Protein Family IF11944

Metagenome Isolate
140 Members
74 Samples
102 Scaffolds
650.99 Avg Length

🧬 Representative Sequence

ID
iso_pr_bacteria|2820111668|2820112383|
Length
735 aa
Sequence
MASFSRTVQTTDSERLAKGATKSPASPFKLSSHYEPKGDQPQAIEKLLLGLAQGDQHQVLLGITGSGKTFTVANVIAKVGRPTLIIAPNKTLAAQLYGEMKELFPENAVEYFVSYYDYYQPEAYVPTSDTYIDKDAIVNDQIDRMRHAATRALLSRHDVIIVASVSCIYGIGSAESYQGLLIDLSVNEEFRRDNLLRMLVDIQYERNDIDFHRGTFRVRGDIVEVFPAYESDTAVRIEFFGDTIEAIKEVDPIRGRVKDSLDRYAIFPGSHYVTPQEQMRRAIVEIRDELRDRLDFFDKEGRFLEKQRLEQRTLYDIEMMEQMGFCNGIENYSRHLSGRKAEEPPPTLVDYFPKDFLLILDESHQTVPQIGAMFRGDRARKETLVEYGFRLPSALDNRPLKFEEFEQHIHRCIHVSATPGDYELGRAQGAFVEQVIRPTGLMDPVVEVRPVAGQVDDLLVEIRDRASKNERVLCTTLTKRMAEDLTDYYRELGVRIRYLHSDIDTLERIDILRDLRLGEFDVLVGINLLREGLDLPEVSLVAIFDADKEGFLRSPRSLIQTIGRAARNVSGRVIMYADSITPAMKNAIDETNRRRVIQEKYNTEHGIIPATVIRAVMNINPASGTMDYFEIPKVPKAGGKGGKGDRAPINVSEQIPSMRAEMFTAAENLEFERAAKLRDEIKRLEALAGDSSSVDAGDIGYDPYAAAPKRKSAKTSRTSRASPTKKTGARGRWKR

📊 Sample Types

Isolate 27.1%
Metagenome 72.9%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 50.0%
Termitidae 23.0%
Kalotermitidae 12.2%
Termopsidae 4.1%
Rhinotermitidae 2.7%
Formicidae 2.7%
Passalidae 1.4%
Dytiscidae 1.4%
Apidae 1.4%
Vespidae 1.4%

