Protein Family IF12009

Metagenome Isolate
125 Members
46 Samples
122 Scaffolds
280.06 Avg Length

🧬 Representative Sequence

ID
iso_pr_bacteria|2820267566|2820267579|
Length
282 aa
Sequence
MTKLGKRRRLFSKITRHVFLLGGALVFMFPLYWLISTSLKHEKQIFVLPPQLIPNPVIIDNYTRMWRHFPFLKFLSNTGFVTAMGVVGVLVSAPMVAYAFARLRWPGRNLWFMVMMATMMIPSQVTMIPLYIIFKEINWIDTFLPLWVPAWFGGGAFSIFLVRQFLMTTPKEMEESAFIDGANYLQIYIRIMLPLVYPPLTTIAIFRFMNSWNDFMGPLIYINNQNKYTLSLGLRLFQQQTGTAEYGMMMAATVLMVLPVILFFFLGQKQFIEGVVLTGMKN

📊 Sample Types

Isolate 2.4%
Metagenome 97.6%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 47.7%
Kalotermitidae 29.5%
Unclassified 9.1%
Rhinotermitidae 6.8%
Termopsidae 4.5%
Passalidae 2.3%

🌳 Taxonomy

Archaea 0
Bacteria 113
Eukaryota 0
Viruses 0
Unclassified 12

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125666 Treponema sp. Emb289P4bin7 Isolate Unclassified
2 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
3 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
4 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
5 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
6 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
7 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
8 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
9 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
10 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
11 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
12 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
13 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
14 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
15 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
16 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
17 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
18 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
19 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
20 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
21 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
22 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
23 2781125688 Treponema sp. Lab288P4bin13 Isolate Unclassified
24 2820267566 Unclassified Firmicutes Th196P3bin33 Isolate Unclassified
25 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
26 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
27 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
28 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
29 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
30 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
31 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
32 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
33 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
34 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
35 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
36 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
37 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
38 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
39 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
40 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
41 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
42 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
43 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
44 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
45 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
46 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_055871 3300042612 Bacteria 10040
2 Ga0466715_217031 3300042616 Bacteria 3306
3 Ga0466718_148460 3300042617 Bacteria 6518
4 Ga0466728_023491 3300042620 Bacteria 2503
5 Ga0466729_000541 3300042621 Bacteria 6466
6 Ga0264413_140270 3300024493 Bacteria 4008
7 Ga0466690_278447 3300042590 Unclassified 10374
8 Ga0466699_292456 3300042597 Bacteria 4296
9 Ga0466707_238413 3300042601 Bacteria 5047
10 Ga0466716_087657 3300042605 Bacteria 2473
11 Ga0466730_071337 3300042625 Bacteria 1765
12 Ga0466704_558062 3300042643 Bacteria 9825
13 Ga0466708_348418 3300042652 Bacteria 9517
14 Ga0466727_037311 3300042655 Bacteria 9547
15 2227091098 2225789004 Bacteria 1835
16 JGI24702J35022_10138706 3300002462 Bacteria 1355
17 Ga0072940_1206369 3300005200 Bacteria 3947
18 Ga0466732_181081 3300042656 Bacteria 1938
19 Ga0466715_314287 3300042616 Bacteria 4626
20 Ga0466718_038777 3300042617 Bacteria 7408
21 Ga0466693_225015 3300042592 Bacteria 39293
22 Ga0466691_036541 3300042593 Bacteria 6941
23 Ga0466694_051268 3300042594 Bacteria 15292
24 Ga0466694_130671 3300042594 Bacteria 13519
25 Ga0466694_154784 3300042594 Bacteria 1090
