Protein Family IF12032

Metagenome Isolate
168 Members
66 Samples
126 Scaffolds
263.35 Avg Length

🧬 Representative Sequence

ID
iso_pr_bacteria|2820282995|2820284879|
Length
324 aa
Sequence
LYTQTARQGCRALRKALDAGLQLDILRSAKLELIIVRCSCSGASGKPRPTNIIIHYSLLIEVIMLTKRLIACFDIIAGRVTKAVQFQDNIDVAAADELAQTMYEAQIDELIFYDITASSEKRPVDIETVKKVARCVFIPFTVGGGIKELDDMYEALKAGAEKISIDSMAVRNPQIISDGAKAFGSQCIVLSTQVKRTPSMPSGYEVYIDGARLATGLDALEWIKKGQELGAGEICINSIDNDGMLSGYDLELMKLAESSLSVPLIASGGAGKPEHLKALFEKTEAQAAIISSMLYSPRMESNYAVSEIKEYLIENGICMRPTRV

πŸ“Š Sample Types

Isolate 25.0%
Metagenome 75.0%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Unclassified 62.5%
Termitidae 32.8%
Passalidae 3.1%
Hodotermitidae 1.6%

🌳 Taxonomy

Archaea 1
Bacteria 145
Eukaryota 0
Viruses 0
Unclassified 22

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820254385 Unclassified Firmicutes Th196P3bin54 Isolate Unclassified
2 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
3 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
4 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
5 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
6 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
7 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
8 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
9 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
10 2820001644 Unclassified Synergistetes Th196P3bin106 Isolate Unclassified
11 2820171952 Unclassified Planctomycetes Th196P3bin88 Isolate Unclassified
12 2820280018 Unclassified Firmicutes Th196P3bin149 Isolate Unclassified
13 2820290662 Unclassified Firmicutes Th196P3bin135 Isolate Unclassified
14 2820462123 Unclassified Firmicutes Lab288P3bin129 Isolate Unclassified
15 2820673891 Unclassified Firmicutes Co191P3bin18 Isolate Unclassified
16 2820705605 Unclassified Firmicutes Co191P1bin34 Isolate Unclassified
17 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
18 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
19 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
20 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
21 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
22 2772190893 Unclassified Elusimicrobia Nt197P4_bin29 Isolate Unclassified
23 2781125690 Treponema sp. Th196P3bin63 Isolate Unclassified
24 2781125691 Treponema sp. Th196P3bin73 Isolate Unclassified
25 2820014844 Unclassified Spirochaetes Nt197P3bin95 Isolate Unclassified
26 2820240463 Unclassified Firmicutes Th196P3bin85 Isolate Unclassified
27 2820246658 Unclassified Firmicutes Th196P3bin70 Isolate Unclassified
28 2820267566 Unclassified Firmicutes Th196P3bin33 Isolate Unclassified
29 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
30 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
31 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
