Protein Family IF11925

Metagenome Isolate
222 Members
58 Samples
203 Scaffolds
392.11 Avg Length

🧬 Representative Sequence

ID
iso_pr_bacteria|2820020240|2820021146|
Length
444 aa
Sequence
MNRKFTDVFFKHLFSIVALFSVLALGAILLFVFVHGSIPFFVPTSPDIRLXAQRIDELTVNGVEYIDHSTFINIPKNTDVISIKFPVSGMLWEDDDEXYDDDYEEEDYENEDNVDYDDSDYASYEEADEYDDYDEKTYEETLEIVINQNEKDPEKKLTFICGEDVKVTYPESYVYTVSWPAAISALEKRIHVILPEPPYSFGRXLTGLQWHXSRDKIYGIFPMIAGTLLASFGAILLGVXVALLCALFMSEFLPLKLASVARAGIEMLAGIPSVVYGFFGLMVIVPFIKSTFNVPSGNTLLSAIIVLALMILPTVITXXETSLRAVPLEVREASLALGASKMQTAWRVVLPHANSXVIAGIILGISRAVGETMAVIXVAGNSXQLTXNPLASIRTLTSTIXMEMGYASGRHSEMLFSIGVTLFIIILILNSLILWYRRRMEQEL

📊 Sample Types

Isolate 8.6%
Metagenome 91.4%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 42.9%
Unclassified 30.4%
Kalotermitidae 23.2%
Rhinotermitidae 3.6%

🌳 Taxonomy

Archaea 0
Bacteria 211
Eukaryota 0
Viruses 0
Unclassified 11

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125641 Treponema sp. Co191P1bin27 Isolate Unclassified
2 2781125647 Treponema sp. Co191P3bin16 Isolate Unclassified
3 3300005485 Termite gut microbial communities from Costa Rica - P3 luminal contents Metagenome Termitidae
4 2781125657 Treponema sp. Emb289P3bin15 Isolate Unclassified
5 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
6 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
7 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
8 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
9 2819992462 Unclassified Spirochaetes Nc150P4bin14 Isolate Unclassified
10 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
11 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
12 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
13 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
14 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
15 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
16 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
17 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
18 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
19 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
20 2781125661 Treponema sp. Emb289P3bin69 Isolate Unclassified
21 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
22 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
23 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
24 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
25 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
26 3300002507 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 Metagenome Termitidae
27 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
28 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
29 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
30 2781125644 Treponema sp. Co191P3bin12 Isolate Unclassified
31 2781125645 Treponema sp. Co191P3bin32 Isolate Unclassified
32 2781125663 Treponema sp. Emb289P3bin135 Isolate Unclassified
33 2781125665 Treponema sp. Emb289P3bin117 Isolate Unclassified
34 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
35 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
36 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
37 2781125634 Treponema sp. Co191P1bin45 Isolate Unclassified
38 2781125658 Treponema sp. Emb289P3bin37 Isolate Unclassified
39 2781125695 Treponema sp. Th196P4bin30 Isolate Unclassified
40 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
41 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
42 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
