Protein Family IF12052

Metagenome Isolate
114 Members
47 Samples
103 Scaffolds
203.1 Avg Length

🧬 Representative Sequence

ID
iso_pr_bacteria|2820357977|2820360151|
Length
240 aa
Sequence
VPKGDLPGEALRLALLYEKEIALRARGYQAIAGLDEAGRGPLAGPVCAAAVVLPVGFPFDILADSKKLKRQQRDAARRVITEKAVAWGVGWATHVEIDRINILQASLLAMRRAFSCLLDTTTDGWPERLETETPFGRPFTPATSIPACLTAVADGTHTPELPVPCTAVVKADDTIPEVMAASILAKTARDMLMEHYAKLHPQYSYERHKGYPTKEHRKLVLQFGPSPIQRLSFKVRGNSL

📊 Sample Types

Isolate 9.7%
Metagenome 90.3%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 34.8%
Unclassified 28.3%
Kalotermitidae 23.9%
Termopsidae 6.5%
Rhinotermitidae 4.3%
Hodotermitidae 2.2%

🌳 Taxonomy

Archaea 1
Bacteria 107
Eukaryota 0
Viruses 0
Unclassified 6

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125637 Treponema sp. Co191P1bin9 Isolate Unclassified
2 2781125642 Treponema sp. Co191P1bin35 Isolate Unclassified
3 2820357977 Unclassified Firmicutes Nt197P3bin136 Isolate Unclassified
4 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
5 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
6 3300002508 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 Metagenome Termitidae
7 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
8 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
9 2819994798 Unclassified Spirochaetes Th196P1bin3 Isolate Unclassified
10 2820020240 Unclassified Spirochaetes Nc150P3bin10 Isolate Unclassified
11 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
12 2781125690 Treponema sp. Th196P3bin63 Isolate Unclassified
13 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
14 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
15 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
16 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
17 2781125631 Treponema sp. Nt197P3bin89 Isolate Unclassified
18 2781125665 Treponema sp. Emb289P3bin117 Isolate Unclassified
19 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
20 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
21 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
22 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
23 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
24 2781125650 Treponema sp. Co191P3bin64 Isolate Unclassified
25 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
26 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
27 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
28 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
29 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
30 2781125649 Treponema sp. Co191P3bin15 Isolate Unclassified
31 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
32 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
33 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
34 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
35 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
36 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
37 2819992462 Unclassified Spirochaetes Nc150P4bin14 Isolate Unclassified
38 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
39 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
40 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
41 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
42 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
43 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
44 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
45 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
46 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
47 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466732_271304 3300042656 Bacteria 13044
2 Ga0415639_114071 3300038395 Bacteria 2067
3 Ga0466693_107864 3300042592 Bacteria 1116
4 Ga0466694_007346 3300042594 Bacteria 1434
5 Ga0466715_476820 3300042616 Bacteria 24646
6 Ga0466735_031016 3300042624 Bacteria 1340
7 Ga0466735_037564 3300042624 Bacteria 1358
8 Ga0466704_186581 3300042643 Bacteria 13691
9 Ga0466720_035609 3300042607 Bacteria 50299
10 JGI24698J34947_10060269 3300002449 Bacteria 1872
11 Ga0068305_10110853 3300005083 Bacteria 4116
12 Ga0072941_1022266 3300005201 Bacteria 10324
13 Ga0072941_1036156 3300005201 Archaea 5975
14 Ga0466699_037483 3300042597 Bacteria 31779