🌳 Taxonomy

Archaea 0
Bacteria 134
Eukaryota 0
Viruses 0
Unclassified 6

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820265624 Unclassified Firmicutes Th196P3bin36 Isolate Unclassified
2 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
3 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
4 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
5 2820240463 Unclassified Firmicutes Th196P3bin85 Isolate Unclassified
6 2820246658 Unclassified Firmicutes Th196P3bin70 Isolate Unclassified
7 2820580397 Unclassified Firmicutes Emb289P3bin133 Isolate Unclassified
8 2820637417 Unclassified Firmicutes Emb289P1bin108 Isolate Unclassified
9 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
10 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
11 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
12 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
13 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
14 2820111668 Unclassified Proteobacteria Emb289P4bin34 Isolate Unclassified
15 2820261600 Unclassified Firmicutes Th196P3bin40 Isolate Unclassified
16 2820272499 Unclassified Firmicutes Th196P3bin18 Isolate Unclassified
17 2820282995 Unclassified Firmicutes Th196P3bin147 Isolate Unclassified
18 2820344559 Unclassified Firmicutes Nt197P3bin63 Isolate Unclassified
19 2820400448 Unclassified Firmicutes Nc150Mbin1 Isolate Unclassified
20 2987233858 Stutzerimonas stutzeri AR9-4 Isolate Unclassified
21 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
22 2841821538 Psychrobacter sp. YP14 Isolate Unclassified
23 2873584433 Vagococcus coleopterorum HDW17A Isolate Dytiscidae
24 2820106212 Unclassified Proteobacteria Emb289P4bin44 Isolate Unclassified
25 2820249082 Unclassified Firmicutes Th196P3bin69 Isolate Unclassified
26 2820280018 Unclassified Firmicutes Th196P3bin149 Isolate Unclassified
27 2820290662 Unclassified Firmicutes Th196P3bin135 Isolate Unclassified
28 2820353569 Unclassified Firmicutes Nt197P3bin28 Isolate Unclassified
29 2820661146 Unclassified Firmicutes Co191P3bin61 Isolate Unclassified
30 2820707375 Unclassified Firmicutes Co191P1bin31 Isolate Unclassified
31 2820155744 Unclassified Proteobacteria Cu122P5bin24 Isolate Unclassified
32 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
33 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
34 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
35 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
36 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
37 2820563109 Unclassified Firmicutes Emb289P3bin58 Isolate Unclassified
38 2820587002 Unclassified Firmicutes Emb289P1bin94 Isolate Unclassified
39 2820690275 Unclassified Firmicutes Co191P1bin72 Isolate Unclassified
40 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
41 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
42 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
43 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
44 2528768159 Alteromonadaceae bacterium Bs31 Isolate Unclassified
45 2820292184 Unclassified Firmicutes Th196P3bin109 Isolate Unclassified
46 2820666966 Unclassified Firmicutes Co191P3bin39 Isolate Unclassified
47 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
48 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
49 2820422691 Unclassified Firmicutes Lab288P3bin58 Isolate Unclassified
50 2820442516 Unclassified Firmicutes Lab288P3bin200 Isolate Unclassified
51 2820488713 Unclassified Firmicutes Lab288P1bin69 Isolate Unclassified
52 2820533259 Unclassified Firmicutes Lab288P1bin140 Isolate Unclassified
53 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
54 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
55 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
56 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
57 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
58 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
59 3003178663 Psychrobacter fulvigenes KC-40 Isolate Unclassified
60 3006156446 Acinetobacter baretiae B10A Isolate Apidae
61 2881375749 Vagococcus entomophilus DSM 24756 Isolate Vespidae
62 2820546020 Unclassified Firmicutes Lab288P1bin102 Isolate Unclassified
63 2820620956 Unclassified Firmicutes Emb289P1bin128 Isolate Unclassified
64 2820626145 Unclassified Firmicutes Emb289P1bin123 Isolate Unclassified
65 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
66 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
67 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
68 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
69 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
70 3300002931 Ant worker gut metagenome for colony PL010 Metagenome Formicidae
71 3300002934 Ant worker gut metagenome for colony PL005 Metagenome Formicidae
72 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
73 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
