Protein Family IF12056

Metagenome Isolate
139 Members
42 Samples
124 Scaffolds
218.86 Avg Length

🧬 Representative Sequence

ID
iso_pr_bacteria|2820367663|2820369138|
Length
216 aa
Sequence
MSKIAPSLLAADALHLGREAGLAAGMGCDYFHLDIMDGVFVPNLSFGPHVLAGLRREVGAVYDVHLMVIDPLPFIDVFAENGADILTVHVEARHFEESLAKIRGLGLRAGASLRPGTQARAIEPYFNLLDLILVMTVEPGFGGQSFMADMLPKIRAIREYITQHGLDCELEVDGGVNPETAKLCIDAGANVLVAGSDVFGQADRVGRIEQLRTVGG

📊 Sample Types

Isolate 10.8%
Metagenome 89.2%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 45.2%
Unclassified 35.7%
Kalotermitidae 11.9%
Termopsidae 4.8%
Rhinotermitidae 2.4%

🌳 Taxonomy

Archaea 0
Bacteria 134
Eukaryota 0
Viruses 0
Unclassified 5

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820367663 Unclassified Firmicutes Nt197P3bin105 Isolate Unclassified
2 2820442516 Unclassified Firmicutes Lab288P3bin200 Isolate Unclassified
3 2820683647 Unclassified Firmicutes Co191P1bin82 Isolate Unclassified
4 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
5 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
6 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
7 2820661146 Unclassified Firmicutes Co191P3bin61 Isolate Unclassified
8 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
9 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
10 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
11 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
12 2820220859 Unclassified Firmicutes Th196P4bin59 Isolate Unclassified
13 2820259584 Unclassified Firmicutes Th196P3bin43 Isolate Unclassified
14 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
15 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
16 2820282995 Unclassified Firmicutes Th196P3bin147 Isolate Unclassified
17 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
18 2820637417 Unclassified Firmicutes Emb289P1bin108 Isolate Unclassified
19 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
20 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
21 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
22 2820231849 Unclassified Firmicutes Th196P4bin1 Isolate Unclassified
23 2820587002 Unclassified Firmicutes Emb289P1bin94 Isolate Unclassified
24 2820690275 Unclassified Firmicutes Co191P1bin72 Isolate Unclassified
25 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
26 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
27 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
28 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
29 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
30 2820318056 Unclassified Firmicutes Nt197P3bin94 Isolate Unclassified
31 2820566695 Unclassified Firmicutes Emb289P3bin50 Isolate Unclassified
32 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
33 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
34 2585428085 Sporobacter termitidis DSM 10068 Isolate Termitidae
35 2820620956 Unclassified Firmicutes Emb289P1bin128 Isolate Unclassified
36 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
37 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