26 Ga0466694_256681 3300042594 Bacteria 5024
27 Ga0466695_188997 3300042595 Bacteria 1284
28 Ga0466699_192077 3300042597 Bacteria 20857
29 Ga0123356_10085479 3300010049 Bacteria 2992
30 Ga0123353_10817633 3300010167 Bacteria 1283
31 Ga0123354_10271349 3300010882 Bacteria 1669
32 Ga0466707_241264 3300042601 Bacteria 1276
33 Ga0466716_119440 3300042605 Unclassified 4698
34 Ga0466725_075442 3300042654 Bacteria 1108
35 Ga0466727_228532 3300042655 Bacteria 2776
36 Ga0466705_059877 3300042612 Bacteria 3632
37 Ga0466691_147751 3300042593 Bacteria 15883
38 Ga0466694_140512 3300042594 Bacteria 34095
39 Ga0466695_292736 3300042595 Bacteria 6822
40 Ga0466696_118924 3300042596 Unclassified 4665
41 Ga0466699_354442 3300042597 Bacteria 8128
42 Ga0466699_438578 3300042597 Bacteria 1405
43 Ga0123355_10379933 3300009826 Bacteria 1842
44 Ga0466722_066991 3300042609 Bacteria 10989
45 Ga0466698_064469 3300042610 Unclassified 1097
46 Ga0466727_213463 3300042655 Bacteria 3123
47 JGI24695J34938_10073356 3300002450 Bacteria 1426
48 JGI24702J35022_10031132 3300002462 Bacteria 2860
49 Ga0072941_1219124 3300005201 Bacteria 3414
50 Ga0466715_107413 3300042616 Bacteria 7959
51 Ga0466715_508671 3300042616 Bacteria 1829
52 Ga0466691_140399 3300042593 Bacteria 2995
53 Ga0466694_037854 3300042594 Bacteria 1881
54 Ga0466694_060542 3300042594 Bacteria 4209
55 Ga0466694_189999 3300042594 Unclassified 1508
56 Ga0123357_10161842 3300009784 Bacteria 2680
57 Ga0123354_10034360 3300010882 Unclassified 7929
58 Ga0466707_241425 3300042601 Bacteria 1988
59 Ga0466703_119970 3300042636 Unclassified 4560
60 Ga0466704_007672 3300042643 Bacteria 14768
61 Ga0466704_459378 3300042643 Bacteria 5047
62 JGI24695J34938_10014327 3300002450 Bacteria 4114
63 JGI24702J35022_10077794 3300002462 Bacteria 1794
64 Ga0466718_066068 3300042617 Bacteria 2342
65 Ga0466723_086393 3300042618 Unclassified 5144
66 Ga0466699_164126 3300042597 Bacteria 1627
67 Ga0123357_10111946 3300009784 Bacteria 3476
68 Ga0123356_10044759 3300010049 Bacteria 4120
69 Ga0123353_10456121 3300010167 Bacteria 1880
70 Ga0466714_083252 3300042603 Unclassified 1010
71 Ga0466717_092511 3300042604 Bacteria 1768
72 Ga0466698_227389 3300042610 Bacteria 1070
73 Ga0466703_177011 3300042636 Bacteria 3213
74 Ga0466704_108879 3300042643 Bacteria 4540
75 Ga0466704_154040 3300042643 Bacteria 7898
76 Ga0466704_367555 3300042643 Bacteria 1613
77 Ga0466704_411072 3300042643 Bacteria 4673
78 Ga0466725_326634 3300042654 Bacteria 1232
79 JGI24695J34938_10003725 3300002450 Bacteria 10413
80 Ga0072940_1035198 3300005200 Bacteria 5466
81 Ga0466705_230635 3300042612 Bacteria 2827
82 Ga0466705_250522 3300042612 Bacteria 20540
83 Ga0466715_184975 3300042616 Bacteria 35546
84 Ga0466726_289514 3300042619 Bacteria 1693
85 Ga0466728_169018 3300042620 Bacteria 15491
86 Ga0466694_009123 3300042594 Bacteria 47055
87 Ga0466699_043735 3300042597 Bacteria 4513
88 Ga0466699_140537 3300042597 Bacteria 2299
89 Ga0466699_309092 3300042597 Unclassified 2038
90 Ga0123356_10010725 3300010049 Bacteria 8969
91 Ga0123353_10008225 3300010167 Bacteria 14212
92 Ga0466698_066081 3300042610 Bacteria 5859
93 Ga0466703_320272 3300042636 Bacteria 45988
94 JGI24698J34947_10001648 3300002449 Bacteria 11887
95 JGI24695J34938_10012057 3300002450 Bacteria 4608
96 Ga0072940_1054760 3300005200 Bacteria 1317
97 Ga0466732_340142 3300042656 Bacteria 2987
98 Ga0466715_148026 3300042616 Bacteria 4671
99 Ga0466718_053459 3300042617 Bacteria 1552
100 Ga0466728_098341 3300042620 Bacteria 6478
101 Ga0466692_153046 3300042591 Bacteria 6818
102 Ga0466694_339802 3300042594 Unclassified 3514
103 Ga0466699_014080 3300042597 Bacteria 16825
104 Ga0123353_10852297 3300010167 Bacteria 1249
105 Ga0123354_10307291 3300010882 Unclassified 1488
106 Ga0466719_053102 3300042606 Bacteria 6571
107 Ga0466708_418603 3300042652 Bacteria 4269
108 Ga0466727_200974 3300042655 Bacteria 5186
109 JGI24695J34938_10018655 3300002450 Bacteria 3461
110 Ga0466732_142602 3300042656 Bacteria 8670
111 Ga0466712_301404 3300042614 Bacteria 1599
112 Ga0466711_517121 3300042615 Bacteria 5842
113 Ga0466726_488930 3300042619 Bacteria 5264
114 Ga0466694_051414 3300042594 Bacteria 27699
115 Ga0466695_259092 3300042595 Bacteria 134193
116 Ga0123357_10072599 3300009784 Bacteria 4560
117 Ga0123354_10240769 3300010882 Bacteria 1862
118 Ga0466714_111762 3300042603 Bacteria 1304
119 Ga0466703_011812 3300042636 Bacteria 7878
120 Ga0466708_070299 3300042652 Bacteria 12721
121 JGI24698J34947_10024908 3300002449 Bacteria 3189
122 Ga0123357_10000486 3300009784 Bacteria 38493

