Protein Family IF12055

Metagenome Isolate
123 Members
69 Samples
98 Scaffolds
308.16 Avg Length

🧬 Representative Sequence

ID
iso_pr_bacteria|2820367663|2820369096|
Length
361 aa
Sequence
LETVFLPPQKTQVRADEDALIIFHKNGTCLDIRICGRIVKHHYDWRIIHRVGKRGERLVRFIVKRVFSAVVTLFVVATLTFFLMNIVPGGPFNTERASKKTVEAMERKYGLDKPLLEQYTMYMGRLLRFDLGDSYKRIGFSVNQIIGEKFPVSAGLGVVAICFALLMGVPAGVYAAYKRNSVVDRIIMFIATLGIAVPNFVMATTLLLLFGVALGWLPTLGLSSWQHYIMPAIALSFFPSCFIARLTRSSMLDVLGQDYIKTARAKGLAERKVIFKHALRISIVPVVSYLAILSAGVLTGGFVIERIFTVPGMGKFFIESINNRDYPLVMGTTVFFSAVLIFLNLIVDLLYGVIDPRIQYD

📊 Sample Types

Isolate 20.3%
Metagenome 79.7%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 26.5%
Termitidae 20.6%
Kalotermitidae 20.6%
Elmidae 7.4%
Rhinotermitidae 2.9%
Culicidae 2.9%
Passalidae 2.9%
Tenebrionidae 2.9%
Termopsidae 2.9%
Drosophilidae 1.5%
Nephropidae 1.5%
Armadillidiidae 1.5%
Scarabaeidae 1.5%
Hydrophilidae 1.5%
Curculionidae 1.5%
Hodotermitidae 1.5%

