Protein Family IF12039
Metagenome
Isolate
122
Members
49
Samples
114
Scaffolds
160.88
Avg Length
Representative Sequence
- ID
- iso_pr_bacteria|2820306284|2820309171|
- Length
- 159 aa
- Sequence
- MRIGIGYDVHKLVAERLLILGGVTVPFDKGLQGHSDADVLVHAIMDALLGAASLGDIGKFFPDTDDRYKNANSLHLLATVKQALQASNFTVVNIDSIIVAQKPKLADFLPKMAQNISEVLDISTTVVNVKATTEEYLGFTGNGEGIAAHAVCLLENERL
Sample Types
Isolate
6.6%
Metagenome
93.4%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
33.3%
Kalotermitidae
25.0%
Unclassified
20.8%
Termopsidae
8.3%
Rhinotermitidae
8.3%
Passalidae
4.2%
Taxonomy
Archaea
0
Bacteria
121
Eukaryota
0
Viruses
0
Unclassified
1
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820781750 | Unclassified Bacteroidetes Emb289P3bin89 | Isolate | Unclassified |
| 2 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 3 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 4 | 643348524 | Candidatus Azobacteroides pseudotrichonymphae gv. CFP2 | Isolate | Unclassified |
| 5 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 6 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 7 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 8 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 9 | 2967483437 | Candidatus Ordinivivax streblomastigis St1 | Isolate | Unclassified |
| 10 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 11 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 12 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 13 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 14 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 15 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 16 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 17 | 2820762746 | Unclassified Bacteroidetes Mp193P4bin3 | Isolate | Unclassified |
| 18 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 19 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 20 | 2820748953 | Unclassified Bacteroidetes Nt197P4bin17 | Isolate | Unclassified |
| 21 | 3300002508 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 | Metagenome | Termitidae |
| 22 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 23 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 24 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 25 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 26 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 27 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 28 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 29 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 30 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 31 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 32 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 33 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 34 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 35 | 2820759988 | Unclassified Bacteroidetes Mp193P4bin4 | Isolate | Unclassified |
| 36 | 2820306284 | Unclassified Firmicutes Th196P1bin11 | Isolate | Unclassified |