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300024493 Ga0264413_140270 Ga0264413_1402702 237
2 3300042625 Ga0466730_071337 Ga0466730_071337_1039_1755 238
3 3300042592 Ga0466693_225015 Ga0466693_225015_11825_12556 243
4 3300042597 Ga0466699_164126 Ga0466699_164126_837_1568 243
5 3300042603 Ga0466714_083252 Ga0466714_083252_106_933 250
6 3300042603 Ga0466714_111762 Ga0466714_111762_375_1202 250
7 3300042594 Ga0466694_154784 Ga0466694_154784_233_991 252
8 3300042617 Ga0466718_148460 Ga0466718_148460_3984_4742 252
9 3300010882 Ga0123354_10307291 Ga0123354_103072912 253
10 3300010167 Ga0123353_10852297 Ga0123353_108522971 254
11 3300042604 Ga0466717_092511 Ga0466717_092511_716_1546 255
12 3300042656 Ga0466732_181081 Ga0466732_181081_21_800 259
13 3300042593 Ga0466691_036541 Ga0466691_036541_3911_4693 260
14 3300042612 Ga0466705_230635 Ga0466705_230635_410_1330 262
15 3300042654 Ga0466725_075442 Ga0466725_075442_50_838 262
16 3300005201 Ga0072941_1219124 Ga0072941_12191243 264
17 3300042595 Ga0466695_188997 Ga0466695_188997_82_876 264
18 3300042594 Ga0466694_189999 Ga0466694_189999_696_1493 265
19 3300009784 Ga0123357_10000486 Ga0123357_1000048618 266
20 3300042656 Ga0466732_142602 Ga0466732_142602_3780_4622 270
21 3300042597 Ga0466699_043735 Ga0466699_043735_224_1039 271
22 3300042643 Ga0466704_411072 Ga0466704_411072_228_1043 271
23 3300042594 Ga0466694_339802 Ga0466694_339802_2277_3095 272
24 3300042597 Ga0466699_354442 Ga0466699_354442_735_1553 272
25 3300042594 Ga0466694_051414 Ga0466694_051414_19231_20052 273
26 3300042601 Ga0466707_241264 Ga0466707_241264_22_843 273
27 3300042610 Ga0466698_227389 Ga0466698_227389_139_960 273
28 3300042643 Ga0466704_154040 Ga0466704_154040_4978_5799 273
29 3300010049 Ga0123356_10085479 Ga0123356_100854793 274
30 3300042597 Ga0466699_438578 Ga0466699_438578_326_1198 275
31 3300042601 Ga0466707_238413 Ga0466707_238413_3809_4636 275
32 3300042643 Ga0466704_007672 Ga0466704_007672_12050_12877 275
33 3300002462 JGI24702J35022_10031132 JGI24702J35022_100311322 276
34 3300042597 Ga0466699_014080 Ga0466699_014080_723_1553 276
35 3300042609 Ga0466722_066991 Ga0466722_066991_7631_8500 276
36 3300002450 JGI24695J34938_10073356 JGI24695J34938_100733562 277
37 3300010167 Ga0123353_10456121 Ga0123353_104561212 277
38 3300042595 Ga0466695_259092 Ga0466695_259092_129618_130451 277
39 3300010049 Ga0123356_10010725 Ga0123356_100107254 278
40 3300042593 Ga0466691_147751 Ga0466691_147751_2855_3727 278
41 3300042617 Ga0466718_053459 Ga0466718_053459_651_1505 278
42 3300042620 Ga0466728_098341 Ga0466728_098341_4659_5495 278
43 2225789004 2227091098 2227470104 279