38 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
39 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
40 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
41 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
42 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466696_009511 3300042596 Bacteria 19262
2 Ga0466733_099931 3300042659 Bacteria 1023
3 Ga0123355_10000345 3300009826 Bacteria 60128
4 Ga0123355_10000428 3300009826 Bacteria 55084
5 Ga0123355_10006430 3300009826 Bacteria 17404
6 Ga0123356_10078661 3300010049 Bacteria 3113
7 Ga0123356_10177692 3300010049 Bacteria 2147
8 Ga0123356_10179098 3300010049 Bacteria 2140
9 Ga0123353_10338517 3300010167 Bacteria 2273
10 Ga0123353_10523042 3300010167 Bacteria 1720
11 Ga0123354_10470426 3300010882 Bacteria 1002
12 Ga0466727_188399 3300042655 Bacteria 1811
13 JGI24695J34938_10001211 3300002450 Bacteria 22875
14 JGI24695J34938_10005074 3300002450 Bacteria 8368
15 Ga0466723_304467 3300042618 Bacteria 8274
16 Ga0466707_085827 3300042601 Bacteria 2003
17 Ga0466707_306007 3300042601 Bacteria 8691
18 Ga0466721_045075 3300042608 Bacteria 1002
19 Ga0123355_10615096 3300009826 Bacteria 1283
20 Ga0123356_10018553 3300010049 Bacteria 6603
21 Ga0123356_10053279 3300010049 Bacteria 3765
22 Ga0123356_10245442 3300010049 Bacteria 1865
23 Ga0123356_10760459 3300010049 Bacteria 1139
24 Ga0123353_10128153 3300010167 Bacteria 4075
25 Ga0123353_10175022 3300010167 Bacteria 3403
26 Ga0123353_10177989 3300010167 Bacteria 3370
27 Ga0123353_10184596 3300010167 Bacteria 3299
28 Ga0123354_10296932 3300010882 Bacteria 1536
29 Ga0466702_005542 3300042635 Bacteria 1565
30 JGI24702J35022_10028662 3300002462 Bacteria 2991
31 Ga0466722_001883 3300042609 Bacteria 4121
32 Ga0466690_038287 3300042590 Bacteria 3727
33 Ga0123356_10010149 3300010049 Bacteria 9262
34 Ga0123356_10041855 3300010049 Bacteria 4269
35 Ga0123356_10292260 3300010049 Bacteria 1730
36 Ga0123356_10299000 3300010049 Bacteria 1714
37 Ga0123356_10773833 3300010049 Bacteria 1130
38 Ga0123353_10186690 3300010167 Bacteria 3278
39 Ga0123353_10813334 3300010167 Bacteria 1288
40 Ga0123353_11658709 3300010167 Unclassified 803
41 Ga0123354_10653989 3300010882 Unclassified 750
42 Ga0466707_154428 3300042601 Bacteria 101562
43 Ga0466707_236563 3300042601 Bacteria 2991
44 Ga0466693_369333 3300042592 Bacteria 1173
45 Ga0466699_120066 3300042597 Bacteria 1761
46 Ga0123355_10002906 3300009826 Bacteria 24334
47 Ga0123356_10008227 3300010049 Bacteria 10380
48 Ga0123356_10378270 3300010049 Bacteria 1548
49 Ga0123356_10658349 3300010049 Bacteria 1215
50 Ga0123356_11515257 3300010049 Unclassified 828
51 Ga0123353_10011197 3300010167 Bacteria 12616
52 Ga0123353_10051804 3300010167 Bacteria 6551
53 Ga0123353_10470961 3300010167 Bacteria 1842
54 Ga0123353_11087869 3300010167 Bacteria 1063
55 Ga0123354_10160165 3300010882 Unclassified 2676
56 Ga0123354_10245855 3300010882 Bacteria 1827
57 JGI24695J34938_10026085 3300002450 Bacteria 2781
58 JGI24702J35022_10002003 3300002462 Bacteria 12556
59 JGI24705J35276_12220865 3300002504 Bacteria 2295