32 2772190894 Unclassified Elusimicrobia Th196P4_bin33 Isolate Unclassified
33 2781125630 Treponema sp. Nt197P3bin60 Isolate Unclassified
34 2820265624 Unclassified Firmicutes Th196P3bin36 Isolate Unclassified
35 2820288918 Unclassified Firmicutes Th196P3bin137 Isolate Unclassified
36 2820294436 Unclassified Firmicutes Th196P3bin104 Isolate Unclassified
37 2820387566 Unclassified Firmicutes Nt197P1bin1 Isolate Unclassified
38 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
39 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
40 2820806175 Unclassified Actinobacteria Th196P3bin122 Isolate Unclassified
41 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
42 2778260941 Unclassified Fibrobacteres Th196P3bin8 Isolate Unclassified
43 2781125692 Treponema sp. Th196P3bin31 Isolate Unclassified
44 2820178484 Unclassified Planctomycetes Th196P3bin110 Isolate Unclassified
45 2820272499 Unclassified Firmicutes Th196P3bin18 Isolate Unclassified
46 2820277137 Unclassified Firmicutes Th196P3bin150 Isolate Unclassified
47 2820282995 Unclassified Firmicutes Th196P3bin147 Isolate Unclassified
48 2820513949 Unclassified Firmicutes Lab288P1bin39 Isolate Unclassified
49 2820576413 Unclassified Firmicutes Emb289P3bin136 Isolate Unclassified
50 2820617402 Unclassified Firmicutes Emb289P1bin131 Isolate Unclassified
51 3300005485 Termite gut microbial communities from Costa Rica - P3 luminal contents Metagenome Termitidae
52 2781125629 Treponema sp. Nt197P3bin20 Isolate Unclassified
53 2820685979 Unclassified Firmicutes Co191P1bin81 Isolate Unclassified
54 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
55 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
56 2820244222 Unclassified Firmicutes Th196P3bin75 Isolate Unclassified
57 2820292184 Unclassified Firmicutes Th196P3bin109 Isolate Unclassified
58 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
59 2740892547 Fibrobacteria bacterium GUT77 MC_77 Isolate Unclassified
60 2781125656 Treponema sp. Emb289P1bin65 Isolate Unclassified
61 2820234266 Unclassified Firmicutes Th196P3bin99 Isolate Unclassified
62 2820375548 Unclassified Firmicutes Nt197P1bin8 Isolate Unclassified
63 2820472365 Unclassified Firmicutes Lab288P1bin87 Isolate Unclassified
64 3300002501 Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 Metagenome Termitidae
65 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
66 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466732_231252 3300042656 Bacteria 1700
2 Ga0415639_002342 3300038395 Bacteria 3203
3 Ga0415639_077797 3300038395 Bacteria 5188
4 Ga0466693_156461 3300042592 Unclassified 1073
5 Ga0466718_091964 3300042617 Bacteria 11393
6 Ga0466718_096178 3300042617 Bacteria 1051
7 Ga0466718_104777 3300042617 Bacteria 1062
8 Ga0466702_123420 3300042635 Bacteria 2029