| 37 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 38 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 39 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 40 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 41 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 42 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 43 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 44 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 45 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 46 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 47 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 48 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 49 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466715_625525 | 3300042616 | Unclassified | 7456 |
| 2 | Ga0466729_264768 | 3300042621 | Bacteria | 2038 |
| 3 | Ga0466704_307703 | 3300042643 | Bacteria | 10998 |
| 4 | Ga0466709_095978 | 3300042648 | Bacteria | 34809 |
| 5 | Ga0466701_044082 | 3300042598 | Bacteria | 23082 |
| 6 | Ga0466713_107448 | 3300042602 | Bacteria | 14158 |
| 7 | Ga0466717_127655 | 3300042604 | Bacteria | 1068 |
| 8 | Ga0466719_457528 | 3300042606 | Bacteria | 7994 |
| 9 | Ga0466721_043945 | 3300042608 | Bacteria | 11758 |
| 10 | IMNBL1DRAFT_c0000733 | 3300000062 | Bacteria | 26035 |
| 11 | JGI24702J35022_10271695 | 3300002462 | Bacteria | 992 |
| 12 | JGI24700J35501_10930862 | 3300002508 | Bacteria | 29357 |
| 13 | JGI24699J35502_11022660 | 3300002509 | Bacteria | 1461 |
| 14 | Ga0466715_583205 | 3300042616 | Bacteria | 24186 |
| 15 | Ga0466723_029668 | 3300042618 | Bacteria | 2374 |
| 16 | Ga0466723_114596 | 3300042618 | Bacteria | 16891 |
| 17 | Ga0123357_10006254 | 3300009784 | Bacteria | 14468 |
| 18 | Ga0123357_10414504 | 3300009784 | Bacteria | 1210 |
| 19 | Ga0123354_10001986 | 3300010882 | Bacteria | 26232 |
| 20 | Ga0466690_279907 | 3300042590 | Bacteria | 12492 |
| 21 | Ga0466690_381813 | 3300042590 | Bacteria | 66142 |
| 22 | Ga0466692_126545 | 3300042591 | Bacteria | 8972 |
| 23 | Ga0466703_152121 | 3300042636 | Bacteria | 1162 |
| 24 | Ga0466704_468893 | 3300042643 | Bacteria | 12102 |
| 25 | Ga0466727_146961 | 3300042655 | Bacteria | 6922 |
| 26 | Ga0466707_151833 | 3300042601 | Bacteria | 2471 |
| 27 | Ga0466722_034359 | 3300042609 | Bacteria | 35656 |
| 28 | 2227393338 | 2225789004 | Bacteria | 1083 |
| 29 | JGI24705J35276_12225752 | 3300002504 | Bacteria | 2763 |
| 30 | JGI24699J35502_11133779 | 3300002509 | Bacteria | 15459 |
| 31 | Ga0466711_342701 | 3300042615 | Bacteria | 3826 |
| 32 | Ga0123357_10060824 | 3300009784 | Bacteria | 5065 |
| 33 | Ga0123357_10062643 | 3300009784 | Bacteria | 4977 |
| 34 | Ga0123354_10035956 | 3300010882 | Bacteria | 7731 |
| 35 | Ga0466729_285797 | 3300042621 | Bacteria | 17692 |
| 36 | Ga0466735_059852 | 3300042624 | Bacteria | 8124 |
| 37 | Ga0466735_113706 | 3300042624 | Bacteria | 3235 |
| 38 | Ga0466703_371541 | 3300042636 | Bacteria | 1231 |
| 39 | Ga0466704_479589 | 3300042643 | Bacteria | 9853 |
| 40 | Ga0466700_235803 | 3300042600 | Bacteria | 20088 |
| 41 | Ga0466700_416865 | 3300042600 | Bacteria | 2230 |
| 42 | Ga0466707_149202 | 3300042601 | Bacteria | 9070 |
| 43 | JGI24702J35022_10114350 | 3300002462 | Bacteria | 1486 |
| 44 | Ga0068305_10096172 | 3300005083 | Bacteria | 1131 |
| 45 | Ga0123357_10027701 | 3300009784 | Bacteria | 7661 |
| 46 | Ga0123357_10489063 | 3300009784 | Bacteria | 1032 |
| 47 | Ga0123357_10675556 | 3300009784 | Bacteria | 752 |
