Protein Family IF11918
Metagenome
Isolate
118
Members
46
Samples
110
Scaffolds
214.04
Avg Length
Representative Sequence
- ID
- iso_pr_bacteria|2819994798|2819995759|
- Length
- 231 aa
- Sequence
- VAAAAFYFSGFCGIIRKMEIIPNFAVFEGLDGSGTTSQQTLLAEYLEKNNAPFFATAEPTAGPVGTLLRQALKKNISLAPQTMARLFAADRCEHLYGKDGIAERSAKGQLVVCDRYVLSSLVYQGIECGDELPAALNADFPAPHLLVYLDIDPALAQQRLKSRQTLEIYEYPEFQAKVREKYLSLLDRFRQAGVEVAVIDAAKSPKEVFEQVLGAFAKMPIFKDMKMEKAR
Sample Types
Isolate
6.8%
Metagenome
93.2%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
47.7%
Unclassified
20.5%
Kalotermitidae
20.5%
Termopsidae
6.8%
Rhinotermitidae
4.5%
Taxonomy
Archaea
0
Bacteria
114
Eukaryota
0
Viruses
0
Unclassified
4
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125658 | Treponema sp. Emb289P3bin37 | Isolate | Unclassified |
| 2 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 3 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 4 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 5 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 6 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 7 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 8 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 9 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 10 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 11 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 12 | 2781125683 | Treponema sp. Lab288P1bin34 | Isolate | Unclassified |
| 13 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 14 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 15 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 16 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 17 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 18 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 19 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 20 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 21 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 22 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 23 | 2781125692 | Treponema sp. Th196P3bin31 | Isolate | Unclassified |
| 24 | 2781125664 | Treponema sp. Emb289P3bin139 | Isolate | Unclassified |
| 25 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 26 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 27 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 28 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 29 | 2781125682 | Treponema sp. Lab288P1bin107 | Isolate | Unclassified |
| 30 | 2781125694 | Treponema sp. Th196P3bin120 | Isolate | Unclassified |
| 31 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 32 | 3300002508 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 | Metagenome | Termitidae |
| 33 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 34 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 35 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 36 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 37 | 2781125689 | Treponema sp. Mp193P4bin9 | Isolate | Unclassified |
| 38 | 2819994798 | Unclassified Spirochaetes Th196P1bin3 | Isolate | Unclassified |
| 39 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 40 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 41 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 42 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 43 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 44 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 45 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 46 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466712_055037 | 3300042614 | Bacteria | 12103 |