43 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
44 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
45 2781125635 Treponema sp. Co191P1bin60 Isolate Unclassified
46 2820020240 Unclassified Spirochaetes Nc150P3bin10 Isolate Unclassified
47 2781125648 Treponema sp. Co191P3bin70 Isolate Unclassified
48 2781125650 Treponema sp. Co191P3bin64 Isolate Unclassified
49 2781125664 Treponema sp. Emb289P3bin139 Isolate Unclassified
50 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
51 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
52 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
53 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
54 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
55 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
56 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
57 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
58 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_068501 3300042612 Bacteria 16865
2 Ga0466732_123457 3300042656 Bacteria 1563
3 Ga0466732_152703 3300042656 Bacteria 7013
4 Ga0123356_10005940 3300010049 Bacteria 12391
5 Ga0466712_015925 3300042614 Bacteria 11922
6 Ga0466712_021239 3300042614 Bacteria 11782
7 Ga0466712_121516 3300042614 Bacteria 3369
8 Ga0466712_183286 3300042614 Bacteria 15136
9 Ga0466711_001519 3300042615 Bacteria 36988
10 Ga0466711_067350 3300042615 Bacteria 9913
11 Ga0466718_037580 3300042617 Bacteria 5402
12 Ga0264413_102956 3300024493 Bacteria 4454
13 Ga0415639_005305 3300038395 Bacteria 16909
14 Ga0415639_031475 3300038395 Bacteria 6713
15 Ga0466693_034950 3300042592 Bacteria 1713
16 Ga0466693_272908 3300042592 Bacteria 38745
17 Ga0466717_194607 3300042604 Bacteria 2151
18 Ga0466716_246398 3300042605 Bacteria 5630
19 Ga0466720_052911 3300042607 Bacteria 5009
20 Ga0466720_080343 3300042607 Bacteria 15819
21 Ga0466720_099143 3300042607 Unclassified 3134
22 Ga0466720_115567 3300042607 Bacteria 8267
23 Ga0466708_408137 3300042652 Bacteria 19449
24 AustNasuHG_c1009637 3300000089 Bacteria 3384
25 JGI24698J34947_10003481 3300002449 Bacteria 8542
26 JGI24695J34938_10024576 3300002450 Bacteria 2892
27 Ga0072941_1075284 3300005201 Bacteria 2817
28 Ga0072941_1121765 3300005201 Bacteria 1793
29 Ga0074263_103272 3300005485 Bacteria 1438
30 Ga0074263_113014 3300005485 Bacteria 4185
31 Ga0123356_10003195 3300010049 Bacteria 17219
32 Ga0123356_10004321 3300010049 Bacteria 14697
33 Ga0123356_10005713 3300010049 Bacteria 12635
34 Ga0123356_10008085 3300010049 Bacteria 10473
35 Ga0466712_059856 3300042614 Bacteria 35187
36 Ga0466694_005840 3300042594 Bacteria 106514
37 Ga0466694_036096 3300042594 Bacteria 7424
38 Ga0466699_228025 3300042597 Bacteria 6350
39 Ga0466701_063335 3300042598 Bacteria 1459
40 Ga0466719_377405 3300042606 Bacteria 15588
41 Ga0466720_017016 3300042607 Unclassified 8594
42 Ga0466721_313968 3300042608 Bacteria 20613
43 Ga0466702_123252 3300042635 Bacteria 9310
44 Ga0466704_477329 3300042643 Bacteria 7960
45 JGI24698J34947_10001106 3300002449 Bacteria 13894
46 JGI24698J34947_10005998 3300002449 Unclassified 6668
47 JGI24697J35500_11273592 3300002507 Bacteria 5803
48 Ga0072941_1002396 3300005201 Bacteria 20668
49 Ga0123356_10021016 3300010049 Unclassified 6174
50 Ga0466712_028680 3300042614 Bacteria 4216
51 Ga0466718_080283 3300042617 Bacteria 3782
52 Ga0466692_031291 3300042591 Bacteria 27627
53 Ga0466692_151326 3300042591 Bacteria 19337
54 Ga0466694_089443 3300042594 Bacteria 8323
