Protein Family IF12058

Metagenome Isolate
140 Members
41 Samples
135 Scaffolds
364.1 Avg Length

🧬 Representative Sequence

ID
iso_pr_bacteria|2820371985|2820373131|
Length
409 aa
Sequence
MKRMKTTVAVLLAFVMIFSLAACGSGSSGSGGGGGSSASSGGSGSSGSGSGSSSSAGSSAGSSSGSSATAGLNIGIVTTSGVDDGNFGQDCYNGILAFINDHPDAKVTAIKEPDNSKVNDAVAAVIADYDVLVLPGFQFSPAGAIGLSNPDKKIILVDVYPQDENGEEVELDNIYAMLFKEEESGFFAGIAAAMESKTGKVAVVNGIAFPSNVNYQYGFMAGVNYANKYYGTNTQYVELPSYAGTDVTGANVGGNYIGDFADEATGKIVGNALIDQGVDVLFVAAGASGNGVFAAAKEANNVWLIGCDVDQYDDGAKGNSNIILTSALKVMNLNVTRQLKAISDGSFKGQNAILGADTDSTGYVSASGRQQLGADTLKKMEEAYGALKEGKIVPPANFNGLSPTSFTGL

πŸ“Š Sample Types

Isolate 3.6%
Metagenome 96.4%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Kalotermitidae 33.3%
Termitidae 33.3%
Unclassified 20.5%
Termopsidae 7.7%
Rhinotermitidae 5.1%