🌳 Taxonomy

Archaea 0
Bacteria 110
Eukaryota 0
Viruses 0
Unclassified 13

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2864909992 Bacillus velezensis S00166 Isolate Elmidae
2 2820367663 Unclassified Firmicutes Nt197P3bin105 Isolate Unclassified
3 2820389254 Unclassified Firmicutes Nc150P4bin19 Isolate Unclassified
4 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
5 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
6 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
7 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
8 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
9 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
10 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
11 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
12 2767802234 Cytobacillus kochii BDGP4 Isolate Drosophilidae
13 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
14 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
15 8043041867 Bacillus pumilus Ha06YP001 Isolate Nephropidae
16 3300012857 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG Metagenome Culicidae
17 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
18 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
19 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
20 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
21 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
22 2820903739 Unclassified Actinobacteria Emb289P4bin49 Isolate Unclassified
23 2864816158 Priestia aryabhattai S00060 Isolate Elmidae
24 2864981449 Sporosarcina sp. S00266 Isolate Elmidae
25 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
26 2820282995 Unclassified Firmicutes Th196P3bin147 Isolate Unclassified
27 2820362221 Unclassified Firmicutes Nt197P3bin116 Isolate Unclassified
28 650716102 Treponema primitia ZAS-2 Isolate Unclassified
29 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
30 2820882373 Unclassified Actinobacteria Lab288P1bin45 Isolate Unclassified
31 3300056790 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) Metagenome Tenebrionidae
32 3300056856 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) Metagenome Tenebrionidae
33 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
34 3300012847 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG Metagenome Armadillidiidae
35 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
36 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
37 2864801025 Bacillus aerius S00042 Isolate Elmidae
38 2820501819 Unclassified Firmicutes Lab288P1bin51 Isolate Unclassified
39 3300012845 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG Metagenome Culicidae
40 2864895409 Bacillus aerius S00152 Isolate Elmidae
41 2791355481 Bacillus sp. ZY-1-1 Isolate Scarabaeidae
42 2820312173 Unclassified Firmicutes Nt197P4bin8 Isolate Unclassified
43 2820332331 Unclassified Firmicutes Nt197P3bin75 Isolate Unclassified
44 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
45 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
46 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
47 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
48 2820857933 Unclassified Actinobacteria Lab288P3bin173 Isolate Unclassified
49 2873603790 Tessaracoccus coleopterorum HDW20 Isolate Hydrophilidae
50 2574180310 Bacillus licheniformis CG-B52 Isolate Unclassified
51 2820438595 Unclassified Firmicutes Lab288P3bin208 Isolate Unclassified
52 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
53 2990166910 Pseudomonas typographi CA3A Isolate Curculionidae
54 3002678670 Agromyces sp. G127AT Isolate Unclassified
55 3300012805 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG Metagenome
56 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
57 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
58 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
59 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
60 2209111004 Macrotermes natalensis queen gut microbiome Metagenome Termitidae
61 2820405014 Unclassified Firmicutes Lab288P4bin88 Isolate Unclassified
62 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
63 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
64 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
65 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
66 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
67 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
68 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
69 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466723_017882 3300042618 Bacteria 24080
2 Ga0466723_212999 3300042618 Bacteria 9859
3 Ga0466726_427681 3300042619 Bacteria 5211
4 Ga0466696_007242 3300042596 Bacteria 5198
5 Ga0466696_042464 3300042596 Unclassified 4977
6 Ga0123357_10021611 3300009784 Unclassified 8613
7 Ga0123356_10289396 3300010049 Bacteria 1738
8 Ga0123353_10126415 3300010167 Bacteria 4109
9 Ga0123353_10144158 3300010167 Bacteria 3811
10 Ga0466707_011223 3300042601 Bacteria 1995
11 Ga0466714_012599 3300042603 Bacteria 1570
12 Ga0466714_117220 3300042603 Bacteria 13666
13 Ga0466719_251327 3300042606 Bacteria 28934
14 Ga0562375_0755 3300056856 Bacteria 56835
15 Ga0466729_085138 3300042621 Bacteria 9837
16 Ga0068305_10001831 3300005083 Bacteria 35448
17 Ga0466702_314545 3300042635 Bacteria 6000
18 Ga0466702_424962 3300042635 Bacteria 1730
19 Ga0466708_062047 3300042652 Bacteria 3742
20 Ga0160460_100870 3300012845 Bacteria 13142
21 Ga0123353_10696316 3300010167 Bacteria 1427
22 Ga0123353_10727523 3300010167 Bacteria 1386
23 Ga0123354_10079535 3300010882 Unclassified 4650
24 Ga0466701_025087 3300042598 Unclassified 1735
25 Ga0466706_239472 3300042599 Bacteria 3366
26 Ga0466714_079803 3300042603 Bacteria 3638
27 Ga0466716_285740 3300042605 Bacteria 1667
28 Ga0466698_217941 3300042610 Bacteria 1256
29 Ga0466715_557156 3300042616 Bacteria 49402
30 2212578247 2209111004 Bacteria 5765
31 IMNBL1DRAFT_c0003349 3300000062 Bacteria 10393
32 IMNBL1DRAFT_c0009414 3300000062 Bacteria 4820
33 Ga0466705_030692 3300042612 Bacteria 4343
34 Ga0466702_264967 3300042635 Bacteria 2250
35 Ga0466703_142143 3300042636 Bacteria 9591
36 Ga0466709_053153 3300042648 Bacteria 6204
37 Ga0466708_407779 3300042652 Bacteria 1259
38 Ga0160445_100826 3300012847 Bacteria 11414
39 Ga0123356_10183957 3300010049 Bacteria 2114
40 Ga0123353_10548836 3300010167 Bacteria 1667
41 Ga0562379_0688 3300056790 Bacteria 57424
42 2227210248 2225789004 Bacteria 1415
43 Ga0466729_285048 3300042621 Unclassified 8901
44 Ga0415639_081964 3300038395 Bacteria 1222
45 Ga0466691_095675 3300042593 Bacteria 20573
46 Ga0123356_10017716 3300010049 Bacteria 6769
47 Ga0123353_10090015 3300010167 Bacteria 4942
48 Ga0123353_10113731 3300010167 Bacteria 4357
49 Ga0123353_10145246 3300010167 Bacteria 3794
50 Ga0466706_081404 3300042599 Bacteria 6550
51 Ga0466714_002497 3300042603 Bacteria 9597
52 Ga0466714_084501 3300042603 Bacteria 49226
53 Ga0466705_480106 3300042612 Bacteria 5184
54 Ga0466715_611280 3300042616 Bacteria 33924
55 Ga0466728_027377 3300042620 Bacteria 6682
56 Ga0466724_02890 3300042649 Bacteria 169295
57 Ga0466690_111460 3300042590 Unclassified 5461
58 Ga0123356_10725390 3300010049 Bacteria 1163
59 Ga0123353_10031856 3300010167 Bacteria 8177
60 Ga0123353_10285396 3300010167 Bacteria 2532
61 Ga0123353_10326678 3300010167 Bacteria 2325
62 Ga0123353_10362233 3300010167 Bacteria 2178
63 Ga0123353_10553448 3300010167 Bacteria 1658
64 Ga0123354_10298459 3300010882 Unclassified 1529
65 Ga0562375_0703 3300056856 Bacteria 59901
66 IMNBL1DRAFT_c0001917 3300000062 Unclassified 15062
67 Ga0466704_350863 3300042643 Bacteria 2137
68 Ga0466690_018132 3300042590 Bacteria 1404
69 Ga0123353_10029624 3300010167 Unclassified 8441
70 Ga0160464_100967 3300012805 Bacteria 13955
71 Ga0466716_408413 3300042605 Bacteria 4297
72 Ga0466711_030518 3300042615 Bacteria 21293
73 Ga0466723_004459 3300042618 Bacteria 4206
74 Ga0466726_103660 3300042619 Bacteria 15823
75 2227544088 2225789004 Bacteria 15330
76 Ga0466705_006239 3300042612 Bacteria 4932
77 Ga0466702_013585 3300042635 Unclassified 1556
78 Ga0466702_177604 3300042635 Bacteria 1094
79 Ga0160435_1009284 3300012857 Bacteria 2092
80 Ga0466693_207170 3300042592 Bacteria 2655
81 Ga0123356_10133485 3300010049 Bacteria 2436
82 Ga0123356_10139611 3300010049 Bacteria 2389
83 Ga0123353_10111999 3300010167 Bacteria 4395
84 Ga0123353_10161178 3300010167 Unclassified 3571
85 Ga0466714_071064 3300042603 Bacteria 5079
86 Ga0466714_142028 3300042603 Unclassified 3479
87 Ga0466711_030511 3300042615 Bacteria 2884
88 Ga0466715_171195 3300042616 Bacteria 14962
89 Ga0466729_317599 3300042621 Bacteria 13539
90 Ga0466731_417024 3300042622 Bacteria 6271
91 Ga0466708_073357 3300042652 Bacteria 7995
92 Ga0466727_288370 3300042655 Bacteria 1206
93 Ga0466656_266437 3300042550 Bacteria 2524
94 Ga0123353_10001974 3300010167 Bacteria 25318
95 Ga0123353_10529437 3300010167 Bacteria 1707
96 Ga0466701_100112 3300042598 Bacteria 4211
97 Ga0466713_086439 3300042602 Unclassified 51900
98 Ga0466722_188855 3300042609 Bacteria 43444

