Protein Family IF11920

Metagenome Isolate
132 Members
41 Samples
118 Scaffolds
255.36 Avg Length

🧬 Representative Sequence

ID
iso_pr_bacteria|2819998259|2819998929|
Length
290 aa
Sequence
MKLLRNDLCWCGSGKKYKKCHMESDALSGTPKKIIAPKGIKIKNSEEIAGIAKCCKLTGNILDMLDEKITEGITTNDINELVHDYTIRHGAIPATLGYNGFPKSVCTSLNNVICHGIPDSTVLKNGDIINVDVTSILNGYYGDANRMYMIGEVSAEAKKLVRVTRECLYMAIEQVKPYNDFGKIGEVIQKHADKNGFSVVRDYGGHGIGLNFHEEPHVHHYNVGYRGLHMFPGMIFTIEPMINAGKYQTKLLKDGWTAVTIDGLLSAQWEHTICVTEKGADILTLTSKEK

📊 Sample Types

Isolate 6.1%
Metagenome 93.9%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Kalotermitidae 35.0%
Termitidae 30.0%
Chrysomelidae 17.5%
Unclassified 7.5%
Termopsidae 5.0%
Hodotermitidae 2.5%
Rhinotermitidae 2.5%

🌳 Taxonomy

Archaea 0
Bacteria 119
Eukaryota 0
Viruses 0
Unclassified 13

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
2 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
3 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
4 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
5 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
6 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
7 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
8 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
9 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
10 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
11 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
12 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
13 2819998259 Unclassified Spirochaetes Nc150P4bin23 Isolate Unclassified
14 2998831604 Enterobacteriaceae endosymbiont of Donacia thalassina DthaSym Isolate Chrysomelidae
15 2998979428 Enterobacteriaceae endosymbiont of Donacia fulgens DfulgSym Isolate Chrysomelidae
16 2999134809 Enterobacteriaceae endosymbiont of Donacia crassipes DcraSym Isolate Chrysomelidae
17 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
18 2998827899 Enterobacteriaceae endosymbiont of Donacia cincticornis DcincSym Isolate Chrysomelidae
19 2998834864 Enterobacteriaceae endosymbiont of Donacia bicoloricornis DbicSym Isolate Chrysomelidae
20 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
21 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
22 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
23 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
24 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
25 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
26 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
27 2998832060 Enterobacteriaceae endosymbiont of Donacia proxima DproxSym Isolate Chrysomelidae
28 2998834370 Enterobacteriaceae endosymbiont of Plateumaris consimilis PconSym Isolate Chrysomelidae
29 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
30 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
31 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
32 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
33 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
34 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
35 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
36 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
37 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
38 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
39 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
40 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
41 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_050927 3300042612 Bacteria 2000
2 Ga0466705_267479 3300042612 Bacteria 101515
3 Ga0466735_155877 3300042624 Bacteria 105020
4 Ga0466708_161522 3300042652 Bacteria 5648
5 Ga0264413_119903 3300024493 Bacteria 16289
6 Ga0466696_142894 3300042596 Bacteria 1063
7 Ga0466699_079552 3300042597 Bacteria 2293
8 Ga0466715_319265 3300042616 Bacteria 21907
9 Ga0466715_592842 3300042616 Bacteria 2719
10 Ga0466723_173911 3300042618 Bacteria 6446
11 Ga0466723_176490 3300042618 Bacteria 1678
12 Ga0466723_370682 3300042618 Bacteria 6540
13 Ga0466705_248722 3300042612 Bacteria 12866
14 Ga0466729_249403 3300042621 Bacteria 4567
15 Ga0466704_435940 3300042643 Bacteria 6236
16 Ga0466709_000907 3300042648 Bacteria 2661
17 Ga0466690_389228 3300042590 Bacteria 2570
18 Ga0466691_049820 3300042593 Unclassified 6609
19 Ga0466705_513464 3300042612 Bacteria 8104
20 Ga0466711_129089 3300042615 Bacteria 9915
21 Ga0466711_264630 3300042615 Bacteria 77963
22 Ga0466723_009986 3300042618 Bacteria 61591