| 48 | Ga0123354_10059564 | 3300010882 | Bacteria | 5660 |
| 49 | Ga0466692_118997 | 3300042591 | Bacteria | 6541 |
| 50 | Ga0466691_187837 | 3300042593 | Bacteria | 10413 |
| 51 | Ga0466696_114042 | 3300042596 | Bacteria | 8252 |
| 52 | Ga0466696_357148 | 3300042596 | Bacteria | 8974 |
| 53 | Ga0466734_078676 | 3300042623 | Bacteria | 1045 |
| 54 | Ga0466735_107178 | 3300042624 | Bacteria | 1133 |
| 55 | Ga0466708_095257 | 3300042652 | Bacteria | 18757 |
| 56 | Ga0466707_310689 | 3300042601 | Bacteria | 5046 |
| 57 | Ga0466716_154198 | 3300042605 | Bacteria | 13244 |
| 58 | IMNBL1DRAFT_c0024995 | 3300000062 | Bacteria | 2299 |
| 59 | JGI24705J35276_12022567 | 3300002504 | Bacteria | 876 |
| 60 | JGI24705J35276_12219054 | 3300002504 | Bacteria | 2182 |
| 61 | JGI24696J40584_12928761 | 3300002834 | Bacteria | 1444 |
| 62 | Ga0072941_1055547 | 3300005201 | Bacteria | 1939 |
| 63 | Ga0466726_032938 | 3300042619 | Bacteria | 39699 |
| 64 | Ga0123356_10004478 | 3300010049 | Bacteria | 14432 |
| 65 | Ga0466690_188170 | 3300042590 | Bacteria | 33248 |
| 66 | Ga0466692_150345 | 3300042591 | Bacteria | 15119 |
| 67 | Ga0466735_211515 | 3300042624 | Bacteria | 3083 |
| 68 | Ga0466703_392331 | 3300042636 | Bacteria | 3359 |
| 69 | Ga0466727_124195 | 3300042655 | Bacteria | 107642 |
| 70 | Ga0466700_286036 | 3300042600 | Bacteria | 14740 |
| 71 | Ga0466719_075471 | 3300042606 | Bacteria | 9184 |
| 72 | JGI24705J35276_12238603 | 3300002504 | Bacteria | 28869 |
| 73 | Ga0123357_10000604 | 3300009784 | Bacteria | 35558 |
| 74 | Ga0466697_136395 | 3300042611 | Bacteria | 1091 |
| 75 | Ga0123357_10004100 | 3300009784 | Bacteria | 16976 |
| 76 | Ga0123356_10074490 | 3300010049 | Bacteria | 3195 |
| 77 | Ga0123354_10033997 | 3300010882 | Bacteria | 7978 |
| 78 | Ga0123354_10102066 | 3300010882 | Bacteria | 3869 |
| 79 | Ga0456237_0000003 | 3300041968 | Bacteria | 82299 |
| 80 | Ga0466692_100663 | 3300042591 | Bacteria | 44250 |
| 81 | Ga0466692_178326 | 3300042591 | Bacteria | 1111 |
| 82 | Ga0466696_020142 | 3300042596 | Bacteria | 50212 |
| 83 | Ga0466735_149441 | 3300042624 | Bacteria | 7846 |
| 84 | Ga0466704_060775 | 3300042643 | Bacteria | 5089 |
| 85 | Ga0466716_411738 | 3300042605 | Bacteria | 3671 |
| 86 | Ga0466711_246793 | 3300042615 | Bacteria | 3049 |
| 87 | Ga0466729_059466 | 3300042621 | Bacteria | 7565 |
| 88 | Ga0123357_10036470 | 3300009784 | Bacteria | 6691 |
| 89 | Ga0123354_10047429 | 3300010882 | Bacteria | 6547 |
| 90 | Ga0466691_184140 | 3300042593 | Bacteria | 4471 |
| 91 | Ga0466694_063253 | 3300042594 | Bacteria | 2894 |
| 92 | Ga0466734_102790 | 3300042623 | Bacteria | 1873 |
| 93 | Ga0466707_161645 | 3300042601 | Bacteria | 28036 |
| 94 | Ga0466707_271714 | 3300042601 | Bacteria | 3940 |
| 95 | Ga0466716_176616 | 3300042605 | Bacteria | 3271 |
| 96 | JGI24699J35502_11134186 | 3300002509 | Bacteria | 47913 |
| 97 | JGI24696J40584_12784601 | 3300002834 | Bacteria | 842 |
| 98 | Ga0123357_10001873 | 3300009784 | Bacteria | 22846 |
| 99 | Ga0466715_425943 | 3300042616 | Bacteria | 13483 |
| 100 | Ga0123357_10109792 | 3300009784 | Bacteria | 3523 |
| 101 | Ga0123357_10153166 | 3300009784 | Bacteria | 2790 |
| 102 | Ga0123356_10325134 | 3300010049 | Bacteria | 1652 |
| 103 | Ga0123356_10460426 | 3300010049 | Bacteria | 1421 |