60 Ga0466717_020566 3300042604 Bacteria 1151
61 Ga0415639_002379 3300038395 Bacteria 17171
62 Ga0123355_10046098 3300009826 Bacteria 7091
63 Ga0123356_10338674 3300010049 Bacteria 1624
64 Ga0123356_10606263 3300010049 Bacteria 1260
65 Ga0123353_10292963 3300010167 Bacteria 2490
66 Ga0123353_11028504 3300010167 Bacteria 1103
67 Ga0123353_11383692 3300010167 Bacteria 906
68 Ga0466734_065213 3300042623 Bacteria 1311
69 Ga0466717_056180 3300042604 Bacteria 1422
70 Ga0123355_10086313 3300009826 Bacteria 4991
71 Ga0123355_10430665 3300009826 Bacteria 1678
72 Ga0123356_10020768 3300010049 Bacteria 6211
73 Ga0123356_10021754 3300010049 Bacteria 6053
74 Ga0123356_10034223 3300010049 Bacteria 4749
75 Ga0123356_10240817 3300010049 Bacteria 1880
76 Ga0123356_10265043 3300010049 Bacteria 1804
77 Ga0123353_10000753 3300010167 Bacteria 39300
78 Ga0123353_10319549 3300010167 Bacteria 2357
79 Ga0123353_11176300 3300010167 Bacteria 1009
80 Ga0466725_391341 3300042654 Bacteria 1568
81 JGI24702J35022_10001259 3300002462 Bacteria 15794
82 JGI24702J35022_10015518 3300002462 Bacteria 4191
83 JGI24702J35022_10015819 3300002462 Bacteria 4145
84 Ga0466693_250246 3300042592 Bacteria 1300
85 Ga0466694_101807 3300042594 Bacteria 14300
86 Ga0466733_138800 3300042659 Bacteria 3606
87 Ga0123355_10012902 3300009826 Bacteria 12970
88 Ga0123355_10121106 3300009826 Bacteria 4058
89 Ga0123355_10208567 3300009826 Bacteria 2838
90 Ga0123355_10390199 3300009826 Bacteria 1805
91 Ga0123356_10000242 3300010049 Bacteria 62970
92 Ga0123356_10000703 3300010049 Bacteria 36998
93 Ga0123356_10163875 3300010049 Unclassified 2224
94 Ga0123356_10191109 3300010049 Bacteria 2078
95 Ga0123356_10223877 3300010049 Bacteria 1940
96 Ga0123356_10549486 3300010049 Bacteria 1316
97 Ga0123356_10891722 3300010049 Bacteria 1061
98 Ga0123356_11233126 3300010049 Bacteria 913
99 Ga0123356_11361361 3300010049 Bacteria 871
100 Ga0123353_10078284 3300010167 Bacteria 5314
101 Ga0123353_10200979 3300010167 Bacteria 3135
102 Ga0123353_10463754 3300010167 Bacteria 1860
103 Ga0123353_10920091 3300010167 Bacteria 1188
104 Ga0123354_10118002 3300010882 Bacteria 3448
105 Ga0466702_126641 3300042635 Bacteria 1245
106 Ga0466705_186213 3300042612 Bacteria 7704
107 Ga0466707_061222 3300042601 Bacteria 6441
108 Ga0466719_484682 3300042606 Bacteria 3944
109 Ga0123357_10185201 3300009784 Bacteria 2418
110 Ga0123355_10000103 3300009826 Bacteria 93124
111 Ga0123355_10158944 3300009826 Bacteria 3410
112 Ga0123356_10113483 3300010049 Bacteria 2622
113 Ga0123356_10176567 3300010049 Bacteria 2153
114 Ga0123356_10374406 3300010049 Bacteria 1555
115 Ga0123356_10536535 3300010049 Bacteria 1330
116 Ga0123356_11135947 3300010049 Bacteria 949
117 Ga0123356_11408601 3300010049 Bacteria 857
118 Ga0123353_10153657 3300010167 Bacteria 3672
119 Ga0123353_10164551 3300010167 Bacteria 3528
120 Ga0123353_11755866 3300010167 Bacteria 774
121 Ga0466702_085278 3300042635 Bacteria 2806
122 Ga0466725_124122 3300042654 Bacteria 1023
123 JGI24702J35022_10000481 3300002462 Bacteria 24075
124 Ga0466726_176702 3300042619 Bacteria 18406