| 2 | Ga0466718_011466 | 3300042617 | Bacteria | 3967 |
| 3 | Ga0466723_047750 | 3300042618 | Bacteria | 8066 |
| 4 | Ga0466728_078303 | 3300042620 | Bacteria | 7175 |
| 5 | Ga0123353_10166674 | 3300010167 | Bacteria | 3501 |
| 6 | Ga0466720_089210 | 3300042607 | Bacteria | 18028 |
| 7 | Ga0466722_176492 | 3300042609 | Bacteria | 1618 |
| 8 | Ga0264413_119852 | 3300024493 | Bacteria | 10004 |
| 9 | Ga0264413_125221 | 3300024493 | Bacteria | 11706 |
| 10 | Ga0466690_042259 | 3300042590 | Bacteria | 3063 |
| 11 | Ga0466690_350377 | 3300042590 | Bacteria | 16475 |
| 12 | Ga0466692_006658 | 3300042591 | Bacteria | 5699 |
| 13 | Ga0466692_015697 | 3300042591 | Bacteria | 1845 |
| 14 | Ga0466694_015656 | 3300042594 | Bacteria | 26194 |
| 15 | Ga0466699_149007 | 3300042597 | Bacteria | 4634 |
| 16 | Ga0466699_316400 | 3300042597 | Bacteria | 7546 |
| 17 | JGI24700J35501_10928559 | 3300002508 | Bacteria | 7798 |
| 18 | Ga0072940_1019437 | 3300005200 | Bacteria | 3843 |
| 19 | Ga0466732_021051 | 3300042656 | Bacteria | 5598 |
| 20 | Ga0466735_062315 | 3300042624 | Bacteria | 8963 |
| 21 | Ga0466703_214579 | 3300042636 | Bacteria | 27555 |
| 22 | Ga0466704_218768 | 3300042643 | Bacteria | 93221 |
| 23 | Ga0466700_066919 | 3300042600 | Unclassified | 1792 |
| 24 | Ga0466720_135734 | 3300042607 | Bacteria | 10226 |
| 25 | Ga0466690_237296 | 3300042590 | Bacteria | 1108 |
| 26 | Ga0466699_144876 | 3300042597 | Bacteria | 4826 |
| 27 | JGI24698J34947_10120374 | 3300002449 | Bacteria | 1140 |
| 28 | JGI24695J34938_10066555 | 3300002450 | Bacteria | 1518 |
| 29 | JGI24699J35502_11113918 | 3300002509 | Bacteria | 2835 |
| 30 | Ga0072941_1121025 | 3300005201 | Bacteria | 7084 |
| 31 | Ga0466731_258276 | 3300042622 | Bacteria | 5062 |
| 32 | Ga0466715_225624 | 3300042616 | Bacteria | 2630 |
| 33 | Ga0466726_086381 | 3300042619 | Bacteria | 3935 |
| 34 | Ga0123353_10175438 | 3300010167 | Bacteria | 3398 |
| 35 | Ga0123353_10728542 | 3300010167 | Bacteria | 1385 |
| 36 | Ga0466696_034295 | 3300042596 | Bacteria | 17146 |
| 37 | Ga0466699_009139 | 3300042597 | Bacteria | 17874 |
| 38 | Ga0466699_239217 | 3300042597 | Bacteria | 2316 |
| 39 | JGI24698J34947_10040949 | 3300002449 | Bacteria | 2389 |
| 40 | Ga0072941_1011114 | 3300005201 | Bacteria | 12795 |
| 41 | Ga0072941_1048074 | 3300005201 | Bacteria | 12385 |
| 42 | Ga0466712_083953 | 3300042614 | Bacteria | 1362 |
| 43 | Ga0466718_031409 | 3300042617 | Bacteria | 1727 |
| 44 | Ga0466718_042889 | 3300042617 | Unclassified | 5932 |
| 45 | Ga0123356_10005618 | 3300010049 | Bacteria | 12745 |
| 46 | Ga0466700_221794 | 3300042600 | Bacteria | 1604 |
| 47 | Ga0466722_147725 | 3300042609 | Bacteria | 6876 |
| 48 | Ga0466691_082415 | 3300042593 | Bacteria | 25944 |
| 49 | Ga0466694_283593 | 3300042594 | Bacteria | 1590 |
| 50 | Ga0466699_084875 | 3300042597 | Bacteria | 1754 |
| 51 | Ga0466699_166378 | 3300042597 | Bacteria | 7559 |
| 52 | JGI24698J34947_10023009 | 3300002449 | Bacteria | 3336 |
| 53 | Ga0072941_1048790 | 3300005201 | Bacteria | 10733 |
| 54 | Ga0466727_005630 | 3300042655 | Bacteria | 1891 |
| 55 | Ga0466712_091130 | 3300042614 | Bacteria | 23740 |
| 56 | Ga0466720_088136 | 3300042607 | Bacteria | 15980 |
| 57 | Ga0466720_222315 | 3300042607 | Bacteria | 38494 |
| 58 | Ga0466722_004699 | 3300042609 | Bacteria | 1515 |