| 104 | Ga0123354_10001302 | 3300010882 | Bacteria | 29724 |
| 105 | Ga0466692_028860 | 3300042591 | Bacteria | 1637 |
| 106 | Ga0466699_426324 | 3300042597 | Bacteria | 2281 |
| 107 | Ga0466735_173329 | 3300042624 | Bacteria | 3407 |
| 108 | Ga0466735_207537 | 3300042624 | Bacteria | 6563 |
| 109 | Ga0466735_233734 | 3300042624 | Bacteria | 2596 |
| 110 | Ga0466703_319405 | 3300042636 | Bacteria | 3346 |
| 111 | Ga0466707_328470 | 3300042601 | Bacteria | 9694 |
| 112 | Ga0466713_148442 | 3300042602 | Bacteria | 11365 |
| 113 | JGI24702J35022_10010770 | 3300002462 | Bacteria | 5105 |
| 114 | Ga0068302_10190383 | 3300005071 | Bacteria | 1116 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300002462 | JGI24702J35022_10010770 | JGI24702J35022_100107703 | 144 |
| 2 | 3300009784 | Ga0123357_10109792 | Ga0123357_101097923 | 147 |
| 3 | 3300042616 | Ga0466715_625525 | Ga0466715_625525_3120_3611 | 153 |
| 4 | 3300042601 | Ga0466707_161645 | Ga0466707_161645_6085_6552 | 155 |
| 5 | 3300010882 | Ga0123354_10033997 | Ga0123354_100339975 | 156 |
| 6 | 3300042623 | Ga0466734_078676 | Ga0466734_078676_44_514 | 156 |
| 7 | 3300042597 | Ga0466699_426324 | Ga0466699_426324_253_726 | 157 |
| 8 | 2225789004 | 2227393338 | 2227837736 | 158 |
| 9 | 3300042590 | Ga0466690_279907 | Ga0466690_279907_6746_7222 | 158 |
| 10 | 3300042591 | Ga0466692_100663 | Ga0466692_100663_36790_37266 | 158 |
| 11 | 3300042591 | Ga0466692_126545 | Ga0466692_126545_1430_1906 | 158 |
| 12 | 3300042593 | Ga0466691_184140 | Ga0466691_184140_2554_3030 | 158 |
| 13 | 3300042605 | Ga0466716_176616 | Ga0466716_176616_1979_2455 | 158 |
| 14 | 3300042605 | Ga0466716_411738 | Ga0466716_411738_2865_3341 | 158 |
| 15 | 3300042643 | Ga0466704_060775 | Ga0466704_060775_69_545 | 158 |
| 16 | 3300042643 | Ga0466704_468893 | Ga0466704_468893_4469_4945 | 158 |
| 17 | iso_pr_bacteria | 2820781750 | 2820783393 | 158 |
| 18 | 3300042601 | Ga0466707_151833 | Ga0466707_151833_166_645 | 159 |
| 19 | 3300042601 | Ga0466707_328470 | Ga0466707_328470_3334_3813 | 159 |
| 20 | 3300042602 | Ga0466713_107448 | Ga0466713_107448_5895_6374 | 159 |
| 21 | 3300042602 | Ga0466713_148442 | Ga0466713_148442_5422_5901 | 159 |
| 22 | 3300042608 | Ga0466721_043945 | Ga0466721_043945_7210_7689 | 159 |
| 23 | 3300042621 | Ga0466729_264768 | Ga0466729_264768_756_1235 | 159 |
| 24 | 3300042624 | Ga0466735_233734 | Ga0466735_233734_730_1209 | 159 |
| 25 | 3300042636 | Ga0466703_319405 | Ga0466703_319405_86_565 | 159 |
| 26 | 3300042643 | Ga0466704_307703 | Ga0466704_307703_5679_6158 | 159 |
| 27 | 3300042652 | Ga0466708_095257 | Ga0466708_095257_2218_2697 | 159 |
| 28 | iso_pr_bacteria | 2820306284 | 2820309171 | 159 |
| 29 | iso_pr_bacteria | 2967483437 | 2967485202 | 159 |
| 30 | iso_pr_bacteria | 2967483437 | 2967485213 | 159 |
| 31 | 3300000062 | IMNBL1DRAFT_c0000733 | IMNBL1DRAFT_00007335 | 160 |
| 32 | 3300000062 | IMNBL1DRAFT_c0024995 | IMNBL1DRAFT_00249952 | 160 |
| 33 | 3300002508 | JGI24700J35501_10930862 | JGI24700J35501_1093086211 | 160 |
| 34 | 3300002509 | JGI24699J35502_11022660 | JGI24699J35502_110226603 | 160 |
| 35 | 3300005083 | Ga0068305_10096172 | Ga0068305_100961721 | 160 |
| 36 | 3300009784 | Ga0123357_10027701 | Ga0123357_100277012 | 160 |