9 Ga0123355_10020495 3300009826 Bacteria 10561
10 Ga0123356_10284208 3300010049 Bacteria 1751
11 JGI24703J35330_11747963 3300002501 Bacteria 9478
12 Ga0466732_273463 3300042656 Archaea 2000
13 Ga0264413_109032 3300024493 Bacteria 20980
14 Ga0466693_251270 3300042592 Unclassified 3080
15 Ga0466694_389754 3300042594 Bacteria 14466
16 Ga0466699_046566 3300042597 Bacteria 4054
17 Ga0466699_053478 3300042597 Bacteria 6145
18 Ga0466702_191755 3300042635 Bacteria 1207
19 Ga0466702_329660 3300042635 Bacteria 6578
20 Ga0466702_335754 3300042635 Bacteria 1586
21 Ga0466706_011360 3300042599 Bacteria 77012
22 Ga0466720_118212 3300042607 Bacteria 10704
23 Ga0123355_10049263 3300009826 Bacteria 6850
24 Ga0123355_10984726 3300009826 Unclassified 898
25 Ga0123353_10011893 3300010167 Bacteria 12307
26 Ga0123353_10568706 3300010167 Unclassified 1630
27 Ga0415639_047845 3300038395 Bacteria 10523
28 Ga0466693_360292 3300042592 Bacteria 3403
29 Ga0466694_207654 3300042594 Bacteria 1816
30 Ga0466694_271302 3300042594 Bacteria 4587
31 Ga0466699_279028 3300042597 Bacteria 2287
32 Ga0466699_282849 3300042597 Unclassified 1220
33 Ga0466699_320762 3300042597 Bacteria 25864
34 Ga0466718_105478 3300042617 Bacteria 2643
35 Ga0466702_100257 3300042635 Bacteria 3554
36 Ga0466702_342180 3300042635 Bacteria 1279
37 Ga0123355_10000922 3300009826 Bacteria 40710
38 Ga0123355_10039396 3300009826 Bacteria 7688
39 Ga0123355_10194099 3300009826 Bacteria 2982
40 Ga0123356_10007648 3300010049 Bacteria 10768
41 Ga0072941_1128887 3300005201 Bacteria 15469
42 Ga0415639_007793 3300038395 Bacteria 12587
43 Ga0466693_244527 3300042592 Bacteria 2256
44 Ga0466699_046077 3300042597 Bacteria 7412
45 Ga0466699_072842 3300042597 Unclassified 2296
46 Ga0466699_141552 3300042597 Bacteria 9431
47 Ga0466699_221090 3300042597 Bacteria 4884
48 Ga0466702_440566 3300042635 Unclassified 1036
49 Ga0466717_022311 3300042604 Bacteria 3913
50 Ga0466720_084103 3300042607 Bacteria 2975
51 Ga0123355_10077423 3300009826 Bacteria 5316
52 Ga0123355_10626513 3300009826 Bacteria 1265
53 Ga0123356_10061823 3300010049 Unclassified 3498
54 Ga0123353_10156182 3300010167 Bacteria 3636
55 Ga0123353_10546235 3300010167 Bacteria 1673
56 Ga0123353_11031342 3300010167 Unclassified 1101
57 JGI24695J34938_10110367 3300002450 Unclassified 1121
58 JGI24703J35330_11647826 3300002501 Bacteria 1580
59 Ga0466732_345256 3300042656 Bacteria 21012
60 Ga0415639_160236 3300038395 Bacteria 3146
61 Ga0466699_025911 3300042597 Bacteria 1379
62 Ga0466699_352369 3300042597 Unclassified 3408
63 Ga0466702_062256 3300042635 Bacteria 47552
64 Ga0466720_058251 3300042607 Bacteria 15810
65 Ga0123355_10015896 3300009826 Bacteria 11841
66 Ga0123355_10085404 3300009826 Bacteria 5022
67 Ga0123355_10104473 3300009826 Bacteria 4448