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042597 Ga0466699_120066 Ga0466699_120066_640_1260 206
2 3300010882 Ga0123354_10160165 Ga0123354_101601651 211
3 3300009826 Ga0123355_10121106 Ga0123355_101211064 214
4 3300009826 Ga0123355_10615096 Ga0123355_106150962 214
5 3300042601 Ga0466707_061222 Ga0466707_061222_627_1271 214
6 3300042601 Ga0466707_154428 Ga0466707_154428_74224_74868 214
7 3300002462 JGI24702J35022_10028662 JGI24702J35022_100286621 215
8 3300010049 Ga0123356_10240817 Ga0123356_102408173 215
9 3300010049 Ga0123356_10374406 Ga0123356_103744061 215
10 3300010167 Ga0123353_10175022 Ga0123353_101750222 215
11 3300010167 Ga0123353_10186690 Ga0123353_101866903 215
12 3300010167 Ga0123353_10319549 Ga0123353_103195493 215
13 3300010167 Ga0123353_11087869 Ga0123353_110878691 215
14 3300010882 Ga0123354_10296932 Ga0123354_102969321 215
15 3300038395 Ga0415639_002379 Ga0415639_002379_9230_9877 215
16 3300042592 Ga0466693_369333 Ga0466693_369333_359_1006 215
17 3300042601 Ga0466707_085827 Ga0466707_085827_1299_1946 215
18 3300042604 Ga0466717_020566 Ga0466717_020566_74_721 215
19 3300042619 Ga0466726_176702 Ga0466726_176702_11492_12139 215
20 3300042635 Ga0466702_005542 Ga0466702_005542_375_1022 215
21 3300042635 Ga0466702_126641 Ga0466702_126641_567_1214 215
22 3300042654 Ga0466725_124122 Ga0466725_124122_204_851 215
23 iso_pr_bacteria 2820282995 2820285209 215
24 iso_pr_bacteria 2820442516 2820444065 215
25 iso_pr_bacteria 2820566695 2820567732 215
26 iso_pr_bacteria 2820620956 2820621476 215
27 iso_pr_bacteria 2820661146 2820662298 215
28 iso_pr_bacteria 2820690275 2820691399 215
29 3300002450 JGI24695J34938_10001211 JGI24695J34938_1000121112 216
30 3300009826 Ga0123355_10000428 Ga0123355_1000042825 216
31 3300009826 Ga0123355_10012902 Ga0123355_100129024 216
32 3300009826 Ga0123355_10390199 Ga0123355_103901992 216
33 3300009826 Ga0123355_10430665 Ga0123355_104306652 216
34 3300010049 Ga0123356_10000242 Ga0123356_1000024221 216
35 3300010049 Ga0123356_10000703 Ga0123356_1000070333 216
36 3300010049 Ga0123356_10008227 Ga0123356_100082279 216
37 3300010049 Ga0123356_10010149 Ga0123356_100101494 216
38 3300010049 Ga0123356_10018553 Ga0123356_100185533 216
39 3300010049 Ga0123356_10021754 Ga0123356_100217543 216
40 3300010049 Ga0123356_10034223 Ga0123356_100342233 216
41 3300010049 Ga0123356_10053279 Ga0123356_100532793 216
42 3300010049 Ga0123356_10078661 Ga0123356_100786614 216
43 3300010049 Ga0123356_10113483 Ga0123356_101134832 216
44 3300010049 Ga0123356_10177692 Ga0123356_101776922 216
45 3300010049 Ga0123356_10223877 Ga0123356_102238773 216
46 3300010049 Ga0123356_10265043 Ga0123356_102650432 216
47 3300010049 Ga0123356_10292260 Ga0123356_102922602 216
48 3300010049 Ga0123356_10338674 Ga0123356_103386741 216
49 3300010049 Ga0123356_10536535 Ga0123356_105365351 216
50 3300010049 Ga0123356_10606263 Ga0123356_106062632 216
51 3300010049 Ga0123356_10658349 Ga0123356_106583492 216
52 3300010049 Ga0123356_10773833 Ga0123356_107738331 216
53 3300010049 Ga0123356_10891722 Ga0123356_108917222 216
54 3300010049 Ga0123356_11135947 Ga0123356_111359472 216
55 3300010049 Ga0123356_11361361 Ga0123356_113613612 216
56 3300010049 Ga0123356_11515257 Ga0123356_115152571 216
57 3300010167 Ga0123353_10000753 Ga0123353_100007536 216
58 3300010167 Ga0123353_10184596 Ga0123353_101845962 216
59 3300042596 Ga0466696_009511 Ga0466696_009511_3608_4258 216
60 3300042654 Ga0466725_391341 Ga0466725_391341_556_1206 216
61 iso_pr_bacteria 2585428085 2587835309 216
62 iso_pr_bacteria 2820367663 2820369138 216
63 3300002462 JGI24702J35022_10015819 JGI24702J35022_100158193 217
64 3300002504 JGI24705J35276_12220865 JGI24705J35276_122208653 217
65 3300009826 Ga0123355_10006430 Ga0123355_100064303 217
66 3300010049 Ga0123356_10176567 Ga0123356_101765672 217
67 3300010049 Ga0123356_10191109 Ga0123356_101911092 217
68 3300010049 Ga0123356_11233126 Ga0123356_112331261 217
69 3300010167 Ga0123353_10128153 Ga0123353_101281534 217
70 3300010167 Ga0123353_10463754 Ga0123353_104637542 217