15 Ga0466699_153302 3300042597 Bacteria 9520
16 Ga0466704_402729 3300042643 Bacteria 6371
17 Ga0466727_047143 3300042655 Unclassified 1048
18 Ga0466722_078745 3300042609 Bacteria 4641
19 JGI24698J34947_10002770 3300002449 Bacteria 9487
20 JGI24695J34938_10004226 3300002450 Bacteria 9541
21 JGI24695J34938_10013688 3300002450 Unclassified 4248
22 Ga0123356_10001769 3300010049 Bacteria 23565
23 Ga0466711_274802 3300042615 Bacteria 10369
24 Ga0466715_358248 3300042616 Bacteria 2102
25 Ga0466706_033745 3300042599 Bacteria 12681
26 AustNasuHG_c1002575 3300000089 Bacteria 6547
27 JGI24698J34947_10125727 3300002449 Bacteria 1105
28 Ga0072940_1022681 3300005200 Bacteria 1312
29 Ga0466705_384898 3300042612 Bacteria 15925
30 Ga0466699_290256 3300042597 Bacteria 2571
31 Ga0123356_10032686 3300010049 Bacteria 4866
32 Ga0123356_11122247 3300010049 Bacteria 954
33 Ga0466712_179832 3300042614 Bacteria 1617
34 Ga0466718_103759 3300042617 Bacteria 4052
35 Ga0466726_219760 3300042619 Bacteria 1751
36 Ga0466720_002785 3300042607 Bacteria 44479
37 Ga0466720_025415 3300042607 Bacteria 22188
38 Ga0466720_197397 3300042607 Bacteria 1495
39 JGI24695J34938_10000071 3300002450 Bacteria 85834
40 JGI24695J34938_10004199 3300002450 Bacteria 9579
41 Ga0072940_1049891 3300005200 Bacteria 4322
42 Ga0466696_284810 3300042596 Bacteria 5754
43 Ga0466699_252573 3300042597 Bacteria 2597
44 Ga0466699_263059 3300042597 Bacteria 1201
45 Ga0123356_10000396 3300010049 Bacteria 49792
46 Ga0466718_023909 3300042617 Bacteria 4788
47 Ga0466718_083400 3300042617 Bacteria 10236
48 Ga0466723_215259 3300042618 Bacteria 3476
49 Ga0466726_414524 3300042619 Bacteria 3235
50 Ga0466703_008322 3300042636 Bacteria 7120
51 Ga0466727_174292 3300042655 Bacteria 1043
52 Ga0466713_049108 3300042602 Bacteria 2090
53 Ga0466713_102863 3300042602 Bacteria 15874
54 Ga0466720_030654 3300042607 Bacteria 1209
55 Ga0466720_195450 3300042607 Bacteria 5334
56 AustNasuHG_c1022355 3300000089 Bacteria 2032
57 JGI24698J34947_10007676 3300002449 Bacteria 5926
58 JGI24695J34938_10000391 3300002450 Bacteria 43169
59 JGI24695J34938_10000507 3300002450 Bacteria 37871
60 JGI24695J34938_10000768 3300002450 Bacteria 30031
61 Ga0466692_097164 3300042591 Bacteria 2091
62 Ga0466691_076000 3300042593 Bacteria 15299
63 Ga0466694_150577 3300042594 Bacteria 1210
64 Ga0123356_10009786 3300010049 Bacteria 9449
65 Ga0123356_10080624 3300010049 Bacteria 3077
66 Ga0466718_012398 3300042617 Bacteria 1515
67 Ga0466718_122719 3300042617 Bacteria 7672
68 Ga0466718_129583 3300042617 Bacteria 1010
69 Ga0466727_321068 3300042655 Bacteria 1337
70 Ga0466719_346980 3300042606 Bacteria 3903
71 Ga0466720_102704 3300042607 Bacteria 2811
72 AustNasuHG_c1029324 3300000089 Bacteria 1616
73 JGI24698J34947_10023759 3300002449 Bacteria 3278
74 JGI24695J34938_10066349 3300002450 Bacteria 1521
75 Ga0072940_1011733 3300005200 Bacteria 22116
76 Ga0123353_10221742 3300010167 Bacteria 2956
77 Ga0466712_052993 3300042614 Unclassified 2845
78 Ga0466712_068910 3300042614 Bacteria 5258
79 Ga0466712_078802 3300042614 Bacteria 3939
80 Ga0466712_082766 3300042614 Bacteria 2759
81 Ga0466712_112822 3300042614 Bacteria 4200
82 Ga0466718_081561 3300042617 Unclassified 1538
83 Ga0466704_041931 3300042643 Bacteria 12633
84 Ga0466716_164248 3300042605 Bacteria 2829
85 Ga0466720_040642 3300042607 Bacteria 7524
86 JGI24700J35501_10930678 3300002508 Bacteria 18442
87 Ga0466705_218824 3300042612 Bacteria 9641
88 Ga0466690_039657 3300042590 Bacteria 15869
89 Ga0466692_059346 3300042591 Bacteria 1261
90 Ga0466694_028192 3300042594 Bacteria 14782
91 Ga0123356_10511947 3300010049 Bacteria 1358
92 Ga0123356_10794513 3300010049 Bacteria 1117
93 Ga0466726_115221 3300042619 Unclassified 1061
94 Ga0466726_406184 3300042619 Bacteria 1795
95 Ga0466731_032621 3300042622 Bacteria 1794
96 Ga0466704_284726 3300042643 Unclassified 9831
97 Ga0466720_118879 3300042607 Bacteria 1288
98 Ga0466720_165736 3300042607 Bacteria 6870
99 Ga0466720_181002 3300042607 Bacteria 45355
100 Ga0466722_179484 3300042609 Bacteria 25896
101 AustNasuHG_c1007053 3300000089 Bacteria 4004
102 JGI24698J34947_10011314 3300002449 Bacteria 4897
103 JGI24695J34938_10001566 3300002450 Bacteria 19253