| 59 | Ga0264413_102291 | 3300024493 | Bacteria | 14873 |
| 60 | Ga0264413_116756 | 3300024493 | Bacteria | 1857 |
| 61 | Ga0466691_178757 | 3300042593 | Bacteria | 1978 |
| 62 | Ga0466699_001160 | 3300042597 | Bacteria | 10346 |
| 63 | Ga0466699_249100 | 3300042597 | Bacteria | 11668 |
| 64 | Ga0072941_1019837 | 3300005201 | Bacteria | 10373 |
| 65 | Ga0466734_172301 | 3300042623 | Bacteria | 1599 |
| 66 | Ga0123354_10208830 | 3300010882 | Unclassified | 2118 |
| 67 | Ga0466699_001476 | 3300042597 | Bacteria | 19710 |
| 68 | Ga0466699_312427 | 3300042597 | Bacteria | 3958 |
| 69 | Ga0466699_341864 | 3300042597 | Bacteria | 1082 |
| 70 | AustNasuHG_c1000711 | 3300000089 | Bacteria | 11827 |
| 71 | AustNasuHG_c1005740 | 3300000089 | Bacteria | 4435 |
| 72 | JGI24695J34938_10045009 | 3300002450 | Unclassified | 1960 |
| 73 | Ga0072940_1024945 | 3300005200 | Bacteria | 4669 |
| 74 | Ga0072941_1000713 | 3300005201 | Bacteria | 13113 |
| 75 | Ga0466719_044536 | 3300042606 | Bacteria | 15513 |
| 76 | Ga0466720_027933 | 3300042607 | Bacteria | 34844 |
| 77 | Ga0466722_129064 | 3300042609 | Bacteria | 2299 |
| 78 | Ga0264413_120312 | 3300024493 | Bacteria | 10757 |
| 79 | Ga0264413_127319 | 3300024493 | Bacteria | 1062 |
| 80 | Ga0466690_101025 | 3300042590 | Bacteria | 1354 |
| 81 | Ga0466693_056170 | 3300042592 | Bacteria | 10629 |
| 82 | Ga0466699_159778 | 3300042597 | Bacteria | 14855 |
| 83 | Ga0466699_294829 | 3300042597 | Bacteria | 18693 |
| 84 | Ga0466699_362229 | 3300042597 | Bacteria | 1150 |
| 85 | JGI24698J34947_10002494 | 3300002449 | Bacteria | 9933 |
| 86 | JGI24698J34947_10002969 | 3300002449 | Bacteria | 9191 |
| 87 | JGI24698J34947_10004859 | 3300002449 | Bacteria | 7359 |
| 88 | JGI24698J34947_10062983 | 3300002449 | Bacteria | 1819 |
| 89 | JGI24698J34947_10102996 | 3300002449 | Bacteria | 1278 |
| 90 | JGI24695J34938_10024526 | 3300002450 | Bacteria | 2895 |
| 91 | Ga0072940_1021629 | 3300005200 | Bacteria | 12883 |
| 92 | Ga0072941_1035382 | 3300005201 | Bacteria | 10071 |
| 93 | Ga0466732_152019 | 3300042656 | Bacteria | 13014 |
| 94 | Ga0466712_130141 | 3300042614 | Bacteria | 11920 |
| 95 | Ga0466712_227559 | 3300042614 | Bacteria | 24106 |
| 96 | Ga0466723_147861 | 3300042618 | Bacteria | 4180 |
| 97 | Ga0466723_297263 | 3300042618 | Bacteria | 29498 |
| 98 | Ga0123355_10088956 | 3300009826 | Bacteria | 4902 |
| 99 | Ga0123355_10193102 | 3300009826 | Bacteria | 2993 |
| 100 | Ga0466707_060287 | 3300042601 | Bacteria | 3675 |
| 101 | Ga0466719_511187 | 3300042606 | Bacteria | 2770 |
| 102 | Ga0466720_093021 | 3300042607 | Bacteria | 4723 |
| 103 | Ga0466720_107771 | 3300042607 | Bacteria | 24087 |
| 104 | Ga0466698_328612 | 3300042610 | Bacteria | 1112 |
| 105 | Ga0264413_143793 | 3300024493 | Bacteria | 1658 |
| 106 | Ga0466690_170668 | 3300042590 | Bacteria | 1704 |
| 107 | Ga0466694_039022 | 3300042594 | Bacteria | 2416 |
| 108 | Ga0466694_154331 | 3300042594 | Bacteria | 3077 |
| 109 | Ga0466696_287078 | 3300042596 | Bacteria | 3465 |
| 110 | JGI24698J34947_10023735 | 3300002449 | Bacteria | 3280 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042600 | Ga0466700_066919 | Ga0466700_066919_1202_1768 | 188 |
| 2 | iso_pr_bacteria | 2781125664 | 2781339333 | 191 |
| 3 | 3300010167 | Ga0123353_10728542 | Ga0123353_107285421 | 198 |
| 4 | 3300042592 | Ga0466693_056170 | Ga0466693_056170_6124_6762 | 202 |
| 5 | 3300002450 | JGI24695J34938_10045009 | JGI24695J34938_100450092 | 203 |
