Protein Family IF12047

Metagenome Isolate
146 Members
59 Samples
130 Scaffolds
358.23 Avg Length

🧬 Representative Sequence

ID
iso_pr_bacteria|2820333861|2820334115|
Length
357 aa
Sequence
MLSLRQDAKYALIIPTSIGVRIQPLNGVPVHTSDTFSMHVTSAESNVASVASYLGLPVKILTAFVKDSPISALIKSNLRSRGMDYEGRDVEQGGPWGYRHQFNIADSGFGVRGPRVHNDRAGEVGRTLNVRDFDLERIFGSEGAQILHLSGLIAALSPETGEFCIELAKAAKKHGTLISFDLNHRASFWKNREGELGELFGRIASLTDILIGNEEDFQLALGISGPETGAGIAGKTDSFKAMIGEVKKAYPDTSVFANTLRQVISANRHLWGALMLEGDNWHTARAREIDVLDRIGGGDGFVGGMLYGILKGWAPEKWIQFGWASGALATTYSTDYNQPADEEQIWSIWHGNARVRR

📊 Sample Types

Isolate 11.0%
Metagenome 89.0%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 35.6%
Unclassified 28.8%
Kalotermitidae 22.0%
Rhinotermitidae 5.1%
Termopsidae 5.1%
Passalidae 3.4%