68 Ga0123355_10184821 3300009826 Bacteria 3085
69 Ga0123354_10205825 3300010882 Unclassified 2146
70 Ga0072940_1040144 3300005200 Bacteria 2483
71 Ga0466732_281739 3300042656 Unclassified 1524
72 Ga0415639_060538 3300038395 Bacteria 4914
73 Ga0415639_064318 3300038395 Bacteria 4781
74 Ga0466693_168834 3300042592 Bacteria 4061
75 Ga0466694_025479 3300042594 Bacteria 30226
76 Ga0466699_323298 3300042597 Bacteria 1045
77 Ga0466718_017125 3300042617 Bacteria 2152
78 Ga0466702_002025 3300042635 Unclassified 2085
79 Ga0466702_111739 3300042635 Unclassified 3301
80 Ga0466702_385361 3300042635 Bacteria 1273
81 Ga0466717_242612 3300042604 Unclassified 1177
82 Ga0466720_129776 3300042607 Bacteria 44546
83 Ga0466720_230936 3300042607 Bacteria 5440
84 Ga0123353_10123295 3300010167 Bacteria 4165
85 Ga0123353_10493655 3300010167 Bacteria 1786
86 IMNBL1DRAFT_c0023769 3300000062 Bacteria 2394
87 JGI24695J34938_10001283 3300002450 Bacteria 22012
88 JGI24705J35276_12238810 3300002504 Bacteria 153372
89 Ga0072941_1088715 3300005201 Unclassified 9540
90 Ga0264413_130260 3300024493 Bacteria 12956
91 Ga0264413_144958 3300024493 Unclassified 2356
92 Ga0415639_109238 3300038395 Unclassified 1075
93 Ga0466694_099352 3300042594 Bacteria 3175
94 Ga0466699_145077 3300042597 Bacteria 1852
95 Ga0466718_129043 3300042617 Bacteria 5658
96 Ga0466720_017687 3300042607 Bacteria 6296
97 Ga0123355_10009218 3300009826 Bacteria 14979
98 Ga0123355_10042369 3300009826 Bacteria 7410
99 Ga0123353_10205398 3300010167 Bacteria 3095
100 Ga0123353_10455892 3300010167 Bacteria 1881
101 Ga0123353_10923514 3300010167 Bacteria 1185
102 Ga0123354_10161216 3300010882 Bacteria 2661
103 2227425263 2225789004 Bacteria 5592
104 JGI24703J35330_11748536 3300002501 Bacteria 18955
105 Ga0072941_1002494 3300005201 Bacteria 21470
106 Ga0072941_1059881 3300005201 Bacteria 4663
107 Ga0415639_191348 3300038395 Bacteria 1390
108 Ga0466693_083397 3300042592 Bacteria 1571
109 Ga0466693_286722 3300042592 Unclassified 1015
110 Ga0466699_116824 3300042597 Bacteria 1999
111 Ga0466718_049337 3300042617 Bacteria 4391
112 Ga0466718_094911 3300042617 Bacteria 19633
113 Ga0466718_102131 3300042617 Bacteria 2366
114 Ga0466720_123259 3300042607 Unclassified 6430
115 Ga0466720_137382 3300042607 Unclassified 1597
116 Ga0466698_057359 3300042610 Bacteria 8853
117 Ga0123355_10000048 3300009826 Bacteria 122485
118 Ga0123355_10159974 3300009826 Bacteria 3395
119 Ga0123355_10312360 3300009826 Bacteria 2128
120 Ga0123355_10322406 3300009826 Bacteria 2080
121 Ga0123353_10137562 3300010167 Bacteria 3916
122 Ga0123353_10371848 3300010167 Bacteria 2142
123 AustNasuHG_c1006334 3300000089 Bacteria 4229
124 JGI24702J35022_10054458 3300002462 Bacteria 2134
125 Ga0072940_1118823 3300005200 Bacteria 11896
126 Ga0074263_101283 3300005485 Bacteria 3503

