Protein Family IF11921

Metagenome Isolate
158 Members
110 Samples
100 Scaffolds
264.72 Avg Length

🧬 Representative Sequence

ID
iso_pr_bacteria|2820004052|2820004277|
Length
303 aa
Sequence
LEEQESVVSQDAVQEESGNPENEEGQTLEKEEPKIPEKEKAHVIVVTSGKGGVGKTTSTSNIAVALAKLGKKVVAVDADIGLRNLDVVMGLENRVVYNFVDVLEGNCRLNQALVRDKRVDQLYLLPAAQTRTKDAVNQEQMIKLCDMLRDEFDYILLDCPAGIEGGFKNAAVGADEALIVVTPEVPSVRDADRIIGMLESMGKSPIRLIVNRIRPDMVRGGDMLDVPDIIEILAIGLIGIVPEDDNVIKAANRGEPMAFSNKAPAAQAYMNIAGRILGNDVPFLNLDTKPRGLLGNIKKILGM

📊 Sample Types

Isolate 36.7%
Metagenome 63.3%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 31.1%
Termitidae 21.7%
Kalotermitidae 11.3%
Blattidae 8.5%
Elmidae 3.8%
Scarabaeidae 2.8%
Armadillidiidae 2.8%
Noctuidae 2.8%
Drosophilidae 1.9%
Rhinotermitidae 1.9%
Apidae 1.9%
Termopsidae 1.9%
Nephropidae 0.9%
Stratiomyidae 0.9%
Tenebrionidae 0.9%
Hodotermitidae 0.9%
Penaeidae 0.9%
Formicidae 0.9%
Passalidae 0.9%
Euphausiidae 0.9%

🌳 Taxonomy

Archaea 0
Bacteria 153
Eukaryota 0
Viruses 0
Unclassified 5

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2731957677 Alkalihalobacillus trypoxylicola NBRC 102646 Isolate Scarabaeidae
2 2767802234 Cytobacillus kochii BDGP4 Isolate Drosophilidae
3 2820353569 Unclassified Firmicutes Nt197P3bin28 Isolate Unclassified
4 2820364642 Unclassified Firmicutes Nt197P3bin107 Isolate Unclassified
5 2820713307 Unclassified Firmicutes Co191P1bin2 Isolate Unclassified
6 2940406939 Paenibacillus sp. PastM-3 Isolate Blattidae
7 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
8 651324002 Acetonema longum APO-1, DSM 6540 Isolate Kalotermitidae
9 8043041867 Bacillus pumilus Ha06YP001 Isolate Nephropidae
10 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
11 3300012834 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG Metagenome
12 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
13 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
14 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
15 2819999932 Unclassified Synergistetes Th196P4bin51 Isolate Unclassified
16 2820350530 Unclassified Firmicutes Nt197P3bin37 Isolate Unclassified
17 2820481688 Unclassified Firmicutes Lab288P1bin76 Isolate Unclassified
18 2855361764 Lysinibacillus fusiformis Juneja Isolate Drosophilidae
19 2864909992 Bacillus velezensis S00166 Isolate Elmidae
20 2940400224 Paenibacillus sp. PastM-2 Isolate Blattidae
21 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
22 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
23 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
24 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
25 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
26 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
27 3300002507 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 Metagenome Termitidae
28 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
29 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
30 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
31 2791355481 Bacillus sp. ZY-1-1 Isolate Scarabaeidae
32 2820312173 Unclassified Firmicutes Nt197P4bin8 Isolate Unclassified
33 2820398208 Unclassified Firmicutes Nc150P1bin1 Isolate Unclassified