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042590 Ga0466690_039657 Ga0466690_039657_2047_2562 171
2 3300042643 Ga0466704_402729 Ga0466704_402729_5276_5797 173
3 3300042636 Ga0466703_008322 Ga0466703_008322_2643_3203 186
4 3300042643 Ga0466704_041931 Ga0466704_041931_9377_9937 186
5 iso_pr_bacteria 2781125642 2781291892 191
6 3300002450 JGI24695J34938_10000507 JGI24695J34938_1000050716 192
7 3300005083 Ga0068305_10110853 Ga0068305_101108533 192
8 3300042617 Ga0466718_083400 Ga0466718_083400_3235_3813 192
9 3300042618 Ga0466723_215259 Ga0466723_215259_1743_2321 192
10 3300010049 Ga0123356_10032686 Ga0123356_100326862 193
11 3300010049 Ga0123356_10080624 Ga0123356_100806244 193
12 3300042591 Ga0466692_097164 Ga0466692_097164_308_889 193
13 3300042615 Ga0466711_274802 Ga0466711_274802_8878_9459 193
14 3300010049 Ga0123356_10001769 Ga0123356_100017693 194
15 3300042594 Ga0466694_028192 Ga0466694_028192_9085_9669 194
16 3300042602 Ga0466713_049108 Ga0466713_049108_1334_1918 194
17 3300042602 Ga0466713_102863 Ga0466713_102863_13635_14219 194
18 3300042606 Ga0466719_346980 Ga0466719_346980_2930_3514 194
19 3300042609 Ga0466722_179484 Ga0466722_179484_18231_18815 194
20 3300042655 Ga0466727_321068 Ga0466727_321068_15_599 194
21 iso_pr_bacteria 2819994798 2819997087 194
22 3300002450 JGI24695J34938_10000768 JGI24695J34938_1000076816 195
23 3300002508 JGI24700J35501_10930678 JGI24700J35501_1093067816 195
24 3300042619 Ga0466726_414524 Ga0466726_414524_1522_2109 195
25 3300042655 Ga0466727_047143 Ga0466727_047143_265_852 195
26 3300042655 Ga0466727_174292 Ga0466727_174292_126_713 195
27 3300005200 Ga0072940_1011733 Ga0072940_10117338 196
28 3300038395 Ga0415639_114071 Ga0415639_114071_904_1497 197
29 3300042593 Ga0466691_076000 Ga0466691_076000_12613_13206 197
30 3300042607 Ga0466720_030654 Ga0466720_030654_497_1090 197
31 3300042607 Ga0466720_035609 Ga0466720_035609_36598_37191 197
32 3300042607 Ga0466720_181002 Ga0466720_181002_6724_7317 197
33 3300042607 Ga0466720_197397 Ga0466720_197397_316_942 197
34 3300042616 Ga0466715_476820 Ga0466715_476820_1970_2563 197
35 3300042617 Ga0466718_012398 Ga0466718_012398_445_1038 197
36 3300042617 Ga0466718_023909 Ga0466718_023909_2226_2819 197
37 3300042617 Ga0466718_081561 Ga0466718_081561_360_953 197
38 3300042617 Ga0466718_103759 Ga0466718_103759_1712_2305 197
39 3300042617 Ga0466718_122719 Ga0466718_122719_3558_4151 197
40 3300042619 Ga0466726_219760 Ga0466726_219760_616_1209 197
41 iso_pr_bacteria 2819992462 2819994694 197
42 iso_pr_bacteria 2820020240 2820020982 197
43 3300000089 AustNasuHG_c1002575 AustNasuHG_10025758 198
44 3300000089 AustNasuHG_c1022355 AustNasuHG_10223554 198
45 3300042619 Ga0466726_115221 Ga0466726_115221_253_849 198
46 3300000089 AustNasuHG_c1029324 AustNasuHG_10293243 199
47 3300002450 JGI24695J34938_10001566 JGI24695J34938_1000156612 199
48 3300005201 Ga0072941_1022266 Ga0072941_10222666 199
49 3300042607 Ga0466720_195450 Ga0466720_195450_4386_5018 199
50 3300042612 Ga0466705_384898 Ga0466705_384898_7949_8548 199
51 3300042624 Ga0466735_037564 Ga0466735_037564_699_1322 199
52 3300042643 Ga0466704_186581 Ga0466704_186581_8473_9072 199
53 3300042643 Ga0466704_284726 Ga0466704_284726_7851_8450 199
54 3300002450 JGI24695J34938_10066349 JGI24695J34938_100663492 200
55 3300042612 Ga0466705_218824 Ga0466705_218824_8301_8903 200
56 3300042599 Ga0466706_033745 Ga0466706_033745_8659_9264 201
57 3300042605 Ga0466716_164248 Ga0466716_164248_686_1336 201
58 3300042609 Ga0466722_078745 Ga0466722_078745_1176_1781 201
59 3300042619 Ga0466726_406184 Ga0466726_406184_184_789 201