πŸ“‹ Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300010167 Ga0123353_10455892 Ga0123353_104558923 260
2 3300038395 Ga0415639_060538 Ga0415639_060538_1388_2170 260
3 3300038395 Ga0415639_109238 Ga0415639_109238_10_792 260
4 3300038395 Ga0415639_160236 Ga0415639_160236_1975_2757 260
5 3300038395 Ga0415639_191348 Ga0415639_191348_561_1343 260
6 3300042592 Ga0466693_286722 Ga0466693_286722_73_855 260
7 3300042597 Ga0466699_046077 Ga0466699_046077_2634_3416 260
8 3300042597 Ga0466699_053478 Ga0466699_053478_2128_2910 260
9 3300042597 Ga0466699_116824 Ga0466699_116824_25_807 260
10 3300042597 Ga0466699_141552 Ga0466699_141552_5415_6197 260
11 3300042597 Ga0466699_221090 Ga0466699_221090_1624_2406 260
12 3300042607 Ga0466720_118212 Ga0466720_118212_6992_7774 260
13 3300042610 Ga0466698_057359 Ga0466698_057359_2783_3565 260
14 3300042617 Ga0466718_094911 Ga0466718_094911_12168_12950 260
15 3300042617 Ga0466718_096178 Ga0466718_096178_169_951 260
16 3300042656 Ga0466732_273463 Ga0466732_273463_716_1498 260
17 iso_pr_bacteria 2772190893 2773438519 260
18 iso_pr_bacteria 2820178484 2820179792 260
19 iso_pr_bacteria 2820265624 2820266609 260
20 iso_pr_bacteria 2820294436 2820295986 260
21 iso_pr_bacteria 2820472365 2820472854 260
22 iso_pr_bacteria 2820513949 2820515694 260
23 iso_pr_bacteria 2820673891 2820676061 260
24 iso_pr_bacteria 2820673891 2820676308 260
25 iso_pr_bacteria 2820673891 2820676582 260
26 iso_pr_bacteria 2820685979 2820688094 260
27 iso_pr_bacteria 2820705605 2820706622 260
28 3300002450 JGI24695J34938_10001283 JGI24695J34938_1000128323 261
29 3300002504 JGI24705J35276_12238810 JGI24705J35276_12238810102 261
30 3300005201 Ga0072941_1128887 Ga0072941_11288878 261
31 3300009826 Ga0123355_10049263 Ga0123355_100492634 261
32 3300009826 Ga0123355_10077423 Ga0123355_100774233 261
33 3300009826 Ga0123355_10085404 Ga0123355_100854045 261
34 3300009826 Ga0123355_10104473 Ga0123355_101044735 261
35 3300009826 Ga0123355_10194099 Ga0123355_101940992 261
36 3300009826 Ga0123355_10312360 Ga0123355_103123602 261
37 3300009826 Ga0123355_10626513 Ga0123355_106265132 261
38 3300010167 Ga0123353_10123295 Ga0123353_101232952 261
39 3300010167 Ga0123353_10923514 Ga0123353_109235141 261
40 3300038395 Ga0415639_047845 Ga0415639_047845_5652_6437 261
41 3300038395 Ga0415639_064318 Ga0415639_064318_2871_3656 261
42 3300042592 Ga0466693_083397 Ga0466693_083397_55_840 261
43 3300042592 Ga0466693_168834 Ga0466693_168834_468_1253 261
44 3300042592 Ga0466693_244527 Ga0466693_244527_171_956 261
45 3300042592 Ga0466693_251270 Ga0466693_251270_1313_2098 261
46 3300042592 Ga0466693_360292 Ga0466693_360292_464_1249 261
47 3300042594 Ga0466694_025479 Ga0466694_025479_17702_18487 261
48 3300042594 Ga0466694_099352 Ga0466694_099352_1403_2188 261
49 3300042594 Ga0466694_207654 Ga0466694_207654_142_927 261
50 3300042594 Ga0466694_271302 Ga0466694_271302_800_1585 261
51 3300042594 Ga0466694_389754 Ga0466694_389754_6761_7546 261
52 3300042597 Ga0466699_025911 Ga0466699_025911_36_821 261
53 3300042597 Ga0466699_320762 Ga0466699_320762_10657_11442 261
54 3300042604 Ga0466717_022311 Ga0466717_022311_542_1327 261
55 3300042607 Ga0466720_084103 Ga0466720_084103_1065_1850 261
56 3300042607 Ga0466720_137382 Ga0466720_137382_648_1433 261
57 3300042617 Ga0466718_049337 Ga0466718_049337_2161_2946 261