44 3300002449 JGI24698J34947_10024908 JGI24698J34947_100249082 279
45 3300009826 Ga0123355_10379933 Ga0123355_103799332 279
46 3300010049 Ga0123356_10044759 Ga0123356_100447593 279
47 3300042616 Ga0466715_508671 Ga0466715_508671_371_1213 280
48 3300002450 JGI24695J34938_10003725 JGI24695J34938_100037254 281
49 3300042601 Ga0466707_241425 Ga0466707_241425_769_1614 281
50 3300042636 Ga0466703_177011 Ga0466703_177011_207_1052 281
51 3300005200 Ga0072940_1054760 Ga0072940_10547602 282
52 3300042643 Ga0466704_558062 Ga0466704_558062_8183_9079 282
53 3300042654 Ga0466725_326634 Ga0466725_326634_352_1200 282
54 3300042655 Ga0466727_037311 Ga0466727_037311_3621_4469 282
55 3300042655 Ga0466727_200974 Ga0466727_200974_1298_2146 282
56 iso_pr_bacteria 2820267566 2820267579 282
57 3300042597 Ga0466699_140537 Ga0466699_140537_145_996 283
58 3300042619 Ga0466726_488930 Ga0466726_488930_47_898 283
59 3300042594 Ga0466694_009123 Ga0466694_009123_42148_43002 284
60 3300042594 Ga0466694_037854 Ga0466694_037854_263_1117 284
61 3300042594 Ga0466694_051268 Ga0466694_051268_6711_7565 284
62 3300042594 Ga0466694_060542 Ga0466694_060542_44_898 284
63 3300042594 Ga0466694_130671 Ga0466694_130671_264_1118 284
64 3300042594 Ga0466694_140512 Ga0466694_140512_13084_13938 284
65 3300042594 Ga0466694_256681 Ga0466694_256681_3595_4449 284
66 3300042595 Ga0466695_292736 Ga0466695_292736_5603_6457 284
67 3300042597 Ga0466699_192077 Ga0466699_192077_11382_12236 284
68 3300042597 Ga0466699_292456 Ga0466699_292456_1008_1862 284
69 3300042597 Ga0466699_309092 Ga0466699_309092_881_1735 284
70 3300042610 Ga0466698_064469 Ga0466698_064469_112_966 284
71 3300042610 Ga0466698_066081 Ga0466698_066081_3433_4287 284
72 3300042656 Ga0466732_340142 Ga0466732_340142_340_1194 284
73 iso_pr_bacteria 2781125688 2781422915 284
74 3300002450 JGI24695J34938_10012057 JGI24695J34938_100120574 285
75 3300002450 JGI24695J34938_10018655 JGI24695J34938_100186552 285
76 3300009784 Ga0123357_10072599 Ga0123357_100725993 285
77 3300009784 Ga0123357_10161842 Ga0123357_101618423 285
78 3300010167 Ga0123353_10817633 Ga0123353_108176331 285
79 3300010882 Ga0123354_10034360 Ga0123354_100343603 285
80 3300010882 Ga0123354_10240769 Ga0123354_102407692 285
81 3300010882 Ga0123354_10271349 Ga0123354_102713492 285
82 3300042590 Ga0466690_278447 Ga0466690_278447_4045_4902 285
83 3300042616 Ga0466715_184975 Ga0466715_184975_5322_6179 285
84 3300042618 Ga0466723_086393 Ga0466723_086393_997_1854 285
85 3300042636 Ga0466703_011812 Ga0466703_011812_6560_7417 285
86 3300042636 Ga0466703_119970 Ga0466703_119970_3301_4158 285
87 3300002450 JGI24695J34938_10014327 JGI24695J34938_100143273 289