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300010049 Ga0123356_10139611 Ga0123356_101396112 279
2 3300009784 Ga0123357_10021611 Ga0123357_100216115 285
3 3300042603 Ga0466714_071064 Ga0466714_071064_2065_2991 285
4 3300042593 Ga0466691_095675 Ga0466691_095675_16724_17584 286
5 3300042596 Ga0466696_042464 Ga0466696_042464_3981_4841 286
6 3300042618 Ga0466723_017882 Ga0466723_017882_337_1197 286
7 3300042655 Ga0466727_288370 Ga0466727_288370_326_1186 286
8 3300042603 Ga0466714_002497 Ga0466714_002497_4908_5792 289
9 3300042621 Ga0466729_085138 Ga0466729_085138_8429_9343 290
10 3300042550 Ga0466656_266437 Ga0466656_266437_422_1297 291
11 3300056790 Ga0562379_0688 Ga0562379_0688_24682_25611 291
12 3300056856 Ga0562375_0755 Ga0562375_0755_29604_30524 293
13 3300000062 IMNBL1DRAFT_c0009414 IMNBL1DRAFT_00094144 294
14 3300010167 Ga0123353_10126415 Ga0123353_101264153 294
15 3300042635 Ga0466702_314545 Ga0466702_314545_5078_5962 294
16 3300042603 Ga0466714_079803 Ga0466714_079803_585_1541 295
17 3300042603 Ga0466714_142028 Ga0466714_142028_50_967 295
18 2225789004 2227210248 2227638913 296
19 iso_pr_bacteria 2820903739 2820905383 298
20 3300010167 Ga0123353_10029624 Ga0123353_100296244 299
21 3300042615 Ga0466711_030518 Ga0466711_030518_19882_20781 299
22 3300042620 Ga0466728_027377 Ga0466728_027377_4522_5424 300
23 2225789004 2227544088 2228068344 302
24 3300000062 IMNBL1DRAFT_c0001917 IMNBL1DRAFT_00019176 303
25 3300042592 Ga0466693_207170 Ga0466693_207170_219_1130 303
26 3300042635 Ga0466702_013585 Ga0466702_013585_469_1380 303
27 3300042635 Ga0466702_177604 Ga0466702_177604_62_973 303
28 3300042635 Ga0466702_424962 Ga0466702_424962_168_1079 303
29 iso_pr_bacteria 2820282995 2820285260 303
30 2209111004 2212578247 2212422765 304
31 3300010049 Ga0123356_10133485 Ga0123356_101334853 304
32 3300010167 Ga0123353_10727523 Ga0123353_107275231 304
33 3300042598 Ga0466701_100112 Ga0466701_100112_2814_3728 304
34 3300042610 Ga0466698_217941 Ga0466698_217941_311_1225 304
35 3300042622 Ga0466731_417024 Ga0466731_417024_3667_4581 304
36 iso_pr_bacteria 2820312173 2820312514 304
37 iso_pr_bacteria 2820362221 2820363907 304
38 iso_pr_bacteria 2820438595 2820439758 304
39 3300010049 Ga0123356_10017716 Ga0123356_100177164 305
40 3300010049 Ga0123356_10183957 Ga0123356_101839572 305
41 3300010049 Ga0123356_10289396 Ga0123356_102893961 305
42 3300010167 Ga0123353_10001974 Ga0123353_100019743 305
43 3300010167 Ga0123353_10090015 Ga0123353_100900154 305
44 3300010167 Ga0123353_10111999 Ga0123353_101119995 305
45 3300010167 Ga0123353_10113731 Ga0123353_101137311 305
46 3300010167 Ga0123353_10144158 Ga0123353_101441582 305
47 3300010167 Ga0123353_10161178 Ga0123353_101611782 305
48 3300010167 Ga0123353_10285396 Ga0123353_102853962 305
49 3300010167 Ga0123353_10326678 Ga0123353_103266783 305
50 3300010167 Ga0123353_10362233 Ga0123353_103622332 305
51 3300010167 Ga0123353_10548836 Ga0123353_105488361 305
52 3300010167 Ga0123353_10553448 Ga0123353_105534482 305
53 3300010167 Ga0123353_10696316 Ga0123353_106963162 305
54 3300042602 Ga0466713_086439 Ga0466713_086439_44467_45384 305
55 3300042603 Ga0466714_084501 Ga0466714_084501_32285_33202 305
56 3300042616 Ga0466715_611280 Ga0466715_611280_30703_31620 305
57 3300000062 IMNBL1DRAFT_c0003349 IMNBL1DRAFT_00033493 306
58 3300005083 Ga0068305_10001831 Ga0068305_100018316 306
59 3300010167 Ga0123353_10529437 Ga0123353_105294372 307
60 3300042598 Ga0466701_025087 Ga0466701_025087_752_1675 307