34 2820469612 Unclassified Firmicutes Lab288P1bin92 Isolate Unclassified
35 2834951433 Brochothrix thermosphacta CD 337 Isolate Unclassified
36 2843246524 Lysinibacillus sphaericus DSM 28 Isolate Unclassified
37 2864895409 Bacillus aerius S00152 Isolate Elmidae
38 2916858470 Heyndrickxia oleronia Isolate Unclassified
39 2940221333 Paenibacillus sp. PastF-3 Isolate Blattidae
40 2940425923 Paenibacillus sp. PastH-4 Isolate Blattidae
41 8030343600 Proteiniborus sp. MB09-C3 Isolate Stratiomyidae
42 2983866074 Paenibacillus polymyxa A18 Isolate Unclassified
43 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
44 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
45 3300012837 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG Metagenome Armadillidiidae
46 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
47 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
48 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
49 2209111004 Macrotermes natalensis queen gut microbiome Metagenome Termitidae
50 2820004052 Unclassified Synergistetes Nt197P3bin25 Isolate Unclassified
51 2827179085 Paenibacillus alvei DSM 29 Isolate Apidae
52 2852123468 Lysinibacillus sphaericus KCCM 35418 Isolate Unclassified
53 2940419646 Paenibacillus sp. PastF-4 Isolate Blattidae
54 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
55 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
56 3300056564 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) Metagenome Tenebrionidae
57 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
58 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
59 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
60 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
61 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
62 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
63 2820327087 Unclassified Firmicutes Nt197P3bin79 Isolate Unclassified
64 2820401926 Unclassified Firmicutes Mp193P1bin2 Isolate Unclassified
65 2820459456 Unclassified Firmicutes Lab288P3bin148 Isolate Unclassified
66 2820528380 Unclassified Firmicutes Lab288P1bin143 Isolate Unclassified
67 2852337885 Paenibacillus protaetiae FW100M-2 Isolate Scarabaeidae
68 2864981449 Sporosarcina sp. S00266 Isolate Elmidae
69 2940380068 Paenibacillus sp. PastH-2 Isolate Blattidae
70 2940413413 Paenibacillus sp. PastH-3 Isolate Blattidae
71 8064008355 Heyndrickxia oleronia Isolate Unclassified
72 8082023105 Niallia sp. Man26 Isolate Penaeidae
73 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
74 2524614537 Lysinibacillus sphaericus OT4b.31 Isolate Unclassified
75 2751185832 Lysinibacillus sp. AR18-8 Isolate Unclassified
76 2820005795 Unclassified Synergistetes Nt197P3bin106 Isolate Unclassified
77 2820008971 Unclassified Synergistetes Lab288P3bin103 Isolate Unclassified
78 2890957088 Psychrobacillus lasiicapitis NEAU-3TGS17 Isolate Formicidae
79 2940386776 Paenibacillus sp. PastF-1 Isolate Blattidae
80 2971438493 Paenibacillus apiarius NRRL B-23460 Isolate Apidae
81 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
82 3300012841 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG Metagenome Armadillidiidae
