural Annotation – Top 5 Hits

IDDescriptionScoreStartEnd
3on3-assembly3.cif.gz_B The crystal structure of keto/oxoacid ferredoxin oxidoreductase, gamma subunit from Geobacter sulfurreducens PCA 0.856 10 196
3on3-assembly2.cif.gz_A The crystal structure of keto/oxoacid ferredoxin oxidoreductase, gamma subunit from Geobacter sulfurreducens PCA 0.841 12 196
3g2e-assembly1.cif.gz_D Structure of putative OORC subunit of 2-oxoglutarate:acceptor oxidoreductase from Campylobacter jejuni 0.829 10 195
3g2e-assembly1.cif.gz_C Structure of putative OORC subunit of 2-oxoglutarate:acceptor oxidoreductase from Campylobacter jejuni 0.827 10 195
3g2e-assembly1.cif.gz_A Structure of putative OORC subunit of 2-oxoglutarate:acceptor oxidoreductase from Campylobacter jejuni 0.791 18 195
IDDescriptionScoreStartEndSuperfamily
3on3A00 Alpha Beta;3-Layer(aba) Sandwich;Pyruvate-ferredoxin Oxidoreductase; domain 3;Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.8276 12 192 3.40.920.10
3g2eC00 Alpha Beta;3-Layer(aba) Sandwich;Pyruvate-ferredoxin Oxidoreductase; domain 3;Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.827 10 195 3.40.920.10
af_Q57717_1_177_3.40.920.10 Alpha Beta;3-Layer(aba) Sandwich;Pyruvate-ferredoxin Oxidoreductase; domain 3;Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.8027 12 196 3.40.920.10
2raaA00 Alpha Beta;3-Layer(aba) Sandwich;Pyruvate-ferredoxin Oxidoreductase; domain 3;Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.7657 9 196 3.40.920.10
af_Q2FZ05_1_182_3.40.920.10 Alpha Beta;3-Layer(aba) Sandwich;Pyruvate-ferredoxin Oxidoreductase; domain 3;Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.7652 11 196 3.40.920.10
IDDescriptionScoreStartEndGO Terms
AF-A0A7V7AHV9-F1-model_v4 Uncharacterized/unreviewed 0.9541 21 199
AF-A0A7X7DQN3-F1-model_v4 Uncharacterized/unreviewed 0.9502 12 198

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.81 0.88 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.