🌳 Taxonomy

Archaea 0
Bacteria 144
Eukaryota 0
Viruses 0
Unclassified 2

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820333861 Unclassified Firmicutes Nt197P3bin72 Isolate Unclassified
2 2820447167 Unclassified Firmicutes Lab288P3bin192 Isolate Unclassified
3 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
4 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
5 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
6 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
7 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
8 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
9 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
10 2820336130 Unclassified Firmicutes Nt197P3bin70 Isolate Unclassified
11 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
12 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
13 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
14 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
15 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
16 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
17 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
18 2820582954 Unclassified Firmicutes Emb289P3bin119 Isolate Unclassified
19 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
20 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
21 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
22 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
23 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
24 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
25 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
26 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
27 2820414148 Unclassified Firmicutes Lab288P3bin93 Isolate Unclassified
28 2820501819 Unclassified Firmicutes Lab288P1bin51 Isolate Unclassified
29 2820657860 Unclassified Firmicutes Co191P4bin15 Isolate Unclassified
30 2820666966 Unclassified Firmicutes Co191P3bin39 Isolate Unclassified
31 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
32 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
33 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
34 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
35 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
36 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
37 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
38 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
39 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
40 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
41 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
42 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
43 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
44 2820357977 Unclassified Firmicutes Nt197P3bin136 Isolate Unclassified
45 2820483401 Unclassified Firmicutes Lab288P1bin74 Isolate Unclassified
46 2820576413 Unclassified Firmicutes Emb289P3bin136 Isolate Unclassified
47 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
48 2820250282 Unclassified Firmicutes Th196P3bin66 Isolate Unclassified
49 2820408893 Unclassified Firmicutes Lab288P4bin80 Isolate Unclassified
50 2820563109 Unclassified Firmicutes Emb289P3bin58 Isolate Unclassified
51 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
52 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
53 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
54 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
55 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
56 2820429680 Unclassified Firmicutes Lab288P3bin30 Isolate Unclassified
57 2820644600 Unclassified Firmicutes Cu122P5bin39 Isolate Unclassified
58 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
59 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466697_121711 3300042611 Bacteria 1890
2 JGI24702J35022_10005855 3300002462 Bacteria 7151
3 Ga0466715_032624 3300042616 Bacteria 23067
4 Ga0466715_191352 3300042616 Bacteria 43892
5 Ga0466715_611496 3300042616 Bacteria 3498
6 Ga0123357_10026794 3300009784 Bacteria 7785
7 Ga0123355_10011516 3300009826 Bacteria 13639
8 Ga0123356_10001554 3300010049 Bacteria 25281
9 Ga0123356_10202207 3300010049 Bacteria 2027
10 Ga0123353_10001305 3300010167 Bacteria 30531
11 Ga0123353_10010054 3300010167 Bacteria 13146
12 Ga0123353_10046691 3300010167 Bacteria 6886
13 Ga0123353_10060137 3300010167 Bacteria 6093
14 Ga0123353_10263613 3300010167 Bacteria 2659
15 Ga0123353_10357269 3300010167 Bacteria 2197
16 Ga0123354_10000120 3300010882 Bacteria 58957
17 Ga0466704_191284 3300042643 Bacteria 31923
18 Ga0466725_112620 3300042654 Bacteria 6736
19 Ga0466727_060271 3300042655 Bacteria 5808
20 Ga0466733_084631 3300042659 Bacteria 5378
21 Ga0466692_187408 3300042591 Bacteria 16849
22 Ga0466691_010059 3300042593 Bacteria 17904
23 Ga0466696_360008 3300042596 Bacteria 1509
24 JGI24702J35022_10005422 3300002462 Bacteria 7465
25 JGI24696J40584_12961544 3300002834 Bacteria 20334
26 Ga0466711_139870 3300042615 Bacteria 3741