23 Ga0466723_051861 3300042618 Bacteria 4354
24 Ga0466723_064166 3300042618 Bacteria 12542
25 Ga0466723_202914 3300042618 Unclassified 11504
26 Ga0466714_157821 3300042603 Bacteria 9563
27 Ga0466717_152718 3300042604 Bacteria 1533
28 Ga0466716_186211 3300042605 Bacteria 74115
29 Ga0466705_119280 3300042612 Bacteria 25556
30 Ga0466732_373365 3300042656 Unclassified 5368
31 Ga0466703_402680 3300042636 Bacteria 1645
32 Ga0466704_120585 3300042643 Bacteria 8375
33 Ga0466704_339143 3300042643 Unclassified 2975
34 Ga0466708_041979 3300042652 Bacteria 25396
35 Ga0466708_123960 3300042652 Bacteria 7964
36 JGI24698J34947_10025142 3300002449 Unclassified 3171
37 Ga0466690_153846 3300042590 Bacteria 7322
38 Ga0466691_139149 3300042593 Bacteria 19243
39 Ga0466699_148322 3300042597 Bacteria 1438
40 Ga0466699_366351 3300042597 Bacteria 3388
41 Ga0466715_434045 3300042616 Bacteria 1774
42 Ga0466715_583260 3300042616 Bacteria 6367
43 Ga0466723_059777 3300042618 Bacteria 1251
44 Ga0466723_087992 3300042618 Bacteria 2570
45 Ga0466729_171960 3300042621 Bacteria 2457
46 Ga0466706_221625 3300042599 Bacteria 6303
47 Ga0466716_246529 3300042605 Bacteria 1800
48 Ga0466719_137724 3300042606 Bacteria 13199
49 Ga0466698_033667 3300042610 Unclassified 1735
50 Ga0466705_092890 3300042612 Bacteria 33744
51 Ga0466703_101688 3300042636 Bacteria 41897
52 Ga0466704_574534 3300042643 Bacteria 10168
53 Ga0466709_395093 3300042648 Bacteria 9281
54 Ga0466724_41334 3300042649 Bacteria 1730
55 JGI24695J34938_10118490 3300002450 Bacteria 1078
56 Ga0466690_277868 3300042590 Bacteria 4521
57 Ga0466691_067559 3300042593 Bacteria 52286
58 Ga0466712_076365 3300042614 Bacteria 1822
59 Ga0466728_358046 3300042620 Bacteria 2402
60 Ga0466728_425198 3300042620 Bacteria 51060
61 Ga0466716_257960 3300042605 Bacteria 1954
62 Ga0466719_290602 3300042606 Bacteria 1588
63 Ga0466704_204560 3300042643 Bacteria 25186
64 Ga0466708_122099 3300042652 Bacteria 23996
65 Ga0466708_289953 3300042652 Bacteria 37911
66 Ga0466727_025890 3300042655 Bacteria 1406
67 Ga0466693_347600 3300042592 Bacteria 1824
68 Ga0466715_523090 3300042616 Bacteria 1500
69 Ga0466723_109862 3300042618 Bacteria 5882
70 Ga0466723_209124 3300042618 Bacteria 14259
71 Ga0466728_389754 3300042620 Bacteria 2207
72 Ga0466717_256172 3300042604 Bacteria 2243
73 Ga0466716_147614 3300042605 Bacteria 1724
74 Ga0466719_031558 3300042606 Bacteria 15956
75 Ga0466719_085671 3300042606 Bacteria 7991
76 Ga0466698_149650 3300042610 Bacteria 3559
77 Ga0466705_180606 3300042612 Bacteria 27935
78 Ga0466705_263915 3300042612 Bacteria 7383
79 Ga0466704_221868 3300042643 Unclassified 1724
80 Ga0466691_121310 3300042593 Bacteria 9656
81 Ga0466696_120991 3300042596 Bacteria 1035
82 Ga0466711_483722 3300042615 Bacteria 3736
83 Ga0466715_407881 3300042616 Bacteria 4737
84 Ga0466715_622980 3300042616 Bacteria 273902
85 Ga0466723_012867 3300042618 Bacteria 14605
86 Ga0466723_073788 3300042618 Bacteria 30376
87 Ga0466728_032614 3300042620 Bacteria 43976
88 Ga0466728_372282 3300042620 Bacteria 14644
89 Ga0466713_151116 3300042602 Bacteria 31590
90 Ga0466719_447116 3300042606 Bacteria 10146
91 Ga0466705_244815 3300042612 Bacteria 1246
92 Ga0466703_071861 3300042636 Bacteria 17885
93 Ga0466703_426546 3300042636 Bacteria 181657
94 Ga0466704_046613 3300042643 Bacteria 6692
95 Ga0466704_075061 3300042643 Bacteria 1536
96 Ga0466690_321002 3300042590 Bacteria 2938
97 Ga0466691_030166 3300042593 Bacteria 1813
98 Ga0466696_171817 3300042596 Bacteria 1198
99 Ga0466696_459653 3300042596 Unclassified 1030
100 Ga0466723_058896 3300042618 Bacteria 1768
101 Ga0466723_374157 3300042618 Bacteria 1311
102 Ga0466728_080646 3300042620 Bacteria 15947
103 Ga0466728_133534 3300042620 Unclassified 3135
104 Ga0466705_137171 3300042612 Unclassified 1722
105 Ga0466705_250964 3300042612 Unclassified 15856
106 Ga0466702_384993 3300042635 Bacteria 1240
107 Ga0466703_381736 3300042636 Bacteria 1463
108 Ga0466709_168259 3300042648 Bacteria 21657
109 Ga0466708_331349 3300042652 Unclassified 1764
110 Ga0466691_012294 3300042593 Bacteria 27486
111 Ga0466691_115447 3300042593 Unclassified 3408
112 Ga0466696_138004 3300042596 Bacteria 1343
113 Ga0466715_020892 3300042616 Bacteria 8566
114 Ga0466718_016984 3300042617 Bacteria 2599
115 Ga0466723_073985 3300042618 Bacteria 19942
116 Ga0466707_225380 3300042601 Bacteria 15917
117 Ga0466717_220100 3300042604 Bacteria 6683
118 Ga0466716_010863 3300042605 Bacteria 9447