71 3300010167 Ga0123353_11176300 Ga0123353_111763002 217
72 3300010167 Ga0123353_11383692 Ga0123353_113836921 217
73 3300042594 Ga0466694_101807 Ga0466694_101807_11373_12026 217
74 3300042618 Ga0466723_304467 Ga0466723_304467_3198_3851 217
75 iso_pr_bacteria 2820220859 2820222549 217
76 iso_pr_bacteria 2820259584 2820261103 217
77 3300002450 JGI24695J34938_10026085 JGI24695J34938_100260853 218
78 3300002462 JGI24702J35022_10001259 JGI24702J35022_1000125911 218
79 3300009826 Ga0123355_10000103 Ga0123355_1000010313 218
80 3300009826 Ga0123355_10086313 Ga0123355_100863134 218
81 3300010167 Ga0123353_10153657 Ga0123353_101536571 218
82 3300010167 Ga0123353_10164551 Ga0123353_101645511 218
83 3300042604 Ga0466717_056180 Ga0466717_056180_472_1128 218
84 3300042635 Ga0466702_085278 Ga0466702_085278_1796_2452 218
85 iso_pr_bacteria 2820231849 2820233581 218
86 iso_pr_bacteria 2820318056 2820318338 218
87 iso_pr_bacteria 2820683647 2820684269 218
88 3300002462 JGI24702J35022_10000481 JGI24702J35022_100004818 219
89 3300002462 JGI24702J35022_10002003 JGI24702J35022_100020035 219
90 3300010049 Ga0123356_10299000 Ga0123356_102990001 219
91 3300010167 Ga0123353_11028504 Ga0123353_110285042 219
92 3300010167 Ga0123353_11658709 Ga0123353_116587091 219
93 3300010882 Ga0123354_10118002 Ga0123354_101180021 219
94 3300010882 Ga0123354_10245855 Ga0123354_102458551 219
95 3300042623 Ga0466734_065213 Ga0466734_065213_56_715 219
96 3300042655 Ga0466727_188399 Ga0466727_188399_1112_1771 219
97 3300042659 Ga0466733_138800 Ga0466733_138800_692_1351 219
98 3300009826 Ga0123355_10208567 Ga0123355_102085673 220
99 3300010049 Ga0123356_10760459 Ga0123356_107604592 220
100 3300010049 Ga0123356_11408601 Ga0123356_114086011 220
101 3300010167 Ga0123353_10051804 Ga0123353_100518047 220
102 3300042592 Ga0466693_250246 Ga0466693_250246_458_1120 220
103 3300042606 Ga0466719_484682 Ga0466719_484682_3244_3906 220
104 3300042608 Ga0466721_045075 Ga0466721_045075_61_723 220
105 iso_pr_bacteria 2820637417 2820637667 220
106 3300009826 Ga0123355_10158944 Ga0123355_101589443 221
107 3300010049 Ga0123356_10020768 Ga0123356_100207685 221
108 3300010049 Ga0123356_10041855 Ga0123356_100418556 221
109 3300010049 Ga0123356_10163875 Ga0123356_101638752 221
110 3300010049 Ga0123356_10245442 Ga0123356_102454421 221
111 3300010049 Ga0123356_10378270 Ga0123356_103782702 221
112 3300010049 Ga0123356_10549486 Ga0123356_105494861 221
113 3300010167 Ga0123353_10523042 Ga0123353_105230422 221
114 3300010167 Ga0123353_11755866 Ga0123353_117558661 221
115 3300042659 Ga0466733_099931 Ga0466733_099931_33_698 221
116 3300009826 Ga0123355_10046098 Ga0123355_100460989 222
117 3300010167 Ga0123353_10078284 Ga0123353_100782842 222
118 3300009826 Ga0123355_10002906 Ga0123355_1000290612 223
119 3300010167 Ga0123353_10292963 Ga0123353_102929632 223
120 3300010167 Ga0123353_10813334 Ga0123353_108133341 223
121 3300010882 Ga0123354_10470426 Ga0123354_104704261 223
122 3300010167 Ga0123353_10011197 Ga0123353_100111974 224
123 3300010167 Ga0123353_10177989 Ga0123353_101779893 224
124 3300010167 Ga0123353_10338517 Ga0123353_103385172 224
125 3300042601 Ga0466707_236563 Ga0466707_236563_1570_2247 225
126 3300042601 Ga0466707_306007 Ga0466707_306007_6628_7305 225
127 3300002462 JGI24702J35022_10015518 JGI24702J35022_100155183 226
128 3300010049 Ga0123356_10179098 Ga0123356_101790982 226
129 3300042590 Ga0466690_038287 Ga0466690_038287_347_1027 226
130 3300010167 Ga0123353_10920091 Ga0123353_109200911 227
131 3300009826 Ga0123355_10000345 Ga0123355_1000034540 230
132 3300042612 Ga0466705_186213 Ga0466705_186213_6000_6692 230
133 3300002450 JGI24695J34938_10005074 JGI24695J34938_100050743 231
134 3300009784 Ga0123357_10185201 Ga0123357_101852012 233
135 3300010167 Ga0123353_10470961 Ga0123353_104709613 233
136 3300010882 Ga0123354_10653989 Ga0123354_106539891 233
137 3300042609 Ga0466722_001883 Ga0466722_001883_1091_1798 235
138 iso_pr_bacteria 2820587002 2820587218 242
139 3300010167 Ga0123353_10200979 Ga0123353_102009793 248