| 6 | 3300042593 | Ga0466691_082415 | Ga0466691_082415_14670_15290 | 206 |
| 7 | 3300024493 | Ga0264413_143793 | Ga0264413_1437933 | 207 |
| 8 | 3300002450 | JGI24695J34938_10024526 | JGI24695J34938_100245262 | 208 |
| 9 | 3300024493 | Ga0264413_102291 | Ga0264413_1022912 | 208 |
| 10 | 3300042591 | Ga0466692_015697 | Ga0466692_015697_1132_1758 | 208 |
| 11 | 3300042594 | Ga0466694_039022 | Ga0466694_039022_530_1156 | 208 |
| 12 | 3300042601 | Ga0466707_060287 | Ga0466707_060287_2850_3476 | 208 |
| 13 | 3300042606 | Ga0466719_044536 | Ga0466719_044536_10634_11260 | 208 |
| 14 | 3300042607 | Ga0466720_027933 | Ga0466720_027933_18737_19363 | 208 |
| 15 | 3300042607 | Ga0466720_107771 | Ga0466720_107771_1663_2289 | 208 |
| 16 | 3300042614 | Ga0466712_091130 | Ga0466712_091130_3331_3957 | 208 |
| 17 | 3300042617 | Ga0466718_042889 | Ga0466718_042889_3549_4175 | 208 |
| 18 | 3300042622 | Ga0466731_258276 | Ga0466731_258276_3626_4252 | 208 |
| 19 | 3300042643 | Ga0466704_218768 | Ga0466704_218768_81488_82114 | 208 |
| 20 | iso_pr_bacteria | 2781125692 | 2781430427 | 208 |
| 21 | 3300042590 | Ga0466690_350377 | Ga0466690_350377_3249_3878 | 209 |
| 22 | 3300042607 | Ga0466720_089210 | Ga0466720_089210_12207_12836 | 209 |
| 23 | 3300042607 | Ga0466720_093021 | Ga0466720_093021_861_1490 | 209 |
| 24 | 3300042609 | Ga0466722_176492 | Ga0466722_176492_205_834 | 209 |
| 25 | 3300042614 | Ga0466712_055037 | Ga0466712_055037_10244_10873 | 209 |
| 26 | 3300042614 | Ga0466712_130141 | Ga0466712_130141_10722_11351 | 209 |
| 27 | 3300042656 | Ga0466732_021051 | Ga0466732_021051_3034_3663 | 209 |
| 28 | iso_pr_bacteria | 2781125658 | 2781326085 | 209 |
| 29 | 3300002449 | JGI24698J34947_10023735 | JGI24698J34947_100237352 | 210 |
| 30 | 3300002449 | JGI24698J34947_10102996 | JGI24698J34947_101029962 | 210 |
| 31 | 3300002449 | JGI24698J34947_10120374 | JGI24698J34947_101203742 | 210 |
| 32 | 3300010049 | Ga0123356_10005618 | Ga0123356_100056185 | 210 |
| 33 | 3300010167 | Ga0123353_10166674 | Ga0123353_101666742 | 210 |
| 34 | 3300010167 | Ga0123353_10175438 | Ga0123353_101754382 | 210 |
| 35 | 3300010882 | Ga0123354_10208830 | Ga0123354_102088302 | 210 |
| 36 | 3300024493 | Ga0264413_119852 | Ga0264413_1198524 | 210 |
| 37 | 3300024493 | Ga0264413_125221 | Ga0264413_1252213 | 210 |
| 38 | 3300042594 | Ga0466694_154331 | Ga0466694_154331_2120_2752 | 210 |
| 39 | 3300042597 | Ga0466699_001476 | Ga0466699_001476_15428_16060 | 210 |
| 40 | 3300042597 | Ga0466699_009139 | Ga0466699_009139_15841_16473 | 210 |
| 41 | 3300042597 | Ga0466699_144876 | Ga0466699_144876_269_901 | 210 |
| 42 | 3300042607 | Ga0466720_088136 | Ga0466720_088136_9819_10451 | 210 |
| 43 | 3300042607 | Ga0466720_135734 | Ga0466720_135734_299_931 | 210 |
| 44 | 3300042610 | Ga0466698_328612 | Ga0466698_328612_109_741 | 210 |
| 45 | 3300042623 | Ga0466734_172301 | Ga0466734_172301_56_688 | 210 |
| 46 | 3300042624 | Ga0466735_062315 | Ga0466735_062315_2667_3299 | 210 |
| 47 | 3300042655 | Ga0466727_005630 | Ga0466727_005630_481_1113 | 210 |
| 48 | iso_pr_bacteria | 2781125694 | 2781436378 | 210 |
| 49 | 3300000089 | AustNasuHG_c1005740 | AustNasuHG_10057404 | 211 |
| 50 | 3300005201 | Ga0072941_1048790 | Ga0072941_10487907 | 211 |
| 51 | 3300005201 | Ga0072941_1121025 | Ga0072941_11210254 | 211 |
| 52 | 3300042597 | Ga0466699_239217 | Ga0466699_239217_1429_2064 | 211 |
| 53 | 3300042609 | Ga0466722_147725 | Ga0466722_147725_5535_6170 | 211 |