🌳 Taxonomy

Archaea 0
Bacteria 128
Eukaryota 0
Viruses 0
Unclassified 12

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
2 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
3 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
4 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
5 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
6 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
7 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
8 2820831444 Unclassified Actinobacteria Nc150P4bin21 Isolate Unclassified
9 2820916033 Unclassified Actinobacteria Emb289P3bin63 Isolate Unclassified
10 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
11 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
12 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
13 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
14 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
15 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
16 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
17 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
18 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
19 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
20 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
21 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
22 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
23 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
24 2820371985 Unclassified Firmicutes Nt197P3bin100 Isolate Unclassified
25 2820848511 Unclassified Actinobacteria Lab288P3bin86 Isolate Unclassified
26 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
27 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
28 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
29 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
30 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
31 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
32 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
33 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
34 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
35 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
36 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
37 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
38 2820800812 Unclassified Actinobacteria Th196P4bin28 Isolate Unclassified
39 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
40 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
41 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_037219 3300042612 Unclassified 2252
2 Ga0466710_127126 3300042613 Bacteria 2470
3 Ga0466712_281832 3300042614 Bacteria 1018
4 Ga0466711_238027 3300042615 Bacteria 1184
5 Ga0466711_271863 3300042615 Bacteria 5987
6 Ga0466711_314542 3300042615 Bacteria 2084
7 Ga0466718_028513 3300042617 Bacteria 21285
8 Ga0466718_065357 3300042617 Bacteria 4698
9 Ga0466718_124745 3300042617 Bacteria 7073
10 Ga0466718_141085 3300042617 Bacteria 8364
11 Ga0466726_047305 3300042619 Bacteria 3628
12 Ga0466728_365309 3300042620 Unclassified 1903
13 Ga0466729_040068 3300042621 Bacteria 4473
14 Ga0466690_094819 3300042590 Bacteria 5494
15 Ga0466693_115825 3300042592 Bacteria 2929
16 Ga0466691_049078 3300042593 Unclassified 9467
17 Ga0466696_501510 3300042596 Bacteria 7194
18 Ga0466707_167748 3300042601 Bacteria 2079
19 Ga0466713_130567 3300042602 Bacteria 13992
20 Ga0466703_063180 3300042636 Bacteria 20066
21 Ga0466704_175905 3300042643 Bacteria 11494
22 Ga0466704_225379 3300042643 Bacteria 1573
23 Ga0466709_144100 3300042648 Bacteria 6135
24 Ga0466708_100861 3300042652 Bacteria 4478
25 Ga0466727_311678 3300042655 Bacteria 2084
26 Ga0466705_039749 3300042612 Bacteria 30204
27 Ga0466732_102542 3300042656 Bacteria 4038
28 Ga0466712_007559 3300042614 Bacteria 17080
29 Ga0466726_174006 3300042619 Bacteria 13818
30 Ga0123353_10289105 3300010167 Bacteria 2511
31 Ga0466690_232630 3300042590 Unclassified 5858
32 Ga0466696_123772 3300042596 Bacteria 21222
33 JGI24698J34947_10003389 3300002449 Bacteria 8652
34 Ga0466708_179612 3300042652 Bacteria 7198
35 Ga0466727_238372 3300042655 Bacteria 3025
36 Ga0466705_377581 3300042612 Bacteria 3188
37 Ga0466712_158350 3300042614 Bacteria 6687
38 Ga0466711_160759 3300042615 Bacteria 26057
39 Ga0466711_278249 3300042615 Bacteria 30666
40 Ga0123353_10154303 3300010167 Unclassified 3663
41 Ga0466699_289983 3300042597 Bacteria 1913