83 3300012847 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG Metagenome Armadillidiidae
84 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
85 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
86 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
87 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
88 2820356982 Unclassified Firmicutes Nt197P3bin19 Isolate Unclassified
89 2820439761 Unclassified Firmicutes Lab288P3bin203 Isolate Unclassified
90 2820565217 Unclassified Firmicutes Emb289P3bin51 Isolate Unclassified
91 2864801025 Bacillus aerius S00042 Isolate Elmidae
92 2940393498 Paenibacillus sp. PastF-2 Isolate Blattidae
93 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
94 3300007733 Gill chamber microbial communities of deep-sea hydrothermal vent shrimp from South Atlantic Ocean Metagenome
95 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
96 2551306396 Paenibacillus sp. ICGEB2008 Isolate Noctuidae
97 2574180310 Bacillus licheniformis CG-B52 Isolate Unclassified
98 2622736579 Desemzia incerta DSM 20581 Isolate Unclassified
99 2820369699 Unclassified Firmicutes Nt197P3bin103 Isolate Unclassified
100 2035265002 Agrotis sp. gut microbial communities from Texas A and M University, USA Metagenome Noctuidae
101 2900804455 Listeria sp. PSOL-1 Marseille-P4284 Isolate Unclassified
102 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
103 8002519755 Planococcus sp. MSAK28401 Isolate Euphausiidae
104 3300002501 Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 Metagenome Termitidae
105 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
106 3300012814 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG Metagenome
107 3300003097 Cutworm gut microbial communities from Hangzhou, China Metagenome Noctuidae
108 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
109 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
110 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466731_099474 3300042622 Bacteria 3192
2 Ga0123357_10404220 3300009784 Bacteria 1239
3 Ga0123355_10000069 3300009826 Bacteria 109930
4 Ga0123356_10028272 3300010049 Bacteria 5253
5 Ga0466656_017416 3300042550 Bacteria 2207
6 Ga0466706_235324 3300042599 Bacteria 4464
7 JGI24697J35500_11272124 3300002507 Bacteria 4803
8 Ga0466729_277079 3300042621 Bacteria 6672
9 Ga0466731_000114 3300042622 Bacteria 3956
10 Ga0466704_482059 3300042643 Bacteria 1055
11 Ga0123355_10034253 3300009826 Bacteria 8251
12 Ga0123356_10019908 3300010049 Bacteria 6356
13 Ga0160444_116514 3300012841 Bacteria 841
14 Ga0466694_216246 3300042594 Bacteria 3247
15 Ga0466706_013581 3300042599 Bacteria 2826
16 Ga0466706_059794 3300042599 Bacteria 8358
17 Ga0466706_238936 3300042599 Bacteria 1273
18 Ga0466717_170841 3300042604 Bacteria 6176
19 2211830526 2209111004 Bacteria 25086
20 Ga0466705_464781 3300042612 Unclassified 22005
21 Ga0466715_010717 3300042616 Bacteria 24838
22 Ga0466726_459743 3300042619 Bacteria 2573
23 Ga0466734_023933 3300042623 Bacteria 1066
24 Ga0123355_10096219 3300009826 Bacteria 4677
25 Ga0123355_10367935 3300009826 Bacteria 1886
26 Ga0160452_100480 3300012834 Bacteria 26661
27 Ga0466707_026924 3300042601 Bacteria 1442
28 Ga0466707_423372 3300042601 Bacteria 7354