27 Ga0466713_085560 3300042602 Bacteria 38968
28 Ga0123355_10084155 3300009826 Bacteria 5067
29 Ga0123355_10133422 3300009826 Bacteria 3820
30 Ga0123356_10000703 3300010049 Bacteria 36998
31 Ga0123356_10001287 3300010049 Bacteria 27785
32 Ga0123356_10021446 3300010049 Bacteria 6096
33 Ga0123356_10034739 3300010049 Bacteria 4712
34 Ga0123356_10337415 3300010049 Bacteria 1626
35 Ga0123353_10108699 3300010167 Bacteria 4469
36 Ga0123353_10144912 3300010167 Bacteria 3799
37 Ga0123353_10268337 3300010167 Bacteria 2631
38 Ga0123353_10431602 3300010167 Bacteria 1948
39 Ga0123353_10467175 3300010167 Bacteria 1851
40 Ga0466731_178797 3300042622 Bacteria 9919
41 Ga0466694_367638 3300042594 Bacteria 1862
42 JGI24699J35502_11134135 3300002509 Bacteria 35221
43 Ga0466716_473788 3300042605 Bacteria 5668
44 Ga0123355_10132110 3300009826 Bacteria 3844
45 Ga0123356_10000536 3300010049 Bacteria 42210
46 Ga0123356_10129255 3300010049 Bacteria 2472
47 Ga0123353_10186388 3300010167 Bacteria 3281
48 Ga0123354_10125147 3300010882 Bacteria 3289
49 Ga0466703_286329 3300042636 Bacteria 8770
50 Ga0466709_031405 3300042648 Bacteria 14176
51 Ga0415639_025769 3300038395 Bacteria 14937
52 Ga0466695_179253 3300042595 Unclassified 2211
53 JGI24695J34938_10027912 3300002450 Bacteria 2660
54 Ga0466711_072383 3300042615 Bacteria 25653
55 Ga0466711_234814 3300042615 Bacteria 5367
56 Ga0123357_10073383 3300009784 Bacteria 4531
57 Ga0123353_10007640 3300010167 Bacteria 14651
58 Ga0123353_10064381 3300010167 Bacteria 5884
59 Ga0466729_216750 3300042621 Bacteria 11724
60 Ga0466704_333919 3300042643 Bacteria 2806
61 Ga0466704_504696 3300042643 Bacteria 11216
62 Ga0466690_043583 3300042590 Bacteria 17399
63 Ga0466693_221650 3300042592 Bacteria 1491
64 Ga0466696_322001 3300042596 Bacteria 2505
65 2227496034 2225789004 Bacteria 3928
66 JGI24702J35022_10002927 3300002462 Bacteria 10332
67 Ga0123356_10002159 3300010049 Bacteria 21226
68 Ga0123356_10215811 3300010049 Bacteria 1971
69 Ga0123353_10053445 3300010167 Bacteria 6455
70 Ga0123353_10202580 3300010167 Bacteria 3121
71 Ga0123353_10221369 3300010167 Bacteria 2959
72 Ga0123353_10249285 3300010167 Bacteria 2752
73 Ga0123353_10577921 3300010167 Bacteria 1613
74 Ga0123354_10122034 3300010882 Bacteria 3358
75 Ga0466735_122168 3300042624 Bacteria 9189
76 Ga0466703_246268 3300042636 Bacteria 9501
77 Ga0466708_255390 3300042652 Bacteria 15700
78 Ga0466705_090294 3300042612 Bacteria 10432
79 JGI24695J34938_10002758 3300002450 Bacteria 12909
80 JGI24702J35022_10007763 3300002462 Bacteria 6122
81 Ga0123357_10002245 3300009784 Bacteria 21372
82 Ga0466715_010386 3300042616 Bacteria 48029
83 Ga0466715_261660 3300042616 Bacteria 43972
84 Ga0466715_363895 3300042616 Bacteria 5395
85 Ga0466728_205222 3300042620 Bacteria 2409
86 Ga0466716_361898 3300042605 Bacteria 17846
87 Ga0466721_217737 3300042608 Bacteria 30181
88 Ga0123356_10009950 3300010049 Unclassified 9361
89 Ga0123356_10190534 3300010049 Bacteria 2081
90 Ga0123356_10368345 3300010049 Bacteria 1566
91 Ga0123353_10013597 3300010167 Bacteria 11670
92 Ga0123353_10029598 3300010167 Bacteria 8445
93 Ga0123353_10076225 3300010167 Bacteria 5389
94 Ga0123353_10451095 3300010167 Bacteria 1893
95 JGI24702J35022_10010678 3300002462 Bacteria 5130
96 Ga0466715_537488 3300042616 Bacteria 5747
97 Ga0466728_079003 3300042620 Bacteria 3438
98 Ga0466728_372276 3300042620 Bacteria 1368
99 Ga0466700_011778 3300042600 Bacteria 2381
100 Ga0466721_323597 3300042608 Bacteria 11691
101 Ga0466722_193990 3300042609 Bacteria 3888
102 Ga0123357_10074708 3300009784 Bacteria 4482
103 Ga0123356_10009007 3300010049 Bacteria 9877
104 Ga0123356_10022111 3300010049 Bacteria 6006
105 Ga0123356_10023225 3300010049 Bacteria 5839
106 Ga0123356_10025430 3300010049 Bacteria 5565
107 Ga0123356_10063061 3300010049 Bacteria 3463
108 Ga0123356_10463363 3300010049 Bacteria 1417
109 Ga0123353_10094712 3300010167 Bacteria 4811
110 Ga0123353_10124809 3300010167 Bacteria 4137
111 Ga0123353_10193076 3300010167 Bacteria 3212
112 Ga0123354_10350148 3300010882 Bacteria 1318
113 Ga0466734_114582 3300042623 Bacteria 1884
114 Ga0466703_135691 3300042636 Bacteria 7114
115 Ga0466691_013886 3300042593 Bacteria 19135
116 IMNBL1DRAFT_c0000819 3300000062 Bacteria 24533
117 JGI24702J35022_10023842 3300002462 Bacteria 3307
118 Ga0466705_413800 3300042612 Bacteria 3324
119 Ga0466705_498032 3300042612 Bacteria 2107
120 Ga0466726_031736 3300042619 Bacteria 18923
121 Ga0466701_097399 3300042598 Bacteria 121087
122 Ga0466700_205397 3300042600 Bacteria 2272
123 Ga0466719_337212 3300042606 Bacteria 5292
124 Ga0466721_349851 3300042608 Bacteria 11657
125 Ga0123355_10329763 3300009826 Bacteria 2046
126 Ga0123356_10052053 3300010049 Bacteria 3809
127 Ga0123353_10000383 3300010167 Bacteria 54226
128 Ga0123353_10036634 3300010167 Bacteria 7686
129 Ga0123353_10168902 3300010167 Bacteria 3474
130 Ga0123353_10257058 3300010167 Bacteria 2701