| 37 | 3300010882 | Ga0123354_10001986 | Ga0123354_100019867 | 160 |
| 38 | 3300042591 | Ga0466692_028860 | Ga0466692_028860_1050_1532 | 160 |
| 39 | 3300042591 | Ga0466692_118997 | Ga0466692_118997_5883_6365 | 160 |
| 40 | 3300042600 | Ga0466700_286036 | Ga0466700_286036_2004_2486 | 160 |
| 41 | 3300042600 | Ga0466700_416865 | Ga0466700_416865_44_526 | 160 |
| 42 | 3300042601 | Ga0466707_149202 | Ga0466707_149202_5621_6103 | 160 |
| 43 | 3300042601 | Ga0466707_310689 | Ga0466707_310689_1043_1525 | 160 |
| 44 | 3300042604 | Ga0466717_127655 | Ga0466717_127655_463_945 | 160 |
| 45 | 3300042616 | Ga0466715_425943 | Ga0466715_425943_6875_7357 | 160 |
| 46 | 3300042618 | Ga0466723_029668 | Ga0466723_029668_1136_1618 | 160 |
| 47 | 3300042621 | Ga0466729_059466 | Ga0466729_059466_6049_6531 | 160 |
| 48 | 3300042621 | Ga0466729_285797 | Ga0466729_285797_10768_11250 | 160 |
| 49 | 3300042624 | Ga0466735_113706 | Ga0466735_113706_2514_2996 | 160 |
| 50 | 3300042624 | Ga0466735_207537 | Ga0466735_207537_2581_3063 | 160 |
| 51 | 3300042636 | Ga0466703_152121 | Ga0466703_152121_346_828 | 160 |
| 52 | iso_pr_bacteria | 2820748953 | 2820750385 | 160 |
| 53 | 3300002504 | JGI24705J35276_12022567 | JGI24705J35276_120225672 | 161 |
| 54 | 3300005201 | Ga0072941_1055547 | Ga0072941_10555473 | 161 |
| 55 | 3300009784 | Ga0123357_10001873 | Ga0123357_100018738 | 161 |
| 56 | 3300009784 | Ga0123357_10006254 | Ga0123357_100062545 | 161 |
| 57 | 3300009784 | Ga0123357_10036470 | Ga0123357_100364702 | 161 |
| 58 | 3300009784 | Ga0123357_10060824 | Ga0123357_100608245 | 161 |
| 59 | 3300009784 | Ga0123357_10062643 | Ga0123357_100626433 | 161 |
| 60 | 3300009784 | Ga0123357_10153166 | Ga0123357_101531663 | 161 |
| 61 | 3300009784 | Ga0123357_10489063 | Ga0123357_104890632 | 161 |
| 62 | 3300009784 | Ga0123357_10675556 | Ga0123357_106755562 | 161 |
| 63 | 3300010049 | Ga0123356_10004478 | Ga0123356_100044785 | 161 |
| 64 | 3300010049 | Ga0123356_10325134 | Ga0123356_103251342 | 161 |
| 65 | 3300010882 | Ga0123354_10047429 | Ga0123354_100474293 | 161 |
| 66 | 3300041968 | Ga0456237_0000003 | Ga0456237_0000003_75269_75754 | 161 |
| 67 | 3300042590 | Ga0466690_381813 | Ga0466690_381813_59642_60127 | 161 |
| 68 | 3300042593 | Ga0466691_187837 | Ga0466691_187837_6130_6615 | 161 |
| 69 | 3300042596 | Ga0466696_357148 | Ga0466696_357148_368_853 | 161 |
| 70 | 3300042600 | Ga0466700_235803 | Ga0466700_235803_13347_13832 | 161 |
| 71 | 3300042601 | Ga0466707_271714 | Ga0466707_271714_3328_3813 | 161 |
| 72 | 3300042606 | Ga0466719_457528 | Ga0466719_457528_923_1408 | 161 |
| 73 | 3300042615 | Ga0466711_246793 | Ga0466711_246793_501_986 | 161 |
| 74 | 3300042616 | Ga0466715_583205 | Ga0466715_583205_11905_12390 | 161 |
| 75 | 3300042624 | Ga0466735_059852 | Ga0466735_059852_4231_4716 | 161 |
| 76 | 3300042624 | Ga0466735_107178 | Ga0466735_107178_311_796 | 161 |
| 77 | 3300042624 | Ga0466735_173329 | Ga0466735_173329_22_507 | 161 |
| 78 | 3300002462 | JGI24702J35022_10271695 | JGI24702J35022_102716952 | 162 |
| 79 | 3300002504 | JGI24705J35276_12225752 | JGI24705J35276_122257522 | 162 |
| 80 | 3300002834 | JGI24696J40584_12784601 | JGI24696J40584_127846012 | 162 |