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00834 Ribul_P_3_epim Ribulose-phosphate 3 epimerase family 3 199 0.99

🏗️ Structural Annotation – Top 5 Hits

IDDescriptionScoreStartEnd
2fli-assembly1.cif.gz_E The crystal structure of D-ribulose 5-phosphate 3-epimerase from Streptococus pyogenes complexed with D-xylitol 5-phosphate 0.979 1 214
1tqj-assembly1.cif.gz_B Crystal structure of D-ribulose 5-phosphate 3-epimerase from Synechocystis to 1.6 angstrom resolution 0.976 2 214
1rpx-assembly1.cif.gz_A D-RIBULOSE-5-PHOSPHATE 3-EPIMERASE FROM SOLANUM TUBEROSUM CHLOROPLASTS 0.975 2 214
7b1w-assembly2.cif.gz_K-3 Crystal structure of plastidial ribulose epimerase RPE1 from the model alga Chlamydomonas reinhardtii 0.975 2 213
7sbj-assembly1.cif.gz_C Crystal Structure of Ribulose-phosphate 3-epimerase from Stenotrophomonas maltophilia K279a 0.972 3 215
IDDescriptionScoreStartEndSuperfamily
2fliC00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9792 1 214 3.20.20.70
af_P0AG07_1_223_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9788 1 214 3.20.20.70
1tqjD00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9654 2 214 3.20.20.70
af_A0A1D6PJ99_41_293_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9581 2 205 3.20.20.70
af_P9WI51_4_223_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.958 2 216 3.20.20.70

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.92 0.92 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.