42 Ga0068305_10091520 3300005083 Bacteria 1549
43 Ga0466735_042810 3300042624 Bacteria 4452
44 Ga0466704_377238 3300042643 Bacteria 6659
45 Ga0466712_076363 3300042614 Bacteria 19984
46 Ga0466712_112999 3300042614 Bacteria 56841
47 Ga0466712_231266 3300042614 Unclassified 8263
48 Ga0466715_156525 3300042616 Bacteria 8876
49 Ga0466723_259585 3300042618 Bacteria 4671
50 Ga0466723_354240 3300042618 Bacteria 10659
51 Ga0466729_116638 3300042621 Unclassified 2004
52 Ga0123353_10073857 3300010167 Bacteria 5482
53 Ga0466690_106800 3300042590 Bacteria 1742
54 Ga0466692_171620 3300042591 Bacteria 5713
55 Ga0466699_208206 3300042597 Bacteria 4950
56 Ga0466707_211213 3300042601 Bacteria 4146
57 JGI24698J34947_10000951 3300002449 Unclassified 14737
58 JGI24702J35022_10000009 3300002462 Bacteria 81427
59 Ga0466735_065511 3300042624 Bacteria 9261
60 Ga0466703_213048 3300042636 Unclassified 11285
61 Ga0466705_105866 3300042612 Bacteria 5294
62 Ga0466705_356902 3300042612 Bacteria 10254
63 Ga0466712_281314 3300042614 Bacteria 7052
64 Ga0466711_043548 3300042615 Bacteria 3005
65 Ga0466718_025507 3300042617 Bacteria 27042
66 Ga0466718_120652 3300042617 Bacteria 11624
67 Ga0466723_048299 3300042618 Bacteria 5207
68 Ga0264413_105118 3300024493 Bacteria 8717
69 Ga0466699_130336 3300042597 Bacteria 7473
70 Ga0466716_115153 3300042605 Bacteria 5560
71 Ga0466720_100304 3300042607 Bacteria 1442
72 JGI24698J34947_10002658 3300002449 Bacteria 9636
73 JGI24698J34947_10003994 3300002449 Bacteria 8025
74 Ga0072941_1425917 3300005201 Bacteria 1342
75 Ga0466703_382179 3300042636 Bacteria 10644
76 Ga0466704_413754 3300042643 Bacteria 3053
77 Ga0466708_228889 3300042652 Bacteria 2986
78 Ga0466705_278453 3300042612 Bacteria 9687
79 Ga0466705_311410 3300042612 Bacteria 7690
80 Ga0466705_434088 3300042612 Bacteria 7916
81 Ga0466705_498899 3300042612 Bacteria 3943
82 Ga0466715_427135 3300042616 Bacteria 5029
83 Ga0466723_061750 3300042618 Bacteria 30747
84 Ga0466728_243678 3300042620 Bacteria 1315
85 Ga0466728_457683 3300042620 Bacteria 1552
86 Ga0466691_027868 3300042593 Bacteria 6651
87 Ga0466695_054104 3300042595 Bacteria 12771
88 Ga0466699_181307 3300042597 Bacteria 1974
89 Ga0466707_044543 3300042601 Bacteria 11459
90 Ga0466720_067705 3300042607 Bacteria 18756
91 JGI24702J35022_10074318 3300002462 Bacteria 1834
92 Ga0068305_10203592 3300005083 Bacteria 20045
93 Ga0466704_189406 3300042643 Bacteria 2134
94 Ga0466727_027368 3300042655 Bacteria 9336
95 Ga0466705_099239 3300042612 Unclassified 2351
96 Ga0466715_427744 3300042616 Bacteria 31942
97 Ga0466718_170529 3300042617 Unclassified 1027
98 Ga0466723_022003 3300042618 Bacteria 18279
99 Ga0466723_195461 3300042618 Bacteria 56859
100 Ga0466726_227479 3300042619 Bacteria 6610
101 Ga0466728_047995 3300042620 Bacteria 6919
102 Ga0123354_10011674 3300010882 Bacteria 13597
103 Ga0466691_076223 3300042593 Bacteria 5896
104 Ga0466696_050823 3300042596 Bacteria 14659
105 Ga0466696_146770 3300042596 Bacteria 3380
106 Ga0466699_035306 3300042597 Bacteria 10945
107 Ga0466699_126849 3300042597 Bacteria 15271
108 Ga0466699_160528 3300042597 Bacteria 1265
109 Ga0466713_138385 3300042602 Bacteria 336961
110 Ga0466720_012868 3300042607 Bacteria 4914
111 Ga0466720_200411 3300042607 Bacteria 2755
112 JGI24698J34947_10001309 3300002449 Bacteria 13066
113 Ga0466703_414316 3300042636 Bacteria 6122
114 Ga0466704_545342 3300042643 Bacteria 14429
115 Ga0466709_018700 3300042648 Unclassified 4913
116 Ga0466708_023530 3300042652 Bacteria 1311
117 Ga0466708_081607 3300042652 Bacteria 2286
118 Ga0466718_124135 3300042617 Bacteria 2216
119 Ga0466726_108933 3300042619 Bacteria 6274
120 Ga0466726_407997 3300042619 Bacteria 4564
121 Ga0466729_072262 3300042621 Bacteria 1948
122 Ga0123353_10004974 3300010167 Bacteria 17315
123 Ga0466691_030900 3300042593 Bacteria 6532
124 Ga0466691_202049 3300042593 Bacteria 5462
125 Ga0466707_016519 3300042601 Bacteria 20976
126 Ga0466707_050297 3300042601 Bacteria 3571
127 Ga0466720_109497 3300042607 Bacteria 28074
128 JGI24696J40584_12957454 3300002834 Bacteria 3522
129 Ga0466729_302148 3300042621 Bacteria 2074
130 Ga0466703_034993 3300042636 Bacteria 12051
131 Ga0466703_147002 3300042636 Bacteria 25312
132 Ga0466704_228543 3300042643 Bacteria 21203
133 Ga0466709_017629 3300042648 Bacteria 12397
134 Ga0466708_289217 3300042652 Bacteria 6913
135 Ga0466727_192509 3300042655 Bacteria 2670