88 3300042591 Ga0466692_153046 Ga0466692_153046_5239_6123 289
89 3300042596 Ga0466696_118924 Ga0466696_118924_2264_3133 289
90 3300042612 Ga0466705_250522 Ga0466705_250522_9667_10536 289
91 3300042593 Ga0466691_140399 Ga0466691_140399_1763_2635 290
92 3300042606 Ga0466719_053102 Ga0466719_053102_1225_2097 290
93 3300042612 Ga0466705_059877 Ga0466705_059877_288_1160 290
94 3300042616 Ga0466715_107413 Ga0466715_107413_4417_5289 290
95 3300042616 Ga0466715_217031 Ga0466715_217031_2134_3006 290
96 3300042616 Ga0466715_314287 Ga0466715_314287_2229_3101 290
97 3300042620 Ga0466728_023491 Ga0466728_023491_742_1614 290
98 3300042620 Ga0466728_169018 Ga0466728_169018_7628_8500 290
99 3300042636 Ga0466703_320272 Ga0466703_320272_11155_12027 290
100 3300042643 Ga0466704_459378 Ga0466704_459378_146_1018 290
101 3300042655 Ga0466727_213463 Ga0466727_213463_1095_1967 290
102 3300042655 Ga0466727_228532 Ga0466727_228532_567_1439 290
103 3300042605 Ga0466716_119440 Ga0466716_119440_2562_3437 291
104 3300042612 Ga0466705_055871 Ga0466705_055871_2695_3570 291
105 3300042616 Ga0466715_148026 Ga0466715_148026_657_1532 291
106 3300042617 Ga0466718_066068 Ga0466718_066068_556_1431 291
107 3300042652 Ga0466708_418603 Ga0466708_418603_3383_4258 291
108 3300005200 Ga0072940_1035198 Ga0072940_10351983 292
109 3300042617 Ga0466718_038777 Ga0466718_038777_1800_2678 292
110 3300042643 Ga0466704_108879 Ga0466704_108879_97_975 292
111 3300010167 Ga0123353_10008225 Ga0123353_100082252 293
112 3300042621 Ga0466729_000541 Ga0466729_000541_455_1336 293
113 3300042652 Ga0466708_348418 Ga0466708_348418_1521_2402 293
114 iso_pr_bacteria 2781125666 2781344246 294
115 3300002462 JGI24702J35022_10077794 JGI24702J35022_100777942 295
116 3300002462 JGI24702J35022_10138706 JGI24702J35022_101387062 295
117 3300042605 Ga0466716_087657 Ga0466716_087657_270_1157 295
118 3300042615 Ga0466711_517121 Ga0466711_517121_3927_4814 295
119 3300042652 Ga0466708_070299 Ga0466708_070299_4218_5105 295
120 3300042619 Ga0466726_289514 Ga0466726_289514_590_1480 296
121 3300042643 Ga0466704_367555 Ga0466704_367555_453_1343 296
122 3300009784 Ga0123357_10111946 Ga0123357_101119462 297
123 3300042614 Ga0466712_301404 Ga0466712_301404_570_1463 297
124 3300002449 JGI24698J34947_10001648 JGI24698J34947_100016485 298
125 3300005200 Ga0072940_1206369 Ga0072940_12063695 299

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00528 BPD_transp_1 Binding-protein-dependent transport system inner membrane component 98 269 0.87

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.83 0.87 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.