55 Ga0466694_207034 3300042594 Bacteria 2507
56 Ga0466699_124136 3300042597 Bacteria 3984
57 Ga0466699_148910 3300042597 Bacteria 1644
58 Ga0466699_439410 3300042597 Bacteria 2354
59 Ga0466719_171770 3300042606 Bacteria 28729
60 Ga0466720_142060 3300042607 Bacteria 3573
61 Ga0466721_162213 3300042608 Bacteria 3519
62 Ga0466698_012103 3300042610 Bacteria 1453
63 Ga0466703_110457 3300042636 Bacteria 13852
64 Ga0466709_320356 3300042648 Bacteria 9795
65 Ga0466708_099906 3300042652 Bacteria 39915
66 Ga0466708_365027 3300042652 Bacteria 4283
67 AustNasuHG_c1002869 3300000089 Bacteria 6225
68 AustNasuHG_c1002957 3300000089 Bacteria 6121
69 Ga0072941_1006601 3300005201 Bacteria 4621
70 Ga0072941_1009209 3300005201 Bacteria 4943
71 Ga0072941_1033337 3300005201 Bacteria 11508
72 Ga0072941_1038715 3300005201 Bacteria 2135
73 Ga0072941_1052254 3300005201 Bacteria 1687
74 Ga0466705_167823 3300042612 Bacteria 13302
75 Ga0466732_303487 3300042656 Bacteria 11255
76 Ga0123356_10000349 3300010049 Bacteria 53319
77 Ga0123356_10124165 3300010049 Bacteria 2517
78 Ga0123353_10741297 3300010167 Bacteria 1369
79 Ga0466711_016357 3300042615 Bacteria 16773
80 Ga0466715_065498 3300042616 Bacteria 1960
81 Ga0466718_052515 3300042617 Bacteria 9284
82 Ga0466718_057114 3300042617 Bacteria 6416
83 Ga0466718_143443 3300042617 Bacteria 1359
84 Ga0466723_173320 3300042618 Bacteria 3515
85 Ga0466728_148113 3300042620 Bacteria 8996
86 Ga0264413_110967 3300024493 Bacteria 2019
87 Ga0466694_006403 3300042594 Bacteria 53277
88 Ga0466695_068957 3300042595 Bacteria 62949
89 Ga0466699_052562 3300042597 Bacteria 9226
90 Ga0466699_070030 3300042597 Bacteria 21782
91 Ga0466699_081058 3300042597 Bacteria 20204
92 Ga0466699_182753 3300042597 Bacteria 2613
93 Ga0466722_105401 3300042609 Bacteria 4522
94 Ga0466731_092789 3300042622 Bacteria 3050
95 Ga0466702_036543 3300042635 Bacteria 2757
96 AustNasuHG_c1004235 3300000089 Bacteria 5150
97 JGI24698J34947_10004050 3300002449 Bacteria 7962
98 JGI24698J34947_10017644 3300002449 Bacteria 3865
99 JGI24698J34947_10030155 3300002449 Bacteria 2861
100 JGI24698J34947_10061405 3300002449 Unclassified 1850
101 JGI24695J34938_10000368 3300002450 Bacteria 44588
102 JGI24695J34938_10001867 3300002450 Bacteria 17119
103 JGI24695J34938_10004340 3300002450 Bacteria 9341
104 Ga0072940_1027797 3300005200 Bacteria 5524
105 Ga0072940_1029838 3300005200 Bacteria 3537
106 Ga0072941_1002428 3300005201 Bacteria 2853
107 Ga0072941_1009285 3300005201 Bacteria 25402
108 Ga0466705_094242 3300042612 Bacteria 12722
109 Ga0123356_10033779 3300010049 Bacteria 4784
110 Ga0123356_10040637 3300010049 Bacteria 4333
111 Ga0466712_008558 3300042614 Bacteria 10675
112 Ga0466712_018438 3300042614 Bacteria 2345
113 Ga0466712_298591 3300042614 Bacteria 10678
114 Ga0466715_081043 3300042616 Bacteria 8728
115 Ga0466718_045669 3300042617 Bacteria 6335
116 Ga0466718_057716 3300042617 Bacteria 8922
117 Ga0466718_142630 3300042617 Bacteria 1718
118 Ga0466694_143437 3300042594 Bacteria 2027
119 Ga0466696_212544 3300042596 Bacteria 2654
120 Ga0466699_180575 3300042597 Bacteria 1881
121 Ga0466716_297812 3300042605 Bacteria 3058
122 Ga0466720_027749 3300042607 Bacteria 6026
123 Ga0466720_222083 3300042607 Unclassified 3161
124 Ga0466702_100956 3300042635 Bacteria 39373
125 Ga0466709_316324 3300042648 Bacteria 2314
126 AustNasuHG_c1000144 3300000089 Bacteria 22319
127 AustNasuHG_c1006968 3300000089 Bacteria 4028
128 JGI24695J34938_10000035 3300002450 Bacteria 102136