πŸ“‹ Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042617 Ga0466718_170529 Ga0466718_170529_74_961 283
2 3300042614 Ga0466712_281832 Ga0466712_281832_10_909 292
3 3300042652 Ga0466708_023530 Ga0466708_023530_25_1014 329
4 iso_pr_bacteria 2820916033 2820916607 333
5 3300042612 Ga0466705_037219 Ga0466705_037219_91_1101 336
6 3300042615 Ga0466711_271863 Ga0466711_271863_3669_4799 338
7 3300002449 JGI24698J34947_10001309 JGI24698J34947_100013097 339
8 3300042614 Ga0466712_007559 Ga0466712_007559_9262_10383 339
9 3300042614 Ga0466712_281314 Ga0466712_281314_375_1496 339
10 3300042607 Ga0466720_100304 Ga0466720_100304_241_1359 340
11 3300042614 Ga0466712_112999 Ga0466712_112999_8091_9212 340
12 3300002449 JGI24698J34947_10003389 JGI24698J34947_100033894 341
13 3300042601 Ga0466707_044543 Ga0466707_044543_8590_9798 343
14 3300042620 Ga0466728_047995 Ga0466728_047995_3354_4478 343
15 3300002449 JGI24698J34947_10000951 JGI24698J34947_100009514 344
16 3300042612 Ga0466705_356902 Ga0466705_356902_3936_5060 345
17 3300002449 JGI24698J34947_10003994 JGI24698J34947_100039944 346
18 3300042597 Ga0466699_130336 Ga0466699_130336_3899_5017 346
19 3300042597 Ga0466699_289983 Ga0466699_289983_12_1094 346
20 3300042643 Ga0466704_413754 Ga0466704_413754_623_1789 347
21 3300042614 Ga0466712_231266 Ga0466712_231266_4227_5354 348
22 3300042617 Ga0466718_120652 Ga0466718_120652_2450_3595 348
23 3300002449 JGI24698J34947_10002658 JGI24698J34947_100026582 349
24 3300042602 Ga0466713_130567 Ga0466713_130567_7382_8566 349
25 3300042656 Ga0466732_102542 Ga0466732_102542_2691_3809 350
26 3300042595 Ga0466695_054104 Ga0466695_054104_7945_9057 351
27 3300042617 Ga0466718_141085 Ga0466718_141085_6623_7735 351
28 3300042652 Ga0466708_179612 Ga0466708_179612_3872_4996 352
29 3300042597 Ga0466699_126849 Ga0466699_126849_3899_5023 353
30 3300042597 Ga0466699_181307 Ga0466699_181307_611_1732 353
31 3300042601 Ga0466707_016519 Ga0466707_016519_9420_10610 354
32 3300042618 Ga0466723_048299 Ga0466723_048299_3775_4965 355
33 3300042593 Ga0466691_076223 Ga0466691_076223_1845_2966 356
34 3300042597 Ga0466699_208206 Ga0466699_208206_1966_3102 356
35 3300042619 Ga0466726_108933 Ga0466726_108933_1611_2735 356
36 3300042655 Ga0466727_238372 Ga0466727_238372_325_1452 356
37 3300042655 Ga0466727_027368 Ga0466727_027368_7613_8719 357
38 3300042617 Ga0466718_025507 Ga0466718_025507_14055_15167 358
39 3300042617 Ga0466718_124745 Ga0466718_124745_4413_5525 358
40 3300002462 JGI24702J35022_10074318 JGI24702J35022_100743181 359
41 3300010167 Ga0123353_10289105 Ga0123353_102891053 359
42 3300042593 Ga0466691_030900 Ga0466691_030900_1682_2812 359
43 3300042596 Ga0466696_050823 Ga0466696_050823_556_1671 359
44 3300042617 Ga0466718_028513 Ga0466718_028513_2576_3691 359
45 3300042617 Ga0466718_124135 Ga0466718_124135_151_1266 359
46 3300024493 Ga0264413_105118 Ga0264413_1051186 360
47 3300042590 Ga0466690_232630 Ga0466690_232630_3585_4700 360
48 3300042597 Ga0466699_160528 Ga0466699_160528_57_1169 360