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042652 Ga0466708_331349 Ga0466708_331349_862_1551 229
2 3300042604 Ga0466717_152718 Ga0466717_152718_20_766 233
3 3300042610 Ga0466698_033667 Ga0466698_033667_466_1212 234
4 3300042610 Ga0466698_149650 Ga0466698_149650_1533_2279 234
5 3300042656 Ga0466732_373365 Ga0466732_373365_913_1659 234
6 3300002449 JGI24698J34947_10025142 JGI24698J34947_100251422 235
7 3300042593 Ga0466691_049820 Ga0466691_049820_326_1033 235
8 3300042604 Ga0466717_256172 Ga0466717_256172_645_1391 235
9 3300042614 Ga0466712_076365 Ga0466712_076365_982_1725 235
10 3300002450 JGI24695J34938_10118490 JGI24695J34938_101184902 236
11 3300042617 Ga0466718_016984 Ga0466718_016984_899_1645 237
12 3300024493 Ga0264413_119903 Ga0264413_11990310 242
13 3300042604 Ga0466717_220100 Ga0466717_220100_3991_4785 246
14 3300042597 Ga0466699_148322 Ga0466699_148322_93_836 247
15 3300042597 Ga0466699_366351 Ga0466699_366351_1129_1872 247
16 3300042596 Ga0466696_120991 Ga0466696_120991_36_782 248
17 3300042612 Ga0466705_250964 Ga0466705_250964_9140_9886 248
18 3300042615 Ga0466711_483722 Ga0466711_483722_2907_3653 248
19 3300042616 Ga0466715_020892 Ga0466715_020892_2138_2884 248
20 3300042616 Ga0466715_319265 Ga0466715_319265_19141_19887 248
21 3300042618 Ga0466723_073788 Ga0466723_073788_9817_10563 248
22 3300042635 Ga0466702_384993 Ga0466702_384993_317_1063 248
23 3300042636 Ga0466703_101688 Ga0466703_101688_26639_27385 248
24 3300042643 Ga0466704_221868 Ga0466704_221868_849_1595 248
25 3300042643 Ga0466704_339143 Ga0466704_339143_1585_2331 248
26 3300042655 Ga0466727_025890 Ga0466727_025890_589_1335 248
27 3300042590 Ga0466690_321002 Ga0466690_321002_1889_2638 249
28 3300042605 Ga0466716_147614 Ga0466716_147614_150_899 249
29 3300042605 Ga0466716_147614 Ga0466716_147614_949_1698 249
30 3300042606 Ga0466719_031558 Ga0466719_031558_4081_4830 249
31 3300042612 Ga0466705_180606 Ga0466705_180606_2515_3264 249
32 3300042612 Ga0466705_248722 Ga0466705_248722_9306_10055 249
33 3300042612 Ga0466705_263915 Ga0466705_263915_203_952 249
34 3300042612 Ga0466705_513464 Ga0466705_513464_2305_3054 249
35 3300042615 Ga0466711_129089 Ga0466711_129089_2015_2764 249
36 3300042618 Ga0466723_009986 Ga0466723_009986_12419_13168 249
37 3300042618 Ga0466723_051861 Ga0466723_051861_919_1668 249
38 3300042618 Ga0466723_087992 Ga0466723_087992_1232_1981 249
39 3300042618 Ga0466723_374157 Ga0466723_374157_106_855 249
40 3300042620 Ga0466728_389754 Ga0466728_389754_807_1556 249
41 3300042621 Ga0466729_249403 Ga0466729_249403_286_1035 249
42 3300042624 Ga0466735_155877 Ga0466735_155877_735_1484 249
43 3300042636 Ga0466703_402680 Ga0466703_402680_182_931 249
44 3300042643 Ga0466704_046613 Ga0466704_046613_3500_4249 249
45 3300042643 Ga0466704_120585 Ga0466704_120585_6151_6900 249