61 3300042599 Ga0466706_239472 Ga0466706_239472_1922_2848 308
62 iso_pr_bacteria 2574180310 2576355917 308
63 iso_pr_bacteria 2791355481 2794423547 308
64 iso_pr_bacteria 2820332331 2820333194 308
65 iso_pr_bacteria 2820389254 2820389706 308
66 iso_pr_bacteria 2864909992 2864910459 308
67 3300010167 Ga0123353_10031856 Ga0123353_100318564 309
68 iso_pr_bacteria 2820857933 2820861031 309
69 iso_pr_bacteria 2820882373 2820884769 309
70 iso_pr_bacteria 2864816158 2864819047 309
71 3300012857 Ga0160435_1009284 Ga0160435_10092842 310
72 3300042599 Ga0466706_081404 Ga0466706_081404_3068_4000 310
73 iso_pr_bacteria 2767802234 2769328603 310
74 iso_pr_bacteria 2820405014 2820406383 310
75 3300010049 Ga0123356_10725390 Ga0123356_107253901 311
76 3300010882 Ga0123354_10079535 Ga0123354_100795353 311
77 3300012847 Ga0160445_100826 Ga0160445_1008267 311
78 3300042635 Ga0466702_264967 Ga0466702_264967_153_1088 311
79 iso_pr_bacteria 2864801025 2864802450 311
80 iso_pr_bacteria 2864895409 2864897060 311
81 iso_pr_bacteria 2864981449 2864983338 311
82 iso_pr_bacteria 8043041867 8043043443 311
83 3300038395 Ga0415639_081964 Ga0415639_081964_16_954 312
84 3300042590 Ga0466690_018132 Ga0466690_018132_223_1161 312
85 3300042590 Ga0466690_111460 Ga0466690_111460_791_1729 312
86 3300042601 Ga0466707_011223 Ga0466707_011223_149_1087 312
87 3300042605 Ga0466716_285740 Ga0466716_285740_517_1455 312
88 3300042605 Ga0466716_408413 Ga0466716_408413_1529_2467 312
89 3300042612 Ga0466705_030692 Ga0466705_030692_454_1392 312
90 3300042612 Ga0466705_480106 Ga0466705_480106_3644_4582 312
91 3300042616 Ga0466715_171195 Ga0466715_171195_8625_9563 312
92 3300042618 Ga0466723_212999 Ga0466723_212999_165_1103 312
93 3300042619 Ga0466726_103660 Ga0466726_103660_1146_2084 312
94 3300042619 Ga0466726_427681 Ga0466726_427681_173_1111 312
95 3300042636 Ga0466703_142143 Ga0466703_142143_5220_6158 312
96 3300042648 Ga0466709_053153 Ga0466709_053153_1551_2489 312
97 3300042652 Ga0466708_062047 Ga0466708_062047_34_972 312
98 3300042652 Ga0466708_073357 Ga0466708_073357_1289_2227 312
99 3300042652 Ga0466708_407779 Ga0466708_407779_105_1061 312
100 3300042615 Ga0466711_030511 Ga0466711_030511_122_1063 313
101 3300042643 Ga0466704_350863 Ga0466704_350863_671_1612 313
102 iso_pr_bacteria 2990166910 2990172719 313
103 iso_pr_bacteria 650716102 650881196 313
104 iso_pr_bacteria 2820501819 2820502591 314
105 3300010882 Ga0123354_10298459 Ga0123354_102984592 317
106 3300042606 Ga0466719_251327 Ga0466719_251327_6698_7651 317
107 3300042609 Ga0466722_188855 Ga0466722_188855_20726_21679 317
108 3300042621 Ga0466729_285048 Ga0466729_285048_3791_4744 317
109 iso_pr_bacteria 2873603790 2873607555 317
110 3300042603 Ga0466714_117220 Ga0466714_117220_1495_2451 318
111 3300042616 Ga0466715_557156 Ga0466715_557156_37543_38499 318
112 3300042603 Ga0466714_012599 Ga0466714_012599_557_1516 319
113 3300042621 Ga0466729_317599 Ga0466729_317599_8883_9869 321
114 3300042612 Ga0466705_006239 Ga0466705_006239_3291_4259 322
115 3300056856 Ga0562375_0703 Ga0562375_0703_31312_32316 324
116 3300042596 Ga0466696_007242 Ga0466696_007242_999_1976 325
117 3300012845 Ga0160460_100870 Ga0160460_1008707 330
118 3300042649 Ga0466724_02890 Ga0466724_02890_76571_77575 334
119 3300010167 Ga0123353_10145246 Ga0123353_101452463 336
120 3300042618 Ga0466723_004459 Ga0466723_004459_334_1353 339
121 iso_pr_bacteria 3002678670 3002680877 353
122 3300012805 Ga0160464_100967 Ga0160464_10096711 354
123 iso_pr_bacteria 2820367663 2820369096 361