129 JGI24695J34938_10002750 3300002450 Bacteria 12940
130 JGI24695J34938_10012382 3300002450 Bacteria 4522
131 JGI24695J34938_10015375 3300002450 Bacteria 3928
132 JGI24695J34938_10037339 3300002450 Bacteria 2208
133 Ga0072941_1002394 3300005201 Bacteria 13768
134 Ga0072941_1006567 3300005201 Bacteria 21410
135 Ga0466732_169638 3300042656 Bacteria 2427
136 Ga0123356_10002571 3300010049 Bacteria 19353
137 Ga0123356_10014331 3300010049 Bacteria 7626
138 Ga0123356_10014814 3300010049 Bacteria 7488
139 Ga0123353_10060205 3300010167 Unclassified 6089
140 Ga0466712_224330 3300042614 Unclassified 11429
141 Ga0466723_114181 3300042618 Bacteria 4072
142 Ga0264413_102957 3300024493 Bacteria 2951
143 Ga0466699_066428 3300042597 Bacteria 5342
144 Ga0466699_268122 3300042597 Bacteria 3584
145 Ga0466719_071293 3300042606 Bacteria 1940
146 Ga0466720_122506 3300042607 Bacteria 2936
147 Ga0466720_129874 3300042607 Bacteria 9649
148 Ga0466722_070145 3300042609 Bacteria 18780
149 Ga0466731_012920 3300042622 Bacteria 154202
150 Ga0466702_218285 3300042635 Bacteria 19292
151 Ga0466702_459393 3300042635 Bacteria 1788
152 Ga0466708_102890 3300042652 Bacteria 21227
153 Ga0466708_112549 3300042652 Bacteria 1601
154 AustNasuHG_c1002947 3300000089 Bacteria 6131
155 AustNasuHG_c1008050 3300000089 Bacteria 3735
156 JGI24698J34947_10000067 3300002449 Bacteria 32875
157 JGI24698J34947_10041240 3300002449 Bacteria 2378
158 JGI24695J34938_10000098 3300002450 Bacteria 76790
159 JGI24695J34938_10000369 3300002450 Bacteria 44536
160 Ga0072941_1059661 3300005201 Bacteria 4304
161 Ga0072941_1138958 3300005201 Bacteria 3190
162 Ga0074263_113384 3300005485 Bacteria 1532
163 Ga0466732_393270 3300042656 Bacteria 2620
164 Ga0123356_10000299 3300010049 Bacteria 57073
165 Ga0123356_10002033 3300010049 Bacteria 21839
166 Ga0123356_10058742 3300010049 Unclassified 3587
167 Ga0466712_000555 3300042614 Unclassified 6675
168 Ga0466712_285453 3300042614 Bacteria 11443
169 Ga0466711_103257 3300042615 Bacteria 20144
170 Ga0466718_120716 3300042617 Bacteria 5164
171 Ga0466728_170570 3300042620 Bacteria 3007
172 Ga0466692_000604 3300042591 Bacteria 5406
173 Ga0466693_028114 3300042592 Bacteria 110002
174 Ga0466694_052650 3300042594 Bacteria 20998
175 Ga0466700_447284 3300042600 Bacteria 1885
176 Ga0466720_059050 3300042607 Bacteria 4179
177 JGI24698J34947_10007146 3300002449 Bacteria 6135
178 JGI24698J34947_10026600 3300002449 Bacteria 3074
179 JGI24695J34938_10005716 3300002450 Bacteria 7674
180 Ga0072940_1027796 3300005200 Bacteria 3802
181 Ga0072941_1014135 3300005201 Bacteria 4308
182 Ga0072941_1028753 3300005201 Bacteria 17830
183 Ga0123356_10000999 3300010049 Bacteria 31384
184 Ga0466711_330658 3300042615 Bacteria 2669
185 Ga0466718_033184 3300042617 Bacteria 15825
186 Ga0264413_117454 3300024493 Bacteria 4047
187 Ga0466692_169137 3300042591 Bacteria 4872
188 Ga0466692_182376 3300042591 Bacteria 6508
189 Ga0466691_158366 3300042593 Bacteria 7798
190 Ga0466694_024253 3300042594 Bacteria 20540
191 Ga0466716_335328 3300042605 Bacteria 10635
192 Ga0466708_017794 3300042652 Bacteria 11629
193 Ga0466708_114331 3300042652 Bacteria 7788
194 Ga0466708_119761 3300042652 Bacteria 5167
195 JGI24698J34947_10009835 3300002449 Bacteria 5245
196 JGI24698J34947_10020555 3300002449 Unclassified 3554
197 JGI24698J34947_10020757 3300002449 Bacteria 3537
198 JGI24695J34938_10000935 3300002450 Bacteria 26639
199 JGI24695J34938_10003138 3300002450 Bacteria 11769