60 3300042597 Ga0466699_037483 Ga0466699_037483_23128_23739 203
61 3300042622 Ga0466731_032621 Ga0466731_032621_465_1076 203
62 3300010049 Ga0123356_10794513 Ga0123356_107945132 204
63 3300042616 Ga0466715_358248 Ga0466715_358248_756_1370 204
64 3300002450 JGI24695J34938_10000391 JGI24695J34938_1000039111 205
65 iso_pr_bacteria 2781125637 2781281826 205
66 iso_pr_bacteria 2781125649 2781307028 205
67 3300002450 JGI24695J34938_10000071 JGI24695J34938_1000007165 206
68 3300002450 JGI24695J34938_10004226 JGI24695J34938_100042268 206
69 3300002450 JGI24695J34938_10013688 JGI24695J34938_100136882 206
70 3300042624 Ga0466735_031016 Ga0466735_031016_104_727 207
71 3300042594 Ga0466694_007346 Ga0466694_007346_364_990 208
72 iso_pr_bacteria 2781125665 2781341641 208
73 3300005201 Ga0072941_1036156 Ga0072941_10361566 209
74 3300010049 Ga0123356_10000396 Ga0123356_100003961 209
75 3300042591 Ga0466692_059346 Ga0466692_059346_587_1216 209
76 3300042607 Ga0466720_102704 Ga0466720_102704_1018_1647 209
77 3300042607 Ga0466720_165736 Ga0466720_165736_5294_5923 209
78 3300042614 Ga0466712_068910 Ga0466712_068910_3656_4285 209
79 3300042617 Ga0466718_129583 Ga0466718_129583_11_640 209
80 iso_pr_bacteria 2781125690 2781427734 209
81 3300010167 Ga0123353_10221742 Ga0123353_102217424 210
82 3300042592 Ga0466693_107864 Ga0466693_107864_175_807 210
83 3300042594 Ga0466694_150577 Ga0466694_150577_70_702 210
84 3300042597 Ga0466699_290256 Ga0466699_290256_330_962 210
85 3300042607 Ga0466720_002785 Ga0466720_002785_37817_38449 210
86 3300042607 Ga0466720_025415 Ga0466720_025415_14065_14697 210
87 3300042614 Ga0466712_052993 Ga0466712_052993_861_1493 210
88 3300042614 Ga0466712_078802 Ga0466712_078802_897_1529 210
89 3300042614 Ga0466712_082766 Ga0466712_082766_1420_2052 210
90 3300042614 Ga0466712_179832 Ga0466712_179832_934_1566 210
91 iso_pr_bacteria 2781125650 2781309252 210
92 3300002449 JGI24698J34947_10002770 JGI24698J34947_100027703 211
93 3300002449 JGI24698J34947_10007676 JGI24698J34947_100076765 211
94 3300002449 JGI24698J34947_10060269 JGI24698J34947_100602692 211
95 3300002450 JGI24695J34938_10004199 JGI24695J34938_100041994 211
96 3300005200 Ga0072940_1049891 Ga0072940_10498912 211
97 3300010049 Ga0123356_10009786 Ga0123356_100097868 211
98 3300042607 Ga0466720_118879 Ga0466720_118879_225_860 211
99 3300042614 Ga0466712_112822 Ga0466712_112822_992_1627 211
100 3300002449 JGI24698J34947_10023759 JGI24698J34947_100237592 212
101 3300002449 JGI24698J34947_10125727 JGI24698J34947_101257271 212
102 3300010049 Ga0123356_10511947 Ga0123356_105119471 212
103 3300042596 Ga0466696_284810 Ga0466696_284810_1810_2466 212
104 iso_pr_bacteria 2781125631 2781268431 213
105 3300042607 Ga0466720_040642 Ga0466720_040642_5321_5965 214
106 3300002449 JGI24698J34947_10011314 JGI24698J34947_100113144 215
107 3300042656 Ga0466732_271304 Ga0466732_271304_11015_11668 217
108 3300005200 Ga0072940_1022681 Ga0072940_10226811 219
109 3300000089 AustNasuHG_c1007053 AustNasuHG_10070533 222
110 3300010049 Ga0123356_11122247 Ga0123356_111222471 222
111 3300042597 Ga0466699_153302 Ga0466699_153302_1583_2251 222
112 3300042597 Ga0466699_263059 Ga0466699_263059_422_1105 227
113 3300042597 Ga0466699_252573 Ga0466699_252573_1224_1943 239
114 iso_pr_bacteria 2820357977 2820360151 240

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01351 RNase_HII Ribonuclease HII 32 114 0.92

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF01351 GO:0004523 RNA-DNA hybrid ribonuclease activity MF

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.86 0.89 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.