29 Ga0466719_262340 3300042606 Bacteria 3124
30 Ga0068305_10004896 3300005083 Bacteria 18292
31 Ga0072940_1484483 3300005200 Bacteria 1225
32 Ga0466697_198760 3300042611 Bacteria 7959
33 Ga0466711_040755 3300042615 Bacteria 16989
34 Ga0466704_436948 3300042643 Bacteria 1860
35 Ga0466709_068776 3300042648 Bacteria 148378
36 Ga0466727_179590 3300042655 Bacteria 18826
37 Ga0123357_10282862 3300009784 Bacteria 1710
38 Ga0123355_10215693 3300009826 Bacteria 2771
39 Ga0123353_10579904 3300010167 Bacteria 1609
40 Ga0160445_101164 3300012847 Bacteria 8170
41 Ga0466694_357441 3300042594 Bacteria 5766
42 Ga0466722_138341 3300042609 Bacteria 84934
43 JGI24703J35330_11562341 3300002501 Bacteria 1256
44 JGI24705J35276_12238817 3300002504 Bacteria 232340
45 Ga0466705_338429 3300042612 Bacteria 1460
46 Ga0466715_229067 3300042616 Bacteria 8164
47 Ga0466728_255537 3300042620 Bacteria 51069
48 Ga0466729_152338 3300042621 Bacteria 104951
49 Ga0123353_10141991 3300010167 Bacteria 3845
50 Ga0123353_10941754 3300010167 Bacteria 1170
51 Ga0160452_100181 3300012834 Bacteria 71782
52 Ga0160455_102000 3300012837 Bacteria 4843
53 Ga0466690_062986 3300042590 Bacteria 21835
54 Ga0466694_070517 3300042594 Bacteria 1413
55 Ga0466696_231199 3300042596 Bacteria 1453
56 Ga0466716_192066 3300042605 Bacteria 5407
57 Ga0466719_404864 3300042606 Bacteria 2896
58 Ga0466697_030714 3300042611 Bacteria 5712
59 JGI24705J35276_12221812 3300002504 Bacteria 2370
60 JGI24705J35276_12238566 3300002504 Bacteria 26902
61 JGI24705J35276_12238723 3300002504 Bacteria 45356
62 Ga0466705_271379 3300042612 Bacteria 5133
63 Ga0530661_000001 3300056564 Bacteria 684835
64 Ga0466715_392047 3300042616 Bacteria 6357
65 Ga0466715_413313 3300042616 Bacteria 3840
66 Ga0466718_099223 3300042617 Bacteria 4076
67 Ga0123355_10112618 3300009826 Bacteria 4246
68 Ga0123355_10249728 3300009826 Bacteria 2500
69 Ga0123354_10052380 3300010882 Bacteria 6149
70 Ga0466706_001339 3300042599 Bacteria 59214
71 Ga0466722_183673 3300042609 Bacteria 1625
72 CwormDRAF_NODE_3409_len_5032_cov_190_581482 2035265002 Bacteria 5062
73 IMNBL1DRAFT_c0002525 3300000062 Bacteria 12673
74 IMNBL1DRAFT_c0010526 3300000062 Bacteria 4413
75 Ga0052191_101970 3300003097 Unclassified 5062
76 Ga0068305_10325553 3300005083 Bacteria 1627
77 Ga0105524_101199 3300007733 Bacteria 4135
78 Ga0466705_330170 3300042612 Bacteria 5261
79 Ga0466732_091585 3300042656 Bacteria 45413
80 Ga0466730_070274 3300042625 Bacteria 1352
81 Ga0466703_374114 3300042636 Unclassified 1816
82 Ga0466725_393218 3300042654 Bacteria 1233
83 Ga0123355_10000163 3300009826 Bacteria 81520
84 Ga0123355_10000761 3300009826 Bacteria 43990
85 Ga0123355_10088265 3300009826 Bacteria 4926
86 Ga0123353_10005204 3300010167 Bacteria 17009
87 Ga0466657_020985 3300042582 Bacteria 4183
88 Ga0466707_014061 3300042601 Bacteria 2670
89 Ga0466705_116336 3300042612 Bacteria 6866
90 Ga0466733_059913 3300042659 Bacteria 7456
91 Ga0123355_10335456 3300009826 Bacteria 2020
92 Ga0123355_10399677 3300009826 Unclassified 1773
93 Ga0123356_10033065 3300010049 Bacteria 4837
94 Ga0123353_10051823 3300010167 Bacteria 6550
95 Ga0123353_10109926 3300010167 Bacteria 4441