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042612 Ga0466705_413800 Ga0466705_413800_915_1916 333
2 3300042612 Ga0466705_498032 Ga0466705_498032_483_1508 341
3 3300042616 Ga0466715_191352 Ga0466715_191352_26821_27846 341
4 3300010049 Ga0123356_10000703 Ga0123356_100007035 342
5 3300010049 Ga0123356_10009007 Ga0123356_100090074 342
6 3300010167 Ga0123353_10257058 Ga0123353_102570582 342
7 3300010167 Ga0123353_10451095 Ga0123353_104510952 342
8 3300042620 Ga0466728_205222 Ga0466728_205222_47_1075 342
9 3300042643 Ga0466704_504696 Ga0466704_504696_7993_9021 342
10 3300042596 Ga0466696_322001 Ga0466696_322001_1391_2452 353
11 3300042592 Ga0466693_221650 Ga0466693_221650_202_1275 357
12 3300042596 Ga0466696_360008 Ga0466696_360008_357_1430 357
13 3300042615 Ga0466711_072383 Ga0466711_072383_14452_15525 357
14 3300042616 Ga0466715_363895 Ga0466715_363895_4145_5218 357
15 3300042616 Ga0466715_537488 Ga0466715_537488_1430_2503 357
16 3300042620 Ga0466728_079003 Ga0466728_079003_741_1814 357
17 3300042655 Ga0466727_060271 Ga0466727_060271_3251_4324 357
18 iso_pr_bacteria 2820333861 2820334115 357
19 iso_pr_bacteria 2820357977 2820358663 357
20 iso_pr_bacteria 2820429680 2820430265 357
21 iso_pr_bacteria 2820447167 2820448043 357
22 iso_pr_bacteria 2820501819 2820504446 357
23 iso_pr_bacteria 2820657860 2820661004 357
24 2225789004 2227496034 2227973406 358
25 3300002462 JGI24702J35022_10002927 JGI24702J35022_100029276 358
26 3300002509 JGI24699J35502_11134135 JGI24699J35502_1113413531 358
27 3300002834 JGI24696J40584_12961544 JGI24696J40584_1296154412 358
28 3300009784 Ga0123357_10074708 Ga0123357_100747083 358
29 3300009826 Ga0123355_10011516 Ga0123355_100115169 358
30 3300009826 Ga0123355_10084155 Ga0123355_100841555 358
31 3300009826 Ga0123355_10132110 Ga0123355_101321102 358
32 3300009826 Ga0123355_10133422 Ga0123355_101334224 358
33 3300010049 Ga0123356_10002159 Ga0123356_100021593 358
34 3300010049 Ga0123356_10022111 Ga0123356_100221115 358
35 3300010049 Ga0123356_10190534 Ga0123356_101905342 358
36 3300010049 Ga0123356_10463363 Ga0123356_104633632 358
37 3300010167 Ga0123353_10000383 Ga0123353_1000038353 358
38 3300010167 Ga0123353_10007640 Ga0123353_1000764010 358
39 3300010167 Ga0123353_10013597 Ga0123353_100135976 358
40 3300010167 Ga0123353_10029598 Ga0123353_100295987 358
41 3300010167 Ga0123353_10036634 Ga0123353_100366344 358
42 3300010167 Ga0123353_10046691 Ga0123353_100466912 358
43 3300010167 Ga0123353_10053445 Ga0123353_100534453 358
44 3300010167 Ga0123353_10060137 Ga0123353_100601375 358
45 3300010167 Ga0123353_10168902 Ga0123353_101689023 358
46 3300010167 Ga0123353_10186388 Ga0123353_101863883 358
47 3300010167 Ga0123353_10357269 Ga0123353_103572691 358
48 3300010882 Ga0123354_10350148 Ga0123354_103501481 358
49 3300042591 Ga0466692_187408 Ga0466692_187408_13551_14627 358
50 3300042593 Ga0466691_010059 Ga0466691_010059_12087_13163 358
51 3300042593 Ga0466691_013886 Ga0466691_013886_5130_6206 358
52 3300042594 Ga0466694_367638 Ga0466694_367638_278_1354 358
53 3300042598 Ga0466701_097399 Ga0466701_097399_11834_12910 358
54 3300042600 Ga0466700_011778 Ga0466700_011778_334_1410 358
55 3300042602 Ga0466713_085560 Ga0466713_085560_15924_17000 358
56 3300042605 Ga0466716_361898 Ga0466716_361898_11455_12531 358
57 3300042605 Ga0466716_473788 Ga0466716_473788_1692_2768 358
58 3300042606 Ga0466719_337212 Ga0466719_337212_3942_5018 358
59 3300042609 Ga0466722_193990 Ga0466722_193990_1973_3049 358
60 3300042615 Ga0466711_139870 Ga0466711_139870_135_1211 358
61 3300042616 Ga0466715_261660 Ga0466715_261660_10018_11094 358
62 3300042616 Ga0466715_611496 Ga0466715_611496_316_1392 358
63 3300042619 Ga0466726_031736 Ga0466726_031736_1145_2221 358
64 3300042620 Ga0466728_372276 Ga0466728_372276_282_1358 358
65 3300042623 Ga0466734_114582 Ga0466734_114582_361_1437 358
66 3300042636 Ga0466703_135691 Ga0466703_135691_4419_5495 358
67 3300042636 Ga0466703_246268 Ga0466703_246268_124_1200 358
68 3300042636 Ga0466703_286329 Ga0466703_286329_3543_4619 358
69 3300042652 Ga0466708_255390 Ga0466708_255390_2828_3904 358
70 3300042654 Ga0466725_112620 Ga0466725_112620_1728_2804 358
71 iso_pr_bacteria 2820414148 2820414654 358
72 3300000062 IMNBL1DRAFT_c0000819 IMNBL1DRAFT_000081916 359
73 3300002462 JGI24702J35022_10007763 JGI24702J35022_100077635 359