58 3300042617 Ga0466718_091964 Ga0466718_091964_7574_8359 261
59 3300042635 Ga0466702_002025 Ga0466702_002025_917_1702 261
60 3300042635 Ga0466702_100257 Ga0466702_100257_423_1208 261
61 3300042635 Ga0466702_111739 Ga0466702_111739_1436_2221 261
62 3300042635 Ga0466702_191755 Ga0466702_191755_227_1012 261
63 3300042635 Ga0466702_335754 Ga0466702_335754_761_1546 261
64 3300042656 Ga0466732_231252 Ga0466732_231252_673_1458 261
65 iso_pr_bacteria 2820014844 2820016293 261
66 iso_pr_bacteria 2820171952 2820172242 261
67 iso_pr_bacteria 2820234266 2820234898 261
68 iso_pr_bacteria 2820240463 2820241660 261
69 iso_pr_bacteria 2820277137 2820277554 261
70 iso_pr_bacteria 2820280018 2820281264 261
71 iso_pr_bacteria 2820292184 2820292989 261
72 iso_pr_bacteria 2820375548 2820376865 261
73 iso_pr_bacteria 2820806175 2820806488 261
74 3300000089 AustNasuHG_c1006334 AustNasuHG_10063342 262
75 3300002501 JGI24703J35330_11647826 JGI24703J35330_116478262 262
76 3300002501 JGI24703J35330_11747963 JGI24703J35330_117479635 262
77 3300009826 Ga0123355_10020495 Ga0123355_1002049511 262
78 3300010167 Ga0123353_10011893 Ga0123353_100118939 262
79 3300010167 Ga0123353_10371848 Ga0123353_103718483 262
80 3300010167 Ga0123353_10546235 Ga0123353_105462351 262
81 3300010167 Ga0123353_10568706 Ga0123353_105687062 262
82 3300010882 Ga0123354_10161216 Ga0123354_101612164 262
83 3300010882 Ga0123354_10205825 Ga0123354_102058252 262
84 3300024493 Ga0264413_144958 Ga0264413_1449583 262
85 3300042592 Ga0466693_156461 Ga0466693_156461_185_973 262
86 3300042607 Ga0466720_123259 Ga0466720_123259_1770_2558 262
87 3300042607 Ga0466720_129776 Ga0466720_129776_25743_26531 262
88 3300042607 Ga0466720_230936 Ga0466720_230936_729_1517 262
89 3300042617 Ga0466718_017125 Ga0466718_017125_985_1773 262
90 3300042617 Ga0466718_105478 Ga0466718_105478_1640_2428 262
91 3300042635 Ga0466702_329660 Ga0466702_329660_3811_4599 262
92 3300042635 Ga0466702_385361 Ga0466702_385361_444_1232 262
93 3300042635 Ga0466702_440566 Ga0466702_440566_21_809 262
94 3300042656 Ga0466732_281739 Ga0466732_281739_185_973 262
95 iso_pr_bacteria 2781125656 2781320987 262
96 iso_pr_bacteria 2820246658 2820248881 262
97 iso_pr_bacteria 2820290662 2820290743 262
98 iso_pr_bacteria 2820576413 2820578129 262
99 iso_pr_bacteria 2820617402 2820617599 262
100 3300000062 IMNBL1DRAFT_c0023769 IMNBL1DRAFT_00237693 263
101 3300005201 Ga0072941_1088715 Ga0072941_10887154 263
102 3300009826 Ga0123355_10000048 Ga0123355_1000004864 263
103 3300009826 Ga0123355_10009218 Ga0123355_1000921810 263
104 3300009826 Ga0123355_10015896 Ga0123355_100158962 263
105 3300009826 Ga0123355_10042369 Ga0123355_100423696 263
106 3300009826 Ga0123355_10184821 Ga0123355_101848214 263
107 3300009826 Ga0123355_10984726 Ga0123355_109847261 263
108 3300010049 Ga0123356_10007648 Ga0123356_100076485 263
109 3300024493 Ga0264413_109032 Ga0264413_1090323 263
110 3300024493 Ga0264413_130260 Ga0264413_1302604 263
111 3300038395 Ga0415639_007793 Ga0415639_007793_9405_10196 263
112 3300042597 Ga0466699_046566 Ga0466699_046566_192_983 263
113 3300042597 Ga0466699_323298 Ga0466699_323298_123_914 263
114 3300042607 Ga0466720_058251 Ga0466720_058251_2429_3220 263
115 3300042617 Ga0466718_104777 Ga0466718_104777_111_902 263
116 iso_pr_bacteria 2740892547 2743912668 263