96 Ga0160453_100836 3300012814 Bacteria 16178
97 Ga0466707_014324 3300042601 Bacteria 12983
98 Ga0466717_105600 3300042604 Unclassified 5179
99 JGI24702J35022_10000581 3300002462 Bacteria 22183
100 Ga0072941_1122178 3300005201 Bacteria 10197

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042606 Ga0466719_404864 Ga0466719_404864_20_682 211
2 3300042606 Ga0466719_262340 Ga0466719_262340_502_1224 240
3 3300009784 Ga0123357_10404220 Ga0123357_104042201 244
4 3300002504 JGI24705J35276_12238817 JGI24705J35276_1223881729 245
5 3300042599 Ga0466706_001339 Ga0466706_001339_37856_38593 245
6 3300005200 Ga0072940_1484483 Ga0072940_14844831 246
7 3300009784 Ga0123357_10282862 Ga0123357_102828623 246
8 3300042601 Ga0466707_014061 Ga0466707_014061_946_1686 246
9 3300042599 Ga0466706_013581 Ga0466706_013581_383_1216 248
10 3300042616 Ga0466715_413313 Ga0466715_413313_1251_1997 248
11 3300042617 Ga0466718_099223 Ga0466718_099223_1021_1815 248
12 3300009826 Ga0123355_10399677 Ga0123355_103996773 251
13 3300010167 Ga0123353_10141991 Ga0123353_101419913 252
14 3300042604 Ga0466717_105600 Ga0466717_105600_1433_2227 252
15 3300002504 JGI24705J35276_12221812 JGI24705J35276_122218122 253
16 3300010167 Ga0123353_10005204 Ga0123353_1000520411 257
17 2035265002 CwormDRAF_NODE_3409_len_5032_cov_190_581482 CwormDRAFT_144870 259
18 3300042599 Ga0466706_238936 Ga0466706_238936_10_789 259
19 3300003097 Ga0052191_101970 Ga0052191_1019705 260
20 3300005201 Ga0072941_1122178 Ga0072941_11221787 261
21 3300009826 Ga0123355_10096219 Ga0123355_100962193 261
22 3300042612 Ga0466705_464781 Ga0466705_464781_19046_19849 261
23 3300042643 Ga0466704_436948 Ga0466704_436948_723_1526 261
24 3300042616 Ga0466715_229067 Ga0466715_229067_255_1061 262
25 iso_pr_bacteria 2820398208 2820400279 262
26 3300042596 Ga0466696_231199 Ga0466696_231199_258_1049 263
27 3300042599 Ga0466706_059794 Ga0466706_059794_1776_2567 263
28 3300042601 Ga0466707_423372 Ga0466707_423372_5371_6162 263
29 3300042604 Ga0466717_170841 Ga0466717_170841_5247_6038 263
30 3300042612 Ga0466705_330170 Ga0466705_330170_3831_4622 263
31 3300042621 Ga0466729_152338 Ga0466729_152338_75858_76649 263
32 3300042636 Ga0466703_374114 Ga0466703_374114_688_1479 263
33 3300042648 Ga0466709_068776 Ga0466709_068776_24552_25343 263
34 iso_pr_bacteria 2820369699 2820371754 263
35 iso_pr_bacteria 2820439761 2820440517 263
36 iso_pr_bacteria 2820565217 2820566087 263
37 iso_pr_bacteria 2852337885 2852338082 263
38 iso_pr_bacteria 651324002 651578707 263
39 3300000062 IMNBL1DRAFT_c0010526 IMNBL1DRAFT_00105262 264
40 3300002501 JGI24703J35330_11562341 JGI24703J35330_115623412 264
41 3300005083 Ga0068305_10004896 Ga0068305_1000489612 264
42 3300009826 Ga0123355_10000069 Ga0123355_10000069109 264
43 3300009826 Ga0123355_10000761 Ga0123355_1000076129 264
44 3300009826 Ga0123355_10034253 Ga0123355_100342535 264
45 3300009826 Ga0123355_10335456 Ga0123355_103354562 264
46 3300010049 Ga0123356_10033065 Ga0123356_100330656 264
47 3300010167 Ga0123353_10109926 Ga0123353_101099263 264
48 3300012814 Ga0160453_100836 Ga0160453_10083615 264
49 3300012834 Ga0160452_100181 Ga0160452_10018151 264
50 3300012834 Ga0160452_100480 Ga0160452_1004805 264