200 Ga0072941_1002429 3300005201 Bacteria 39736
201 Ga0072941_1003272 3300005201 Bacteria 13396
202 Ga0072941_1018360 3300005201 Bacteria 13367
203 Ga0074263_101293 3300005485 Bacteria 4007

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042656 Ga0466732_393270 Ga0466732_393270_1585_2550 321
2 3300042594 Ga0466694_089443 Ga0466694_089443_4684_5874 360
3 3300000089 AustNasuHG_c1002947 AustNasuHG_10029473 361
4 3300010049 Ga0123356_10058742 Ga0123356_100587422 363
5 3300042656 Ga0466732_169638 Ga0466732_169638_1041_2225 363
6 3300000089 AustNasuHG_c1008050 AustNasuHG_10080502 364
7 3300002449 JGI24698J34947_10009835 JGI24698J34947_100098353 365
8 3300042592 Ga0466693_034950 Ga0466693_034950_552_1679 365
9 3300010049 Ga0123356_10003195 Ga0123356_100031959 368
10 3300010049 Ga0123356_10124165 Ga0123356_101241652 368
11 3300005201 Ga0072941_1059661 Ga0072941_10596612 369
12 3300010049 Ga0123356_10014331 Ga0123356_100143311 373
13 3300042635 Ga0466702_459393 Ga0466702_459393_108_1301 373
14 3300042652 Ga0466708_112549 Ga0466708_112549_223_1344 373
15 3300042652 Ga0466708_365027 Ga0466708_365027_2825_3946 373
16 3300042591 Ga0466692_151326 Ga0466692_151326_880_2058 374
17 3300042622 Ga0466731_012920 Ga0466731_012920_123774_125099 374
18 3300042597 Ga0466699_070030 Ga0466699_070030_3185_4378 375
19 3300042605 Ga0466716_335328 Ga0466716_335328_5878_7053 375
20 3300042616 Ga0466715_081043 Ga0466715_081043_5024_6220 375
21 3300010049 Ga0123356_10002571 Ga0123356_100025719 376
22 3300042609 Ga0466722_070145 Ga0466722_070145_14444_15631 376
23 3300042614 Ga0466712_285453 Ga0466712_285453_1580_2770 376
24 3300042648 Ga0466709_320356 Ga0466709_320356_2852_4051 376
25 3300042652 Ga0466708_119761 Ga0466708_119761_1823_3025 377
26 3300005201 Ga0072941_1033337 Ga0072941_103333713 379
27 iso_pr_bacteria 2781125644 2781296891 379
28 3300042614 Ga0466712_028680 Ga0466712_028680_2040_3182 380
29 3300005201 Ga0072941_1003272 Ga0072941_10032724 381
30 3300042597 Ga0466699_182753 Ga0466699_182753_153_1340 381
31 3300042648 Ga0466709_316324 Ga0466709_316324_1005_2198 381
32 3300042652 Ga0466708_408137 Ga0466708_408137_12199_13392 382
33 3300005201 Ga0072941_1002428 Ga0072941_10024282 383
34 3300005201 Ga0072941_1006601 Ga0072941_10066012 383
35 3300005201 Ga0072941_1028753 Ga0072941_102875312 383
36 3300005201 Ga0072941_1075284 Ga0072941_10752842 383
37 3300005201 Ga0072941_1138958 Ga0072941_11389584 383
38 3300005485 Ga0074263_101293 Ga0074263_1012932 383
39 3300042600 Ga0466700_447284 Ga0466700_447284_539_1750 383
40 3300042607 Ga0466720_222083 Ga0466720_222083_403_1596 383
41 3300042614 Ga0466712_008558 Ga0466712_008558_9361_10551 383
42 3300005201 Ga0072941_1014135 Ga0072941_10141354 384
43 3300005485 Ga0074263_103272 Ga0074263_1032721 384
44 3300042594 Ga0466694_005840 Ga0466694_005840_39217_40431 384
45 3300042595 Ga0466695_068957 Ga0466695_068957_35397_36584 384
46 3300042604 Ga0466717_194607 Ga0466717_194607_498_1685 384
47 3300042614 Ga0466712_059856 Ga0466712_059856_29257_30474 384
48 3300042635 Ga0466702_100956 Ga0466702_100956_114_1301 384
49 3300042591 Ga0466692_031291 Ga0466692_031291_14663_15889 385
50 3300042594 Ga0466694_006403 Ga0466694_006403_37502_38692 385
51 3300042594 Ga0466694_024253 Ga0466694_024253_10979_12169 385
52 3300042594 Ga0466694_036096 Ga0466694_036096_2869_4071 385
53 3300042597 Ga0466699_052562 Ga0466699_052562_1177_2367 385
54 3300042597 Ga0466699_066428 Ga0466699_066428_3369_4559 385