49 3300042612 Ga0466705_311410 Ga0466705_311410_4445_5620 360
50 3300042636 Ga0466703_147002 Ga0466703_147002_6608_7720 360
51 3300042643 Ga0466704_189406 Ga0466704_189406_340_1437 360
52 3300042596 Ga0466696_146770 Ga0466696_146770_465_1619 361
53 3300042607 Ga0466720_067705 Ga0466720_067705_13804_14925 361
54 3300042615 Ga0466711_043548 Ga0466711_043548_283_1401 361
55 3300042615 Ga0466711_314542 Ga0466711_314542_757_1938 361
56 3300042617 Ga0466718_065357 Ga0466718_065357_31_1140 361
57 3300042620 Ga0466728_243678 Ga0466728_243678_33_1118 361
58 3300042614 Ga0466712_076363 Ga0466712_076363_11792_12913 362
59 3300042636 Ga0466703_382179 Ga0466703_382179_7682_8821 362
60 3300005083 Ga0068305_10203592 Ga0068305_102035925 363
61 3300042591 Ga0466692_171620 Ga0466692_171620_1136_2314 363
62 3300042618 Ga0466723_195461 Ga0466723_195461_35100_36227 363
63 3300042592 Ga0466693_115825 Ga0466693_115825_1080_2219 364
64 3300042607 Ga0466720_200411 Ga0466720_200411_1237_2367 364
65 3300010167 Ga0123353_10154303 Ga0123353_101543032 365
66 3300042601 Ga0466707_167748 Ga0466707_167748_766_1914 365
67 3300042615 Ga0466711_278249 Ga0466711_278249_15716_16813 365
68 3300042636 Ga0466703_414316 Ga0466703_414316_4366_5484 365
69 3300002462 JGI24702J35022_10000009 JGI24702J35022_1000000956 366
70 3300042590 Ga0466690_094819 Ga0466690_094819_2759_3889 367
71 3300042605 Ga0466716_115153 Ga0466716_115153_900_2009 369
72 3300042612 Ga0466705_377581 Ga0466705_377581_1376_2515 369
73 3300042613 Ga0466710_127126 Ga0466710_127126_434_1543 369
74 3300042615 Ga0466711_160759 Ga0466711_160759_19981_21117 369
75 3300042618 Ga0466723_354240 Ga0466723_354240_720_1829 369
76 3300042621 Ga0466729_116638 Ga0466729_116638_594_1727 369
77 3300042636 Ga0466703_034993 Ga0466703_034993_2727_3878 369
78 3300002834 JGI24696J40584_12957454 JGI24696J40584_129574542 370
79 3300010167 Ga0123353_10004974 Ga0123353_1000497411 370
80 3300042597 Ga0466699_035306 Ga0466699_035306_175_1287 370
81 3300042612 Ga0466705_278453 Ga0466705_278453_5390_6577 370
82 3300042621 Ga0466729_040068 Ga0466729_040068_2081_3193 370
83 3300042615 Ga0466711_238027 Ga0466711_238027_55_1170 371
84 3300042621 Ga0466729_302148 Ga0466729_302148_546_1661 371
85 3300042643 Ga0466704_377238 Ga0466704_377238_3108_4250 371
86 3300005201 Ga0072941_1425917 Ga0072941_14259171 372
87 3300042593 Ga0466691_202049 Ga0466691_202049_2162_3280 372
88 3300042612 Ga0466705_498899 Ga0466705_498899_624_1742 372
89 3300042616 Ga0466715_427744 Ga0466715_427744_17583_18701 372
90 3300042618 Ga0466723_022003 Ga0466723_022003_12302_13420 372
91 3300042618 Ga0466723_259585 Ga0466723_259585_2580_3698 372
92 3300042620 Ga0466728_365309 Ga0466728_365309_281_1399 372
93 3300042621 Ga0466729_072262 Ga0466729_072262_552_1703 372
94 3300042624 Ga0466735_042810 Ga0466735_042810_2768_3886 372
95 3300042648 Ga0466709_017629 Ga0466709_017629_7288_8406 372
96 3300042612 Ga0466705_039749 Ga0466705_039749_18719_19888 373
97 3300042614 Ga0466712_158350 Ga0466712_158350_2851_3972 373