74 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466728_335614 3300042620 Bacteria 10430
2 Ga0123355_10000913 3300009826 Bacteria 40903
3 Ga0123355_10003376 3300009826 Bacteria 22874
4 Ga0123355_10027403 3300009826 Bacteria 9203
5 Ga0123356_10000405 3300010049 Bacteria 49129
6 Ga0123353_10000511 3300010167 Bacteria 48051
7 Ga0123353_10022105 3300010167 Bacteria 9573
8 Ga0123353_10309810 3300010167 Bacteria 2404
9 JGI24695J34938_10001118 3300002450 Bacteria 24171
10 JGI24702J35022_10006350 3300002462 Bacteria 6834
11 Ga0466697_121715 3300042611 Bacteria 2766
12 Ga0466716_099578 3300042605 Bacteria 3093
13 Ga0466721_037876 3300042608 Unclassified 7090
14 Ga0466721_171557 3300042608 Bacteria 3315
15 Ga0123355_10000759 3300009826 Bacteria 44075
16 Ga0123355_10002475 3300009826 Bacteria 26149
17 Ga0123356_10033956 3300010049 Bacteria 4771
18 Ga0123356_10093394 3300010049 Bacteria 2871
19 Ga0123356_10108100 3300010049 Bacteria 2681
20 JGI24695J34938_10003731 3300002450 Bacteria 10405
21 Ga0415639_001085 3300038395 Bacteria 60940
22 Ga0466726_173114 3300042619 Bacteria 17281
23 Ga0123355_10037425 3300009826 Bacteria 7890
24 Ga0123356_10003018 3300010049 Bacteria 17778
25 Ga0123356_10017812 3300010049 Bacteria 6748
26 Ga0123356_10036488 3300010049 Bacteria 4590
27 Ga0123356_10089964 3300010049 Bacteria 2921
28 Ga0123356_10102433 3300010049 Unclassified 2748
29 Ga0123353_10114114 3300010167 Bacteria 4349
30 Ga0123353_10199189 3300010167 Bacteria 3152
31 Ga0123354_10084234 3300010882 Unclassified 4467
32 Ga0466703_150166 3300042636 Bacteria 26236
33 Ga0466708_176529 3300042652 Bacteria 8576
34 Ga0123357_10000210 3300009784 Bacteria 54869
35 Ga0466733_094048 3300042659 Bacteria 3765
36 Ga0466690_042053 3300042590 Bacteria 23081
37 Ga0466696_180269 3300042596 Bacteria 4131
38 Ga0466705_474281 3300042612 Bacteria 9022
39 Ga0466715_115573 3300042616 Bacteria 6967
40 Ga0466726_233550 3300042619 Bacteria 17997
41 Ga0123355_10017997 3300009826 Bacteria 11190
42 Ga0123355_10028815 3300009826 Bacteria 8981
43 Ga0123356_10056959 3300010049 Bacteria 3642
44 Ga0123353_10114386 3300010167 Bacteria 4344
45 Ga0123354_10204942 3300010882 Bacteria 2153
46 Ga0466730_037491 3300042625 Bacteria 1958
47 Ga0466727_245681 3300042655 Bacteria 65513
48 Ga0123357_10000069 3300009784 Bacteria 84342
49 Ga0466707_273324 3300042601 Bacteria 19540
50 Ga0466714_019530 3300042603 Bacteria 14374
51 Ga0123355_10000068 3300009826 Bacteria 110792
52 Ga0123356_10010255 3300010049 Bacteria 9214
53 Ga0123356_10010391 3300010049 Bacteria 9136
54 Ga0123356_10048424 3300010049 Bacteria 3956
55 Ga0123356_10055238 3300010049 Unclassified 3699
56 Ga0123353_10003478 3300010167 Bacteria 19905
57 Ga0123353_10045660 3300010167 Bacteria 6955
58 Ga0123353_10051184 3300010167 Bacteria 6590
59 Ga0123353_10228332 3300010167 Bacteria 2904
60 JGI24695J34938_10020158 3300002450 Unclassified 3286
61 Ga0466714_143709 3300042603 Bacteria 12218
62 Ga0466722_218979 3300042609 Bacteria 21124
63 Ga0466715_343453 3300042616 Bacteria 22114
64 Ga0123355_10204825 3300009826 Bacteria 2873
65 Ga0123356_10000010 3300010049 Bacteria 220063
66 Ga0123356_10001848 3300010049 Bacteria 22947
67 Ga0123356_10001891 3300010049 Bacteria 22696
68 Ga0123353_10006247 3300010167 Bacteria 15839
69 Ga0123353_10043731 3300010167 Bacteria 7097
70 Ga0123353_10184147 3300010167 Bacteria 3303
71 CVPL005W_1000236 3300002934 Bacteria 24542
72 Ga0466700_210474 3300042600 Bacteria 75558
73 Ga0123356_10002283 3300010049 Bacteria 20651
74 Ga0123356_10035969 3300010049 Bacteria 4624
75 Ga0123356_10080722 3300010049 Bacteria 3076
76 Ga0123353_10193211 3300010167 Bacteria 3210
77 Ga0466735_180902 3300042624 Bacteria 56754
78 Ga0466725_048442 3300042654 Bacteria 2463
79 2227219689 2225789004 Bacteria 32782
80 Ga0466732_376663 3300042656 Bacteria 38993
81 Ga0415639_020119 3300038395 Bacteria 10047
82 Ga0466690_154811 3300042590 Bacteria 17895
83 Ga0466693_090723 3300042592 Bacteria 3783
84 Ga0466691_058352 3300042593 Bacteria 18356
85 Ga0466707_039662 3300042601 Bacteria 10567
86 Ga0466707_047035 3300042601 Bacteria 25395
87 Ga0466707_106253 3300042601 Bacteria 108878
88 Ga0466713_116879 3300042602 Bacteria 19083
89 Ga0466714_150935 3300042603 Bacteria 85449
90 Ga0466721_294824 3300042608 Bacteria 3799
91 Ga0466722_105882 3300042609 Bacteria 8946
92 Ga0466729_012995 3300042621 Bacteria 9162
93 Ga0123355_10001594 3300009826 Bacteria 31632
94 Ga0123355_10002415 3300009826 Bacteria 26398
95 Ga0123356_10008219 3300010049 Bacteria 10384
96 Ga0123356_10118041 3300010049 Bacteria 2575
97 Ga0123353_10011952 3300010167 Bacteria 12281
98 Ga0123353_10091841 3300010167 Unclassified 4890
99 Ga0123353_10328830 3300010167 Bacteria 2315
100 Ga0123353_10339448 3300010167 Bacteria 2269
101 CVPL010W_10004428 3300002931 Bacteria 15584
102 Ga0123357_10000084 3300009784 Bacteria 75651