55 3300042597 Ga0466699_081058 Ga0466699_081058_15094_16284 385
56 3300042597 Ga0466699_124136 Ga0466699_124136_2625_3815 385
57 3300042597 Ga0466699_148910 Ga0466699_148910_287_1477 385
58 3300042597 Ga0466699_228025 Ga0466699_228025_4068_5258 385
59 3300042597 Ga0466699_268122 Ga0466699_268122_2087_3277 385
60 3300042607 Ga0466720_017016 Ga0466720_017016_874_2064 385
61 3300042614 Ga0466712_000555 Ga0466712_000555_1718_2908 385
62 3300042614 Ga0466712_015925 Ga0466712_015925_3919_5109 385
63 3300042614 Ga0466712_018438 Ga0466712_018438_554_1744 385
64 3300042614 Ga0466712_183286 Ga0466712_183286_597_1787 385
65 3300042617 Ga0466718_033184 Ga0466718_033184_4134_5324 385
66 3300042617 Ga0466718_052515 Ga0466718_052515_5876_7066 385
67 3300042617 Ga0466718_057716 Ga0466718_057716_7324_8514 385
68 3300042617 Ga0466718_142630 Ga0466718_142630_359_1549 385
69 3300042620 Ga0466728_170570 Ga0466728_170570_947_2119 385
70 3300042656 Ga0466732_123457 Ga0466732_123457_341_1531 385
71 3300000089 AustNasuHG_c1002869 AustNasuHG_10028694 386
72 3300000089 AustNasuHG_c1002957 AustNasuHG_10029573 386
73 3300002449 JGI24698J34947_10017644 JGI24698J34947_100176444 386
74 3300002449 JGI24698J34947_10020555 JGI24698J34947_100205554 386
75 3300002449 JGI24698J34947_10030155 JGI24698J34947_100301552 386
76 3300002449 JGI24698J34947_10061405 JGI24698J34947_100614052 386
77 3300002507 JGI24697J35500_11273592 JGI24697J35500_112735923 386
78 3300005201 Ga0072941_1002396 Ga0072941_100239612 386
79 3300005201 Ga0072941_1006567 Ga0072941_10065675 386
80 3300042597 Ga0466699_180575 Ga0466699_180575_34_1296 386
81 3300042607 Ga0466720_052911 Ga0466720_052911_772_2115 386
82 3300042614 Ga0466712_021239 Ga0466712_021239_8166_9359 386
83 3300042614 Ga0466712_224330 Ga0466712_224330_9426_10619 386
84 3300042614 Ga0466712_298591 Ga0466712_298591_1253_2446 386
85 3300000089 AustNasuHG_c1006968 AustNasuHG_10069682 387
86 3300002449 JGI24698J34947_10005998 JGI24698J34947_100059986 387
87 3300002449 JGI24698J34947_10026600 JGI24698J34947_100266002 387
88 3300005201 Ga0072941_1009285 Ga0072941_100928519 387
89 3300005201 Ga0072941_1038715 Ga0072941_10387152 387
90 3300042607 Ga0466720_027749 Ga0466720_027749_2895_4241 387
91 3300042607 Ga0466720_059050 Ga0466720_059050_1977_3185 387
92 3300042607 Ga0466720_099143 Ga0466720_099143_1679_2887 387
93 3300042610 Ga0466698_012103 Ga0466698_012103_67_1257 387
94 3300042615 Ga0466711_067350 Ga0466711_067350_3475_4668 387
95 3300005201 Ga0072941_1002394 Ga0072941_10023942 388
96 3300005201 Ga0072941_1002429 Ga0072941_100242932 388
97 3300005201 Ga0072941_1018360 Ga0072941_101836013 388
98 3300024493 Ga0264413_110967 Ga0264413_1109672 388
99 3300042591 Ga0466692_169137 Ga0466692_169137_1378_2574 388
100 3300042592 Ga0466693_028114 Ga0466693_028114_56583_57782 388
101 3300042614 Ga0466712_121516 Ga0466712_121516_1079_2278 388
102 3300000089 AustNasuHG_c1009637 AustNasuHG_10096372 389
103 3300002449 JGI24698J34947_10020757 JGI24698J34947_100207575 389
104 3300005201 Ga0072941_1009209 Ga0072941_10092092 389
105 3300005201 Ga0072941_1052254 Ga0072941_10522541 389
106 3300024493 Ga0264413_102956 Ga0264413_1029564 389
107 3300042607 Ga0466720_122506 Ga0466720_122506_840_2030 389
108 3300042622 Ga0466731_092789 Ga0466731_092789_1041_2243 389
109 3300042656 Ga0466732_303487 Ga0466732_303487_4451_5653 389
110 3300002450 JGI24695J34938_10037339 JGI24695J34938_100373392 390
111 3300010049 Ga0123356_10040637 Ga0123356_100406375 390