98 3300042620 Ga0466728_457683 Ga0466728_457683_165_1286 373
99 3300042590 Ga0466690_106800 Ga0466690_106800_72_1196 374
100 3300042596 Ga0466696_123772 Ga0466696_123772_16820_17944 374
101 3300042596 Ga0466696_501510 Ga0466696_501510_5331_6455 374
102 3300042607 Ga0466720_012868 Ga0466720_012868_3535_4659 374
103 3300042612 Ga0466705_099239 Ga0466705_099239_626_1777 374
104 3300042612 Ga0466705_105866 Ga0466705_105866_1949_3073 374
105 3300042616 Ga0466715_427135 Ga0466715_427135_206_1330 374
106 3300042619 Ga0466726_047305 Ga0466726_047305_1456_2580 374
107 3300042636 Ga0466703_213048 Ga0466703_213048_3005_4129 374
108 3300042643 Ga0466704_545342 Ga0466704_545342_12038_13162 374
109 3300042593 Ga0466691_027868 Ga0466691_027868_1271_2398 375
110 3300042612 Ga0466705_434088 Ga0466705_434088_684_1811 375
111 3300042616 Ga0466715_156525 Ga0466715_156525_5065_6192 375
112 3300042619 Ga0466726_227479 Ga0466726_227479_4148_5323 375
113 3300042643 Ga0466704_175905 Ga0466704_175905_10080_11207 375
114 3300042643 Ga0466704_228543 Ga0466704_228543_18072_19199 375
115 3300042655 Ga0466727_192509 Ga0466727_192509_322_1449 375
116 3300042619 Ga0466726_174006 Ga0466726_174006_696_1826 376
117 3300042636 Ga0466703_063180 Ga0466703_063180_11536_12666 376
118 3300042607 Ga0466720_109497 Ga0466720_109497_18088_19221 377
119 3300042619 Ga0466726_407997 Ga0466726_407997_2686_3819 377
120 3300042652 Ga0466708_289217 Ga0466708_289217_5413_6567 377
121 3300010167 Ga0123353_10073857 Ga0123353_100738573 378
122 3300042652 Ga0466708_081607 Ga0466708_081607_173_1372 378
123 3300042601 Ga0466707_050297 Ga0466707_050297_1102_2244 380
124 3300042601 Ga0466707_211213 Ga0466707_211213_566_1708 380
125 iso_pr_bacteria 2820800812 2820801209 380
126 3300042655 Ga0466727_311678 Ga0466727_311678_210_1454 381
127 iso_pr_bacteria 2820848511 2820849500 381
128 3300042643 Ga0466704_225379 Ga0466704_225379_75_1280 382
129 3300042624 Ga0466735_065511 Ga0466735_065511_4081_5268 383
130 3300042618 Ga0466723_061750 Ga0466723_061750_8928_10082 384
131 3300042593 Ga0466691_049078 Ga0466691_049078_5777_6934 385
132 3300042648 Ga0466709_018700 Ga0466709_018700_537_1694 385
133 3300042652 Ga0466708_228889 Ga0466708_228889_556_1713 385
134 3300005083 Ga0068305_10091520 Ga0068305_100915201 386
135 3300042648 Ga0466709_144100 Ga0466709_144100_953_2116 387
136 3300010882 Ga0123354_10011674 Ga0123354_100116748 388
137 iso_pr_bacteria 2820831444 2820832679 389
138 3300042602 Ga0466713_138385 Ga0466713_138385_24494_25672 392
139 3300042652 Ga0466708_100861 Ga0466708_100861_2852_4039 395
140 iso_pr_bacteria 2820371985 2820373131 409

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF02608 Bmp ABC transporter substrate-binding protein PnrA-like 73 238 0.93

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF02608 GO:0005886 plasma membrane CC

βš›οΈ Structure & Feature Viewer

pLDDTpTMQuality
0.76 0.84 High

Powered by Feature Viewer

Powered by PDBe Molstar

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.