51 3300012837 Ga0160455_102000 Ga0160455_1020006 264
52 3300012847 Ga0160445_101164 Ga0160445_10116410 264
53 3300042550 Ga0466656_017416 Ga0466656_017416_530_1324 264
54 3300042594 Ga0466694_070517 Ga0466694_070517_277_1071 264
55 3300042594 Ga0466694_216246 Ga0466694_216246_1249_2043 264
56 3300042611 Ga0466697_198760 Ga0466697_198760_4828_5622 264
57 3300042616 Ga0466715_392047 Ga0466715_392047_1914_2708 264
58 3300042622 Ga0466731_099474 Ga0466731_099474_1294_2088 264
59 3300042623 Ga0466734_023933 Ga0466734_023933_41_835 264
60 3300042625 Ga0466730_070274 Ga0466730_070274_514_1308 264
61 3300042654 Ga0466725_393218 Ga0466725_393218_228_1022 264
62 iso_pr_bacteria 2622736579 2623392259 264
63 iso_pr_bacteria 2820312173 2820314144 264
64 iso_pr_bacteria 2820350530 2820352540 264
65 iso_pr_bacteria 2820356982 2820357825 264
66 iso_pr_bacteria 2820364642 2820365776 264
67 iso_pr_bacteria 2820481688 2820482326 264
68 iso_pr_bacteria 2820528380 2820528502 264
69 iso_pr_bacteria 2834951433 2834953091 264
70 iso_pr_bacteria 2940221333 2940226508 264
71 iso_pr_bacteria 2940380068 2940385159 264
72 iso_pr_bacteria 2940386776 2940391927 264
73 iso_pr_bacteria 2940393498 2940398554 264
74 iso_pr_bacteria 2940400224 2940405303 264
75 iso_pr_bacteria 2940406939 2940411889 264
76 iso_pr_bacteria 2940413413 2940419217 264
77 iso_pr_bacteria 2940419646 2940425473 264
78 iso_pr_bacteria 2940425923 2940431752 264
79 iso_pr_bacteria 2971438493 2971443561 264
80 iso_pr_bacteria 8030343600 8030345815 264
81 3300002504 JGI24705J35276_12238566 JGI24705J35276_1223856620 265
82 3300002504 JGI24705J35276_12238723 JGI24705J35276_1223872349 265
83 3300002507 JGI24697J35500_11272124 JGI24697J35500_112721243 265
84 3300005083 Ga0068305_10325553 Ga0068305_103255532 265
85 3300010049 Ga0123356_10028272 Ga0123356_100282723 265
86 3300010882 Ga0123354_10052380 Ga0123354_100523806 265
87 3300012841 Ga0160444_116514 Ga0160444_1165141 265
88 3300042609 Ga0466722_138341 Ga0466722_138341_80091_80888 265
89 3300042612 Ga0466705_338429 Ga0466705_338429_293_1090 265
90 3300042621 Ga0466729_277079 Ga0466729_277079_2117_2914 265
91 3300042659 Ga0466733_059913 Ga0466733_059913_3175_3972 265
92 iso_pr_bacteria 2524614537 2524835312 265
93 iso_pr_bacteria 2551306396 2552922529 265
94 iso_pr_bacteria 2751185832 2753508529 265
95 iso_pr_bacteria 2820353569 2820355191 265
96 iso_pr_bacteria 2820401926 2820402357 265
97 iso_pr_bacteria 2820459456 2820459843 265
98 iso_pr_bacteria 2820469612 2820470672 265
99 iso_pr_bacteria 2827179085 2827182676 265
100 iso_pr_bacteria 2843246524 2843248043 265
101 iso_pr_bacteria 2852123468 2852125778 265
102 iso_pr_bacteria 2855361764 2855363648 265
103 iso_pr_bacteria 2864981449 2864984589 265
104 iso_pr_bacteria 2983866074 2983869899 265
105 3300000062 IMNBL1DRAFT_c0002525 IMNBL1DRAFT_00025255 266
106 3300009826 Ga0123355_10088265 Ga0123355_100882653 266
107 3300009826 Ga0123355_10112618 Ga0123355_101126183 266
108 3300009826 Ga0123355_10215693 Ga0123355_102156933 266
109 3300009826 Ga0123355_10249728 Ga0123355_102497282 266
110 3300009826 Ga0123355_10367935 Ga0123355_103679352 266
111 3300010049 Ga0123356_10019908 Ga0123356_100199083 266