46 3300042643 Ga0466704_120585 Ga0466704_120585_7054_7803 249
47 3300042648 Ga0466709_000907 Ga0466709_000907_132_881 249
48 3300042606 Ga0466719_447116 Ga0466719_447116_1013_1765 250
49 3300042590 Ga0466690_277868 Ga0466690_277868_2452_3207 251
50 3300042603 Ga0466714_157821 Ga0466714_157821_6825_7580 251
51 3300042612 Ga0466705_137171 Ga0466705_137171_602_1357 251
52 3300042616 Ga0466715_583260 Ga0466715_583260_802_1557 251
53 3300042616 Ga0466715_622980 Ga0466715_622980_234593_235348 251
54 3300042643 Ga0466704_574534 Ga0466704_574534_7463_8218 251
55 3300042652 Ga0466708_122099 Ga0466708_122099_13672_14427 251
56 3300042593 Ga0466691_139149 Ga0466691_139149_13343_14101 252
57 3300042620 Ga0466728_425198 Ga0466728_425198_33470_34228 252
58 3300042601 Ga0466707_225380 Ga0466707_225380_2152_2913 253
59 3300042593 Ga0466691_030166 Ga0466691_030166_535_1299 254
60 3300042596 Ga0466696_138004 Ga0466696_138004_30_794 254
61 3300042596 Ga0466696_142894 Ga0466696_142894_32_796 254
62 3300042612 Ga0466705_092890 Ga0466705_092890_20075_20839 254
63 3300042612 Ga0466705_092890 Ga0466705_092890_21014_21778 254
64 3300042612 Ga0466705_267479 Ga0466705_267479_58505_59269 254
65 3300042616 Ga0466715_523090 Ga0466715_523090_406_1170 254
66 3300042616 Ga0466715_592842 Ga0466715_592842_1124_1888 254
67 3300042618 Ga0466723_012867 Ga0466723_012867_4265_5029 254
68 3300042618 Ga0466723_064166 Ga0466723_064166_10372_11136 254
69 3300042618 Ga0466723_073985 Ga0466723_073985_1881_2645 254
70 3300042618 Ga0466723_209124 Ga0466723_209124_1909_2673 254
71 3300042620 Ga0466728_133534 Ga0466728_133534_262_1026 254
72 3300042620 Ga0466728_358046 Ga0466728_358046_573_1337 254
73 3300042636 Ga0466703_381736 Ga0466703_381736_100_864 254
74 3300042643 Ga0466704_204560 Ga0466704_204560_20383_21147 254
75 3300042643 Ga0466704_204560 Ga0466704_204560_21332_22096 254
76 3300042643 Ga0466704_435940 Ga0466704_435940_3522_4286 254
77 3300042648 Ga0466709_395093 Ga0466709_395093_1509_2273 254
78 3300042648 Ga0466709_395093 Ga0466709_395093_2496_3260 254
79 3300042652 Ga0466708_041979 Ga0466708_041979_14485_15249 254
80 3300042605 Ga0466716_257960 Ga0466716_257960_202_969 255
81 3300042612 Ga0466705_119280 Ga0466705_119280_5897_6664 255
82 3300042618 Ga0466723_058896 Ga0466723_058896_557_1327 256
83 3300042596 Ga0466696_171817 Ga0466696_171817_369_1142 257
84 3300042602 Ga0466713_151116 Ga0466713_151116_16068_16841 257
85 3300042620 Ga0466728_372282 Ga0466728_372282_10939_11712 257
86 3300042636 Ga0466703_071861 Ga0466703_071861_4955_5728 257
87 3300042590 Ga0466690_153846 Ga0466690_153846_1620_2396 258
88 3300042606 Ga0466719_137724 Ga0466719_137724_11368_12144 258
89 3300042618 Ga0466723_202914 Ga0466723_202914_133_909 258
90 iso_pr_bacteria 2998831604 2998831831 259