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00528 BPD_transp_1 Binding-protein-dependent transport system inner membrane component 168 359 0.99
PF19300 BPD_transp_1_N Binding-prot-dependent transport system membrane comp, N-term 59 127 0.85

🏗️ Structural Annotation – Top 5 Hits

IDDescriptionScoreStartEnd
3tui-assembly2.cif.gz_E Inward facing conformations of the MetNI methionine ABC transporter: CY5 native crystal form 0.817 145 355
3tuz-assembly2.cif.gz_F Inward facing conformations of the MetNI methionine ABC transporter: CY5 SeMet soak crystal form 0.801 145 355
3dhw-assembly1.cif.gz_A Crystal structure of methionine importer MetNI 0.798 145 343
8ja7-assembly1.cif.gz_A Cryo-EM structure of Mycobacterium tuberculosis LpqY-SugABC in complex with trehalose 0.776 149 356
8hpr-assembly1.cif.gz_B LpqY-SugABC in state 4 0.752 145 346
IDDescriptionScoreStartEndSuperfamily
af_Q2FZR7_83_297_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9782 142 354 1.10.3720.10
af_Q2FVE8_90_302_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9644 142 354 1.10.3720.10
af_P75798_87_300_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9571 145 355 1.10.3720.10
af_P0AFH2_84_300_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9559 140 354 1.10.3720.10
af_P33591_90_303_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9519 145 355 1.10.3720.10
IDDescriptionScoreStartEndGO Terms
AF-A0A0K8JD53-F1-model_v4 Uncharacterized/unreviewed 0.9811 56 358
AF-A0A4R6BC54-F1-model_v4 Uncharacterized/unreviewed 0.9778 59 358 GO:0005886
GO:0015675
GO:0055085
AF-A0A3G9KB04-F1-model_v4 Uncharacterized/unreviewed 0.9724 59 361 GO:0005886
GO:0055085

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.74 0.82 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.