112 3300010167 Ga0123353_10051823 Ga0123353_100518237 266
113 3300042601 Ga0466707_026924 Ga0466707_026924_619_1419 266
114 3300042605 Ga0466716_192066 Ga0466716_192066_2575_3375 266
115 3300042609 Ga0466722_183673 Ga0466722_183673_254_1054 266
116 3300056564 Ga0530661_000001 Ga0530661_000001_315629_316429 266
117 iso_pr_bacteria 2820713307 2820713718 266
118 iso_pr_bacteria 2890957088 2890960388 266
119 3300010167 Ga0123353_10579904 Ga0123353_105799042 267
120 3300042643 Ga0466704_482059 Ga0466704_482059_181_984 267
121 iso_pr_bacteria 2731957677 2732687275 267
122 iso_pr_bacteria 2767802234 2769331506 267
123 iso_pr_bacteria 2791355481 2794424819 267
124 iso_pr_bacteria 2864801025 2864803387 267
125 iso_pr_bacteria 2864895409 2864897769 267
126 iso_pr_bacteria 2864909992 2864912874 267
127 iso_pr_bacteria 2900804455 2900805321 267
128 iso_pr_bacteria 8002519755 8002521348 267
129 iso_pr_bacteria 8043041867 8043042159 267
130 iso_pr_bacteria 8082023105 8082026045 267
131 2209111004 2211830526 2211865478 268
132 3300042599 Ga0466706_235324 Ga0466706_235324_334_1140 268
133 3300042601 Ga0466707_014324 Ga0466707_014324_9563_10369 268
134 iso_pr_bacteria 2574180310 2576357792 268
135 iso_pr_bacteria 2916858470 2916863607 268
136 iso_pr_bacteria 8064008355 8064010193 268
137 3300042590 Ga0466690_062986 Ga0466690_062986_2259_3068 269
138 3300042615 Ga0466711_040755 Ga0466711_040755_8943_9752 269
139 3300042619 Ga0466726_459743 Ga0466726_459743_677_1486 269
140 3300042620 Ga0466728_255537 Ga0466728_255537_11457_12266 269
141 3300042656 Ga0466732_091585 Ga0466732_091585_5703_6512 269
142 3300042612 Ga0466705_116336 Ga0466705_116336_2212_3024 270
143 3300007733 Ga0105524_101199 Ga0105524_1011992 271
144 3300009826 Ga0123355_10000163 Ga0123355_10000163103 271
145 3300042655 Ga0466727_179590 Ga0466727_179590_8897_9715 272
146 3300010167 Ga0123353_10941754 Ga0123353_109417541 275
147 3300042612 Ga0466705_271379 Ga0466705_271379_3306_4133 275
148 3300042616 Ga0466715_010717 Ga0466715_010717_21308_22135 275
149 3300042582 Ga0466657_020985 Ga0466657_020985_119_1027 281
150 iso_pr_bacteria 2820327087 2820328869 283
151 iso_pr_bacteria 2820008971 2820009035 288
152 3300042594 Ga0466694_357441 Ga0466694_357441_904_1773 289
153 3300042611 Ga0466697_030714 Ga0466697_030714_1346_2215 289
154 3300042622 Ga0466731_000114 Ga0466731_000114_137_1006 289
155 iso_pr_bacteria 2819999932 2820000192 289
156 iso_pr_bacteria 2820005795 2820006038 289
157 3300002462 JGI24702J35022_10000581 JGI24702J35022_1000058112 290
158 iso_pr_bacteria 2820004052 2820004277 303

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01656 CbiA CobQ/CobB/MinD/ParA nucleotide binding domain 44 256 0.96
PF02374 ArsA_ATPase Anion-transporting ATPase 44 79 0.92
PF00142 Fer4_NifH 4Fe-4S iron sulfur cluster binding proteins, NifH/frxC family 46 79 0.89
PF13614 AAA_31 AAA domain 42 201 0.86
PF06564 CBP_BcsQ Cellulose biosynthesis protein BcsQ 43 186 0.81
PF10609 ParA NUBPL iron-transfer P-loop NTPase 41 276 0.79
PF09140 MipZ ATPase MipZ 42 194 0.7

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.82 0.91 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.