112 3300042591 Ga0466692_182376 Ga0466692_182376_3108_4298 390
113 3300042617 Ga0466718_120716 Ga0466718_120716_857_2179 390
114 3300042652 Ga0466708_099906 Ga0466708_099906_5117_6373 390
115 3300005200 Ga0072940_1027797 Ga0072940_10277976 391
116 3300042594 Ga0466694_207034 Ga0466694_207034_50_1366 391
117 3300010167 Ga0123353_10741297 Ga0123353_107412972 392
118 iso_pr_bacteria 2781125665 2781341496 392
119 3300002449 JGI24698J34947_10004050 JGI24698J34947_100040507 393
120 3300002450 JGI24695J34938_10024576 JGI24695J34938_100245762 393
121 3300010049 Ga0123356_10000349 Ga0123356_1000034935 393
122 3300042635 Ga0466702_036543 Ga0466702_036543_533_1750 394
123 3300042635 Ga0466702_123252 Ga0466702_123252_6008_7225 394
124 iso_pr_bacteria 2781125657 2781324160 394
125 3300000089 AustNasuHG_c1000144 AustNasuHG_100014412 395
126 3300002450 JGI24695J34938_10003138 JGI24695J34938_100031387 395
127 3300005201 Ga0072941_1121765 Ga0072941_11217652 395
128 3300010049 Ga0123356_10002033 Ga0123356_1000203311 395
129 3300042594 Ga0466694_143437 Ga0466694_143437_773_1960 395
130 3300042609 Ga0466722_105401 Ga0466722_105401_2515_3702 395
131 3300042615 Ga0466711_001519 Ga0466711_001519_5822_7009 395
132 3300042617 Ga0466718_037580 Ga0466718_037580_2814_4139 395
133 3300000089 AustNasuHG_c1004235 AustNasuHG_10042352 396
134 3300024493 Ga0264413_117454 Ga0264413_1174545 396
135 3300042596 Ga0466696_212544 Ga0466696_212544_186_1376 396
136 3300042605 Ga0466716_246398 Ga0466716_246398_456_1646 396
137 3300042606 Ga0466719_171770 Ga0466719_171770_13650_14840 396
138 3300042617 Ga0466718_045669 Ga0466718_045669_2798_3988 396
139 3300042617 Ga0466718_057114 Ga0466718_057114_857_2185 396
140 3300042617 Ga0466718_143443 Ga0466718_143443_147_1337 396
141 3300042618 Ga0466723_173320 Ga0466723_173320_297_1487 396
142 iso_pr_bacteria 2781125658 2781325700 396
143 iso_pr_bacteria 2781125663 2781338705 396
144 3300002449 JGI24698J34947_10007146 JGI24698J34947_100071465 397
145 3300010049 Ga0123356_10014814 Ga0123356_100148145 397
146 3300010049 Ga0123356_10021016 Ga0123356_100210162 397
147 3300038395 Ga0415639_031475 Ga0415639_031475_3314_4540 397
148 3300042598 Ga0466701_063335 Ga0466701_063335_180_1373 397
149 3300042605 Ga0466716_297812 Ga0466716_297812_810_2003 397
150 3300042608 Ga0466721_162213 Ga0466721_162213_1893_3086 397
151 3300042608 Ga0466721_313968 Ga0466721_313968_8917_10158 397
152 3300042615 Ga0466711_016357 Ga0466711_016357_4742_5935 397
153 3300042652 Ga0466708_017794 Ga0466708_017794_2253_3446 397
154 3300042652 Ga0466708_114331 Ga0466708_114331_4522_5715 397
155 3300042656 Ga0466732_152703 Ga0466732_152703_488_1681 397
156 3300010049 Ga0123356_10008085 Ga0123356_100080856 398
157 3300038395 Ga0415639_005305 Ga0415639_005305_14449_15645 398
158 3300042592 Ga0466693_272908 Ga0466693_272908_8186_9382 398
159 3300042606 Ga0466719_071293 Ga0466719_071293_503_1699 398
160 3300042607 Ga0466720_142060 Ga0466720_142060_609_1805 398
161 3300042612 Ga0466705_094242 Ga0466705_094242_3930_5126 398
162 3300042616 Ga0466715_065498 Ga0466715_065498_361_1557 398
163 3300042618 Ga0466723_114181 Ga0466723_114181_1109_2305 398
164 iso_pr_bacteria 2781125634 2781274204 398
165 iso_pr_bacteria 2781125644 2781296961 398
166 iso_pr_bacteria 2781125647 2781302606 398
167 3300002449 JGI24698J34947_10001106 JGI24698J34947_100011062 399
168 3300002450 JGI24695J34938_10000098 JGI24695J34938_1000009848 399