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042625 Ga0466730_037491 Ga0466730_037491_254_1948 564
2 3300042654 Ga0466725_048442 Ga0466725_048442_590_2410 584
3 iso_pr_bacteria 2820290662 2820292078 584
4 3300002450 JGI24695J34938_10020158 JGI24695J34938_100201582 603
5 3300010049 Ga0123356_10118041 Ga0123356_101180412 607
6 iso_pr_bacteria 2820546020 2820547405 619
7 3300010049 Ga0123356_10056959 Ga0123356_100569593 624
8 3300010049 Ga0123356_10102433 Ga0123356_101024332 624
9 3300042612 Ga0466705_474281 Ga0466705_474281_976_2961 625
10 3300010049 Ga0123356_10001848 Ga0123356_1000184817 626
11 3300010167 Ga0123353_10328830 Ga0123353_103288302 626
12 3300010049 Ga0123356_10010391 Ga0123356_100103913 627
13 3300009826 Ga0123355_10037425 Ga0123355_100374258 628
14 3300010049 Ga0123356_10093394 Ga0123356_100933942 628
15 3300010167 Ga0123353_10006247 Ga0123353_1000624711 628
16 3300042601 Ga0466707_047035 Ga0466707_047035_22136_24073 628
17 3300010167 Ga0123353_10114114 Ga0123353_101141143 629
18 3300010167 Ga0123353_10184147 Ga0123353_101841472 629
19 3300010167 Ga0123353_10199189 Ga0123353_101991892 629
20 3300010049 Ga0123356_10003018 Ga0123356_100030189 630
21 3300010049 Ga0123356_10010255 Ga0123356_100102556 630
22 3300010049 Ga0123356_10048424 Ga0123356_100484243 630
23 3300010167 Ga0123353_10003478 Ga0123353_100034787 630
24 3300010167 Ga0123353_10091841 Ga0123353_100918414 630
25 3300010167 Ga0123353_10228332 Ga0123353_102283322 630
26 3300010167 Ga0123353_10339448 Ga0123353_103394482 630
27 3300042608 Ga0466721_037876 Ga0466721_037876_5118_7076 630
28 3300002450 JGI24695J34938_10001118 JGI24695J34938_1000111813 631
29 3300010049 Ga0123356_10108100 Ga0123356_101081002 631
30 3300010167 Ga0123353_10309810 Ga0123353_103098101 631
31 3300010167 Ga0123353_10011952 Ga0123353_100119529 632
32 3300010049 Ga0123356_10080722 Ga0123356_100807222 633
33 3300010167 Ga0123353_10193211 Ga0123353_101932112 633
34 3300042608 Ga0466721_171557 Ga0466721_171557_15_1973 633
35 3300009826 Ga0123355_10002415 Ga0123355_1000241523 634
36 3300009826 Ga0123355_10000759 Ga0123355_100007594 635
37 3300010167 Ga0123353_10000511 Ga0123353_1000051128 635
38 3300042655 Ga0466727_245681 Ga0466727_245681_49340_51310 635
39 3300010882 Ga0123354_10084234 Ga0123354_100842343 636
40 3300010049 Ga0123356_10035969 Ga0123356_100359692 637
41 3300010049 Ga0123356_10008219 Ga0123356_100082196 638
42 3300010882 Ga0123354_10204942 Ga0123354_102049421 638
43 3300042590 Ga0466690_042053 Ga0466690_042053_20240_22225 638
44 3300042609 Ga0466722_218979 Ga0466722_218979_15439_17445 638
45 3300009826 Ga0123355_10000068 Ga0123355_1000006836 639
46 3300010049 Ga0123356_10001891 Ga0123356_1000189113 639
47 3300042602 Ga0466713_116879 Ga0466713_116879_14402_16378 639
48 3300042596 Ga0466696_180269 Ga0466696_180269_1460_3421 641