74 3300002462 JGI24702J35022_10023842 JGI24702J35022_100238422 359
75 3300009784 Ga0123357_10002245 Ga0123357_100022454 359
76 3300009784 Ga0123357_10026794 Ga0123357_100267945 359
77 3300009784 Ga0123357_10073383 Ga0123357_100733834 359
78 3300010167 Ga0123353_10010054 Ga0123353_100100542 359
79 3300010167 Ga0123353_10076225 Ga0123353_100762255 359
80 3300010882 Ga0123354_10000120 Ga0123354_100001204 359
81 3300038395 Ga0415639_025769 Ga0415639_025769_12117_13196 359
82 3300042590 Ga0466690_043583 Ga0466690_043583_13292_14371 359
83 3300042595 Ga0466695_179253 Ga0466695_179253_672_1751 359
84 3300042600 Ga0466700_205397 Ga0466700_205397_282_1361 359
85 3300042608 Ga0466721_217737 Ga0466721_217737_1529_2608 359
86 3300042608 Ga0466721_323597 Ga0466721_323597_8786_9865 359
87 3300042608 Ga0466721_349851 Ga0466721_349851_8901_9980 359
88 3300042611 Ga0466697_121711 Ga0466697_121711_465_1544 359
89 3300042612 Ga0466705_090294 Ga0466705_090294_685_1764 359
90 3300042615 Ga0466711_234814 Ga0466711_234814_3209_4288 359
91 3300042616 Ga0466715_010386 Ga0466715_010386_10113_11192 359
92 3300042621 Ga0466729_216750 Ga0466729_216750_3175_4254 359
93 3300042624 Ga0466735_122168 Ga0466735_122168_5797_6876 359
94 3300042643 Ga0466704_191284 Ga0466704_191284_11124_12203 359
95 3300042648 Ga0466709_031405 Ga0466709_031405_8358_9437 359
96 3300042659 Ga0466733_084631 Ga0466733_084631_3377_4456 359
97 iso_pr_bacteria 2820250282 2820252292 359
98 iso_pr_bacteria 2820336130 2820339249 359
99 iso_pr_bacteria 2820408893 2820410944 359
100 iso_pr_bacteria 2820563109 2820564811 359
101 iso_pr_bacteria 2820576413 2820576448 359
102 iso_pr_bacteria 2820644600 2820644735 359
103 iso_pr_bacteria 2820666966 2820669471 359
104 3300002450 JGI24695J34938_10002758 JGI24695J34938_1000275814 360
105 3300002450 JGI24695J34938_10027912 JGI24695J34938_100279122 360
106 3300002462 JGI24702J35022_10005422 JGI24702J35022_100054223 360
107 3300010049 Ga0123356_10000536 Ga0123356_100005362 360
108 3300010049 Ga0123356_10001287 Ga0123356_1000128711 360
109 3300010049 Ga0123356_10001554 Ga0123356_1000155427 360
110 3300010049 Ga0123356_10009950 Ga0123356_100099502 360
111 3300010049 Ga0123356_10021446 Ga0123356_100214466 360
112 3300010049 Ga0123356_10025430 Ga0123356_100254304 360
113 3300010049 Ga0123356_10034739 Ga0123356_100347393 360
114 3300010049 Ga0123356_10052053 Ga0123356_100520532 360
115 3300010049 Ga0123356_10063061 Ga0123356_100630612 360
116 3300010049 Ga0123356_10129255 Ga0123356_101292552 360
117 3300010049 Ga0123356_10202207 Ga0123356_102022071 360
118 3300010049 Ga0123356_10215811 Ga0123356_102158112 360
119 3300010049 Ga0123356_10337415 Ga0123356_103374152 360
120 3300010049 Ga0123356_10368345 Ga0123356_103683451 360
121 3300010167 Ga0123353_10001305 Ga0123353_100013057 360
122 3300010167 Ga0123353_10064381 Ga0123353_100643816 360
123 3300010167 Ga0123353_10094712 Ga0123353_100947124 360
124 3300010167 Ga0123353_10108699 Ga0123353_101086992 360
125 3300010167 Ga0123353_10124809 Ga0123353_101248092 360
126 3300010167 Ga0123353_10193076 Ga0123353_101930762 360
127 3300010167 Ga0123353_10202580 Ga0123353_102025803 360
128 3300010167 Ga0123353_10221369 Ga0123353_102213692 360
129 3300010167 Ga0123353_10249285 Ga0123353_102492852 360
130 3300010167 Ga0123353_10263613 Ga0123353_102636133 360
131 3300010167 Ga0123353_10268337 Ga0123353_102683372 360
132 3300010167 Ga0123353_10431602 Ga0123353_104316022 360
133 3300010167 Ga0123353_10467175 Ga0123353_104671752 360
134 3300010167 Ga0123353_10577921 Ga0123353_105779212 360
135 3300010882 Ga0123354_10122034 Ga0123354_101220343 360
136 3300042643 Ga0466704_333919 Ga0466704_333919_322_1404 360
137 3300010167 Ga0123353_10144912 Ga0123353_101449122 361
138 3300009826 Ga0123355_10329763 Ga0123355_103297632 362
139 3300042616 Ga0466715_032624 Ga0466715_032624_8500_9588 362
140 iso_pr_bacteria 2820483401 2820484496 363
141 iso_pr_bacteria 2820582954 2820583375 364
142 3300002462 JGI24702J35022_10005855 JGI24702J35022_100058553 365
143 3300010049 Ga0123356_10023225 Ga0123356_100232256 365
144 3300002462 JGI24702J35022_10010678 JGI24702J35022_100106782 366
145 3300042622 Ga0466731_178797 Ga0466731_178797_7101_8204 367
146 3300010882 Ga0123354_10125147 Ga0123354_101251473 413