117 iso_pr_bacteria 2781125690 2781427704 263
118 iso_pr_bacteria 2820244222 2820245431 263
119 2225789004 2227425263 2227865776 264
120 3300002450 JGI24695J34938_10110367 JGI24695J34938_101103671 264
121 3300005200 Ga0072940_1118823 Ga0072940_11188237 264
122 3300005201 Ga0072941_1002494 Ga0072941_100249414 264
123 3300009826 Ga0123355_10000922 Ga0123355_1000092215 264
124 3300009826 Ga0123355_10159974 Ga0123355_101599743 264
125 3300009826 Ga0123355_10322406 Ga0123355_103224063 264
126 3300042599 Ga0466706_011360 Ga0466706_011360_38996_39790 264
127 3300042617 Ga0466718_102131 Ga0466718_102131_1307_2101 264
128 iso_pr_bacteria 2772190894 2773439982 264
129 iso_pr_bacteria 2781125691 2781429277 264
130 iso_pr_bacteria 2781125692 2781430802 264
131 iso_pr_bacteria 2820387566 2820388245 264
132 3300002501 JGI24703J35330_11748536 JGI24703J35330_1174853611 265
133 3300005200 Ga0072940_1040144 Ga0072940_10401442 265
134 3300010167 Ga0123353_10137562 Ga0123353_101375622 265
135 3300042597 Ga0466699_072842 Ga0466699_072842_826_1623 265
136 3300042597 Ga0466699_279028 Ga0466699_279028_781_1578 265
137 3300042597 Ga0466699_282849 Ga0466699_282849_286_1083 265
138 3300042597 Ga0466699_352369 Ga0466699_352369_258_1055 265
139 iso_pr_bacteria 2778260941 2778359452 265
140 iso_pr_bacteria 2820267566 2820267886 265
141 3300002462 JGI24702J35022_10054458 JGI24702J35022_100544583 266
142 3300042607 Ga0466720_017687 Ga0466720_017687_2840_3640 266
143 iso_pr_bacteria 2820254385 2820255598 266
144 3300009826 Ga0123355_10039396 Ga0123355_100393964 267
145 3300042597 Ga0466699_145077 Ga0466699_145077_403_1206 267
146 3300042617 Ga0466718_129043 Ga0466718_129043_2346_3149 267
147 3300042635 Ga0466702_062256 Ga0466702_062256_30020_30823 267
148 3300042635 Ga0466702_123420 Ga0466702_123420_857_1660 267
149 3300005201 Ga0072941_1059881 Ga0072941_10598816 268
150 3300005485 Ga0074263_101283 Ga0074263_1012832 268
151 3300010167 Ga0123353_10205398 Ga0123353_102053982 268
152 3300010167 Ga0123353_10493655 Ga0123353_104936552 268
153 3300010167 Ga0123353_11031342 Ga0123353_110313421 268
154 iso_pr_bacteria 2781125629 2781262632 268
155 iso_pr_bacteria 2781125630 2781266538 268
156 iso_pr_bacteria 2820001644 2820002229 268
157 iso_pr_bacteria 2820272499 2820272890 268
158 3300038395 Ga0415639_077797 Ga0415639_077797_2680_3489 269
159 3300042604 Ga0466717_242612 Ga0466717_242612_205_1017 270
160 3300042635 Ga0466702_342180 Ga0466702_342180_258_1070 270
161 iso_pr_bacteria 2820462123 2820462959 270
162 iso_pr_bacteria 2820288918 2820290232 272
163 3300010049 Ga0123356_10061823 Ga0123356_100618233 273
164 3300010049 Ga0123356_10284208 Ga0123356_102842082 274
165 3300010167 Ga0123353_10156182 Ga0123353_101561823 274
166 3300038395 Ga0415639_002342 Ga0415639_002342_128_952 274
167 3300042656 Ga0466732_345256 Ga0466732_345256_19363_20190 275
168 iso_pr_bacteria 2820282995 2820284879 324

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00977 His_biosynth Histidine biosynthesis protein 68 297 0.96

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF00977 GO:0000105 L-histidine biosynthetic process BP

βš›οΈ Structure & Feature Viewer

pLDDTpTMQuality
0.79 0.82 High

Powered by Feature Viewer

Powered by PDBe Molstar

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.