49 3300042608 Ga0466721_294824 Ga0466721_294824_219_2177 645
50 3300042593 Ga0466691_058352 Ga0466691_058352_6348_8318 648
51 3300042601 Ga0466707_273324 Ga0466707_273324_1505_3478 648
52 3300042619 Ga0466726_173114 Ga0466726_173114_1977_3923 648
53 3300042621 Ga0466729_012995 Ga0466729_012995_4304_6310 649
54 iso_pr_bacteria 2820620956 2820622280 651
55 3300009826 Ga0123355_10003376 Ga0123355_1000337614 652
56 3300042624 Ga0466735_180902 Ga0466735_180902_14496_16454 652
57 iso_pr_bacteria 2820442516 2820443790 652
58 3300002462 JGI24702J35022_10006350 JGI24702J35022_100063504 653
59 3300009826 Ga0123355_10001594 Ga0123355_1000159424 653
60 3300010049 Ga0123356_10000010 Ga0123356_1000001092 653
61 3300010167 Ga0123353_10022105 Ga0123353_100221056 653
62 3300010167 Ga0123353_10043731 Ga0123353_100437313 653
63 3300010167 Ga0123353_10045660 Ga0123353_100456602 653
64 3300010167 Ga0123353_10051184 Ga0123353_100511842 653
65 3300010167 Ga0123353_10114386 Ga0123353_101143863 653
66 3300042605 Ga0466716_099578 Ga0466716_099578_628_2589 653
67 3300042616 Ga0466715_343453 Ga0466715_343453_12778_14739 653
68 iso_pr_bacteria 2820240463 2820241900 653
69 iso_pr_bacteria 2820246658 2820247018 653
70 iso_pr_bacteria 2820282995 2820284386 653
71 iso_pr_bacteria 2820587002 2820589577 653
72 2225789004 2227219689 2227652098 654
73 3300010049 Ga0123356_10002283 Ga0123356_100022839 654
74 3300038395 Ga0415639_020119 Ga0415639_020119_2546_4510 654
75 3300042603 Ga0466714_019530 Ga0466714_019530_5685_7649 654
76 3300042603 Ga0466714_143709 Ga0466714_143709_5640_7604 654
77 iso_pr_bacteria 2820661146 2820662237 654
78 iso_pr_bacteria 2820690275 2820691174 654
79 iso_pr_bacteria 2820707375 2820708083 654
80 3300042600 Ga0466700_210474 Ga0466700_210474_51715_53682 655
81 iso_pr_bacteria 2820249082 2820249289 655
82 iso_pr_bacteria 2820261600 2820262853 655
83 3300009826 Ga0123355_10027403 Ga0123355_100274033 656
84 3300009826 Ga0123355_10204825 Ga0123355_102048252 656
85 3300042620 Ga0466728_335614 Ga0466728_335614_7657_9627 656
86 3300042652 Ga0466708_176529 Ga0466708_176529_1947_3917 656
87 iso_pr_bacteria 2820292184 2820292222 656
88 iso_pr_bacteria 2820488713 2820489253 656
89 iso_pr_bacteria 2820533259 2820533422 656
90 iso_pr_bacteria 2820563109 2820564436 656
91 iso_pr_bacteria 2820637417 2820638749 656
92 3300002934 CVPL005W_1000236 CVPL005W_10002363 657
93 3300009826 Ga0123355_10000913 Ga0123355_100009131 657
94 3300009826 Ga0123355_10017997 Ga0123355_100179972 657
95 3300010049 Ga0123356_10000405 Ga0123356_1000040539 657
96 3300010049 Ga0123356_10033956 Ga0123356_100339562 657
97 3300010049 Ga0123356_10036488 Ga0123356_100364882 657
98 3300010049 Ga0123356_10055238 Ga0123356_100552382 657
99 3300042601 Ga0466707_106253 Ga0466707_106253_55196_57169 657