169 3300002450 JGI24695J34938_10001867 JGI24695J34938_1000186714 399
170 3300002450 JGI24695J34938_10004340 JGI24695J34938_100043407 399
171 3300042607 Ga0466720_129874 Ga0466720_129874_1202_2428 399
172 3300042612 Ga0466705_068501 Ga0466705_068501_7958_9157 399
173 3300010049 Ga0123356_10005713 Ga0123356_1000571310 400
174 3300042591 Ga0466692_000604 Ga0466692_000604_2663_3865 400
175 3300042593 Ga0466691_158366 Ga0466691_158366_5515_6717 400
176 3300042615 Ga0466711_330658 Ga0466711_330658_1276_2529 400
177 iso_pr_bacteria 2781125650 2781309010 400
178 3300002449 JGI24698J34947_10041240 JGI24698J34947_100412401 401
179 3300002450 JGI24695J34938_10012382 JGI24695J34938_100123824 401
180 3300005200 Ga0072940_1029838 Ga0072940_10298383 401
181 iso_pr_bacteria 2781125695 2781437613 401
182 3300002450 JGI24695J34938_10000935 JGI24695J34938_1000093517 402
183 3300024493 Ga0264413_102957 Ga0264413_1029573 402
184 3300002450 JGI24695J34938_10000368 JGI24695J34938_1000036823 403
185 3300002450 JGI24695J34938_10005716 JGI24695J34938_100057166 404
186 3300002450 JGI24695J34938_10015375 JGI24695J34938_100153754 404
187 3300010049 Ga0123356_10000299 Ga0123356_1000029947 404
188 3300042615 Ga0466711_103257 Ga0466711_103257_2834_4048 404
189 3300042617 Ga0466718_080283 Ga0466718_080283_1658_2944 404
190 3300005200 Ga0072940_1027796 Ga0072940_10277962 405
191 3300010049 Ga0123356_10000999 Ga0123356_1000099924 405
192 3300002449 JGI24698J34947_10000067 JGI24698J34947_100000674 406
193 3300002450 JGI24695J34938_10002750 JGI24695J34938_1000275010 407
194 3300042594 Ga0466694_052650 Ga0466694_052650_4077_5342 407
195 iso_pr_bacteria 2781125635 2781276956 407
196 iso_pr_bacteria 2781125645 2781297690 407
197 3300002450 JGI24695J34938_10000035 JGI24695J34938_100000355 408
198 3300042607 Ga0466720_115567 Ga0466720_115567_1129_2355 408
199 iso_pr_bacteria 2781125648 2781304907 408
200 3300002450 JGI24695J34938_10000369 JGI24695J34938_1000036916 409
201 3300005485 Ga0074263_113384 Ga0074263_1133842 409
202 3300042635 Ga0466702_218285 Ga0466702_218285_7206_8471 410
203 iso_pr_bacteria 2781125665 2781341339 410
204 3300010167 Ga0123353_10060205 Ga0123353_100602054 411
205 3300042606 Ga0466719_377405 Ga0466719_377405_10065_11300 411
206 3300002449 JGI24698J34947_10003481 JGI24698J34947_100034819 412
207 3300042607 Ga0466720_080343 Ga0466720_080343_1211_2449 412
208 iso_pr_bacteria 2781125661 2781333273 412
209 iso_pr_bacteria 2781125664 2781340847 412
210 3300005485 Ga0074263_113014 Ga0074263_1130145 413
211 3300042612 Ga0466705_167823 Ga0466705_167823_6383_7624 413
212 3300042597 Ga0466699_439410 Ga0466699_439410_880_2127 415
213 3300010049 Ga0123356_10005940 Ga0123356_1000594013 416
214 3300010049 Ga0123356_10004321 Ga0123356_100043219 419
215 3300010049 Ga0123356_10033779 Ga0123356_100337792 421
216 3300042620 Ga0466728_148113 Ga0466728_148113_4676_5941 421
217 3300042643 Ga0466704_477329 Ga0466704_477329_5802_7073 423
218 iso_pr_bacteria 2781125641 2781290840 423
219 3300042652 Ga0466708_102890 Ga0466708_102890_6846_8159 437
220 3300042636 Ga0466703_110457 Ga0466703_110457_8089_9480 441
221 iso_pr_bacteria 2819992462 2819993902 444
222 iso_pr_bacteria 2820020240 2820021146 444

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00528 BPD_transp_1 Binding-protein-dependent transport system inner membrane component 244 441 0.83

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.78 0.86 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.