91 iso_pr_bacteria 2998834370 2998834618 259
92 iso_pr_bacteria 2999134809 2999135041 259
93 3300042593 Ga0466691_121310 Ga0466691_121310_681_1466 261
94 iso_pr_bacteria 2998827899 2998828127 261
95 3300042618 Ga0466723_173911 Ga0466723_173911_741_1529 262
96 3300042618 Ga0466723_176490 Ga0466723_176490_747_1535 262
97 3300042652 Ga0466708_161522 Ga0466708_161522_3236_4024 262
98 iso_pr_bacteria 2998834864 2998835093 262
99 iso_pr_bacteria 2998979428 2998979654 262
100 3300042596 Ga0466696_459653 Ga0466696_459653_131_922 263
101 3300042593 Ga0466691_012294 Ga0466691_012294_8019_8813 264
102 3300042593 Ga0466691_067559 Ga0466691_067559_39206_40000 264
103 3300042593 Ga0466691_115447 Ga0466691_115447_1143_1937 264
104 3300042599 Ga0466706_221625 Ga0466706_221625_5255_6049 264
105 3300042605 Ga0466716_186211 Ga0466716_186211_57985_58779 264
106 3300042615 Ga0466711_264630 Ga0466711_264630_10926_11720 264
107 3300042620 Ga0466728_032614 Ga0466728_032614_31031_31825 264
108 3300042621 Ga0466729_171960 Ga0466729_171960_661_1455 264
109 3300042636 Ga0466703_426546 Ga0466703_426546_95525_96319 264
110 3300042648 Ga0466709_168259 Ga0466709_168259_1559_2353 264
111 3300042652 Ga0466708_123960 Ga0466708_123960_3567_4361 264
112 3300042652 Ga0466708_289953 Ga0466708_289953_28735_29529 264
113 iso_pr_bacteria 2998832060 2998832286 264
114 3300042606 Ga0466719_085671 Ga0466719_085671_4005_4802 265
115 3300042620 Ga0466728_080646 Ga0466728_080646_6655_7452 265
116 3300042616 Ga0466715_434045 Ga0466715_434045_859_1659 266
117 3300042643 Ga0466704_075061 Ga0466704_075061_157_957 266
118 3300042649 Ga0466724_41334 Ga0466724_41334_22_822 266
119 3300042618 Ga0466723_109862 Ga0466723_109862_4411_5217 268
120 3300042605 Ga0466716_010863 Ga0466716_010863_2220_3029 269
121 3300042618 Ga0466723_073788 Ga0466723_073788_11179_11988 269
122 3300042605 Ga0466716_246529 Ga0466716_246529_712_1527 271
123 3300042612 Ga0466705_050927 Ga0466705_050927_1077_1892 271
124 3300042618 Ga0466723_370682 Ga0466723_370682_2123_2941 272
125 3300042590 Ga0466690_389228 Ga0466690_389228_713_1534 273
126 3300042616 Ga0466715_407881 Ga0466715_407881_1025_1846 273
127 3300042612 Ga0466705_244815 Ga0466705_244815_273_1100 275
128 3300042597 Ga0466699_079552 Ga0466699_079552_1178_2026 282
129 iso_pr_bacteria 2819998259 2819998929 290
130 3300042592 Ga0466693_347600 Ga0466693_347600_178_1053 291
131 3300042606 Ga0466719_290602 Ga0466719_290602_621_1496 291
132 3300042618 Ga0466723_059777 Ga0466723_059777_25_921 298

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF02810 SEC-C SEC-C motif 5 22 0.96
PF00557 Peptidase_M24 Metallopeptidase family M24 50 277 0.91

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.86 0.92 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.