| 81 | 3300002834 | JGI24696J40584_12928761 | JGI24696J40584_129287612 | 162 |
| 82 | 3300005071 | Ga0068302_10190383 | Ga0068302_101903832 | 162 |
| 83 | 3300009784 | Ga0123357_10004100 | Ga0123357_100041009 | 162 |
| 84 | 3300010049 | Ga0123356_10460426 | Ga0123356_104604262 | 162 |
| 85 | 3300010882 | Ga0123354_10001302 | Ga0123354_1000130216 | 162 |
| 86 | 3300010882 | Ga0123354_10035956 | Ga0123354_100359561 | 162 |
| 87 | 3300010882 | Ga0123354_10102066 | Ga0123354_101020661 | 162 |
| 88 | 3300042590 | Ga0466690_188170 | Ga0466690_188170_6365_6853 | 162 |
| 89 | 3300042591 | Ga0466692_150345 | Ga0466692_150345_12112_12600 | 162 |
| 90 | 3300042591 | Ga0466692_178326 | Ga0466692_178326_273_761 | 162 |
| 91 | 3300042594 | Ga0466694_063253 | Ga0466694_063253_545_1033 | 162 |
| 92 | 3300042596 | Ga0466696_114042 | Ga0466696_114042_6248_6736 | 162 |
| 93 | 3300042605 | Ga0466716_154198 | Ga0466716_154198_7067_7555 | 162 |
| 94 | 3300042618 | Ga0466723_114596 | Ga0466723_114596_7652_8140 | 162 |
| 95 | 3300042623 | Ga0466734_102790 | Ga0466734_102790_213_701 | 162 |
| 96 | 3300042624 | Ga0466735_211515 | Ga0466735_211515_1733_2221 | 162 |
| 97 | 3300042636 | Ga0466703_371541 | Ga0466703_371541_147_635 | 162 |
| 98 | 3300042643 | Ga0466704_479589 | Ga0466704_479589_5667_6155 | 162 |
| 99 | 3300002462 | JGI24702J35022_10114350 | JGI24702J35022_101143502 | 163 |
| 100 | 3300002504 | JGI24705J35276_12219054 | JGI24705J35276_122190542 | 163 |
| 101 | 3300009784 | Ga0123357_10000604 | Ga0123357_1000060428 | 163 |
| 102 | 3300010049 | Ga0123356_10074490 | Ga0123356_100744903 | 163 |
| 103 | 3300010882 | Ga0123354_10059564 | Ga0123354_100595646 | 163 |
| 104 | 3300042598 | Ga0466701_044082 | Ga0466701_044082_20121_20612 | 163 |
| 105 | 3300042606 | Ga0466719_075471 | Ga0466719_075471_2925_3416 | 163 |
| 106 | 3300042609 | Ga0466722_034359 | Ga0466722_034359_5462_5953 | 163 |
| 107 | 3300042615 | Ga0466711_342701 | Ga0466711_342701_1390_1881 | 163 |
| 108 | 3300042624 | Ga0466735_149441 | Ga0466735_149441_2057_2548 | 163 |
| 109 | 3300042636 | Ga0466703_392331 | Ga0466703_392331_717_1208 | 163 |
| 110 | iso_pr_bacteria | 2820759988 | 2820762213 | 163 |
| 111 | 3300002509 | JGI24699J35502_11134186 | JGI24699J35502_1113418631 | 164 |
| 112 | iso_pr_bacteria | 2820762746 | 2820763221 | 164 |
| 113 | 3300002509 | JGI24699J35502_11133779 | JGI24699J35502_111337795 | 165 |
| 114 | 3300042611 | Ga0466697_136395 | Ga0466697_136395_406_903 | 165 |
| 115 | 3300042619 | Ga0466726_032938 | Ga0466726_032938_14756_15253 | 165 |
| 116 | 3300042655 | Ga0466727_124195 | Ga0466727_124195_101620_102117 | 165 |
| 117 | 3300042648 | Ga0466709_095978 | Ga0466709_095978_30765_31265 | 166 |
| 118 | 3300042655 | Ga0466727_146961 | Ga0466727_146961_5918_6421 | 167 |
| 119 | iso_pr_bacteria | 643348524 | 643423338 | 167 |
| 120 | 3300002504 | JGI24705J35276_12238603 | JGI24705J35276_1223860319 | 169 |
| 121 | 3300009784 | Ga0123357_10414504 | Ga0123357_104145041 | 174 |
| 122 | 3300042596 | Ga0466696_020142 | Ga0466696_020142_21330_21866 | 178 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF02542 | YgbB | YgbB family | 1 | 154 | 0.99 |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.94 | 0.94 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.