100 3300042603 Ga0466714_150935 Ga0466714_150935_57505_59478 657
101 iso_pr_bacteria 2820265624 2820266739 657
102 3300010049 Ga0123356_10017812 Ga0123356_100178126 658
103 3300010049 Ga0123356_10089964 Ga0123356_100899642 658
104 3300042609 Ga0466722_105882 Ga0466722_105882_6188_8164 658
105 3300042636 Ga0466703_150166 Ga0466703_150166_19895_21901 658
106 3300042656 Ga0466732_376663 Ga0466732_376663_36236_38212 658
107 iso_pr_bacteria 2820272499 2820274612 658
108 iso_pr_bacteria 2820626145 2820626552 658
109 3300009826 Ga0123355_10028815 Ga0123355_100288152 659
110 3300042659 Ga0466733_094048 Ga0466733_094048_71_2050 659
111 iso_pr_bacteria 2820422691 2820423491 660
112 3300038395 Ga0415639_001085 Ga0415639_001085_49413_51398 661
113 iso_pr_bacteria 2820400448 2820400977 661
114 iso_pr_bacteria 2820353569 2820356839 663
115 iso_pr_bacteria 2881375749 2881376955 664
116 iso_pr_bacteria 2820280018 2820280315 665
117 iso_pr_bacteria 2820344559 2820345245 665
118 iso_pr_bacteria 2873584433 2873585740 665
119 iso_pr_bacteria 2820580397 2820580848 666
120 3300042590 Ga0466690_154811 Ga0466690_154811_14936_16942 668
121 3300042619 Ga0466726_233550 Ga0466726_233550_10595_12607 670
122 iso_pr_bacteria 2528768159 2529055785 670
123 iso_pr_bacteria 3006156446 3006158898 670
124 3300042611 Ga0466697_121715 Ga0466697_121715_341_2422 671
125 iso_pr_bacteria 2820155744 2820155787 671
126 iso_pr_bacteria 2987233858 2987235802 671
127 3300042616 Ga0466715_115573 Ga0466715_115573_2577_4610 677
128 3300009784 Ga0123357_10000069 Ga0123357_1000006910 682
129 3300009826 Ga0123355_10002475 Ga0123355_1000247515 682
130 iso_pr_bacteria 2820666966 2820668800 690
131 3300002450 JGI24695J34938_10003731 JGI24695J34938_100037319 691
132 3300009784 Ga0123357_10000084 Ga0123357_100000846 696
133 3300042601 Ga0466707_039662 Ga0466707_039662_7806_9899 697
134 iso_pr_bacteria 3003178663 3003179656 703
135 iso_pr_bacteria 2841821538 2841822978 705
136 iso_pr_bacteria 2820106212 2820108107 706
137 3300009784 Ga0123357_10000210 Ga0123357_1000021016 707
138 3300042592 Ga0466693_090723 Ga0466693_090723_669_2822 709
139 3300002931 CVPL010W_10004428 CVPL010W_1000442810 717
140 iso_pr_bacteria 2820111668 2820112383 735

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF17757 UvrB_inter UvrB interaction domain 182 272 0.99
PF12344 UvrB Ultra-violet resistance protein B 575 616 0.98
PF02151 UVR UvrB/uvrC motif 653 686 0.94
PF00271 Helicase_C Helicase conserved C-terminal domain 458 568 0.9
PF04851 ResIII Type III restriction enzyme, res subunit 35 110 0.83
PF00270 DEAD DEAD/DEAH box helicase 39 107 0.82

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF02151 GO:0005515 protein binding MF

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.81 0.89 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.