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00294 PfkB pfkB family carbohydrate kinase 144 336 0.88

🏗️ Structural Annotation – Top 5 Hits

IDDescriptionScoreStartEnd
2afb-assembly1.cif.gz_B Crystal structure of 2-dehydro-3- deoxygluconokinase (EC 2.7.1.45) (tm0067) from THERMOTOGA MARITIMA at 2.05 A resolution 0.944 10 351
4gm6-assembly1.cif.gz_F Crystal structure of PfkB family carbohydrate kinase(TARGET EFI-502146 FROM Listeria grayi DSM 20601 0.94 12 350
2afb-assembly1.cif.gz_A Crystal structure of 2-dehydro-3- deoxygluconokinase (EC 2.7.1.45) (tm0067) from THERMOTOGA MARITIMA at 2.05 A resolution 0.925 6 351
1v19-assembly1.cif.gz_A 2-KETO-3-DEOXYGLUCONATE KINASE FROM THERMUS THERMOPHILUS 0.901 10 348
3pl2-assembly2.cif.gz_D Crystal structure of a 5-keto-2-deoxygluconokinase (NCgl0155, Cgl0158) from Corynebacterium glutamicum ATCC 13032 KITASATO at 1.89 A resolution 0.884 10 347
IDDescriptionScoreStartEndSuperfamily
1j5vB00 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.9464 12 349 3.40.1190.20
4gm6A00 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.9397 12 350 3.40.1190.20
1v1aA00 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.8874 10 346 3.40.1190.20
3ktnA00 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.8776 10 357 3.40.1190.20
3iq0B00 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.8576 10 352 3.40.1190.20
IDDescriptionScoreStartEndGO Terms
AF-A0A7V5YRH9-F1-model_v4 Uncharacterized/unreviewed 0.9935 1 304
AF-X1CLC1-F1-model_v4 Carbohydrate kinase PfkB domain-containing protein 0.9917 1 166

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.94 0.94 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.