| 54 | 3300042614 | Ga0466712_083953 | Ga0466712_083953_302_937 | 211 |
| 55 | 3300000089 | AustNasuHG_c1000711 | AustNasuHG_10007115 | 212 |
| 56 | 3300005200 | Ga0072940_1024945 | Ga0072940_10249453 | 212 |
| 57 | 3300005201 | Ga0072941_1048074 | Ga0072941_10480745 | 212 |
| 58 | 3300024493 | Ga0264413_116756 | Ga0264413_1167563 | 212 |
| 59 | 3300024493 | Ga0264413_127319 | Ga0264413_1273191 | 212 |
| 60 | 3300042590 | Ga0466690_042259 | Ga0466690_042259_1647_2285 | 212 |
| 61 | 3300042590 | Ga0466690_237296 | Ga0466690_237296_67_705 | 212 |
| 62 | 3300042607 | Ga0466720_222315 | Ga0466720_222315_15701_16339 | 212 |
| 63 | 3300042617 | Ga0466718_011466 | Ga0466718_011466_2669_3307 | 212 |
| 64 | 3300042617 | Ga0466718_031409 | Ga0466718_031409_72_710 | 212 |
| 65 | iso_pr_bacteria | 2781125689 | 2781424960 | 212 |
| 66 | 3300002449 | JGI24698J34947_10002494 | JGI24698J34947_100024944 | 213 |
| 67 | 3300002449 | JGI24698J34947_10002969 | JGI24698J34947_100029695 | 213 |
| 68 | 3300005200 | Ga0072940_1019437 | Ga0072940_10194376 | 213 |
| 69 | 3300005200 | Ga0072940_1021629 | Ga0072940_10216291 | 213 |
| 70 | 3300005201 | Ga0072941_1011114 | Ga0072941_10111147 | 213 |
| 71 | 3300005201 | Ga0072941_1019837 | Ga0072941_10198376 | 213 |
| 72 | 3300042590 | Ga0466690_170668 | Ga0466690_170668_470_1111 | 213 |
| 73 | 3300042596 | Ga0466696_287078 | Ga0466696_287078_703_1344 | 213 |
| 74 | 3300002449 | JGI24698J34947_10040949 | JGI24698J34947_100409493 | 214 |
| 75 | 3300005201 | Ga0072941_1035382 | Ga0072941_10353822 | 214 |
| 76 | 3300042590 | Ga0466690_101025 | Ga0466690_101025_137_781 | 214 |
| 77 | 3300042593 | Ga0466691_178757 | Ga0466691_178757_496_1140 | 214 |
| 78 | 3300042597 | Ga0466699_001160 | Ga0466699_001160_8943_9587 | 214 |
| 79 | 3300042597 | Ga0466699_159778 | Ga0466699_159778_11137_11781 | 214 |
| 80 | 3300042597 | Ga0466699_249100 | Ga0466699_249100_917_1561 | 214 |
| 81 | 3300042597 | Ga0466699_362229 | Ga0466699_362229_343_987 | 214 |
| 82 | 3300042618 | Ga0466723_147861 | Ga0466723_147861_2070_2714 | 214 |
| 83 | iso_pr_bacteria | 2781125682 | 2781408425 | 214 |
| 84 | 3300002508 | JGI24700J35501_10928559 | JGI24700J35501_109285591 | 215 |
| 85 | 3300042597 | Ga0466699_294829 | Ga0466699_294829_2832_3479 | 215 |
| 86 | 3300042620 | Ga0466728_078303 | Ga0466728_078303_1033_1680 | 215 |
| 87 | 3300009826 | Ga0123355_10088956 | Ga0123355_100889562 | 216 |
| 88 | 3300042597 | Ga0466699_341864 | Ga0466699_341864_338_988 | 216 |
| 89 | 3300042606 | Ga0466719_511187 | Ga0466719_511187_544_1194 | 216 |
| 90 | iso_pr_bacteria | 2781125683 | 2781410863 | 216 |
| 91 | 3300002449 | JGI24698J34947_10062983 | JGI24698J34947_100629832 | 217 |
| 92 | 3300009826 | Ga0123355_10193102 | Ga0123355_101931025 | 217 |
| 93 | 3300042614 | Ga0466712_227559 | Ga0466712_227559_823_1476 | 217 |
| 94 | 3300042618 | Ga0466723_047750 | Ga0466723_047750_6392_7045 | 217 |
| 95 | 3300002449 | JGI24698J34947_10004859 | JGI24698J34947_100048594 | 218 |
| 96 | 3300002450 | JGI24695J34938_10066555 | JGI24695J34938_100665552 | 219 |
| 97 | 3300042597 | Ga0466699_149007 | Ga0466699_149007_2448_3107 | 219 |
| 98 | 3300042616 | Ga0466715_225624 | Ga0466715_225624_1170_1829 | 219 |
| 99 | 3300042609 | Ga0466722_004699 | Ga0466722_004699_838_1500 | 220 |
| 100 | 3300042597 | Ga0466699_084875 | Ga0466699_084875_838_1503 | 221 |
| 101 | 3300042600 | Ga0466700_221794 | Ga0466700_221794_856_1521 | 221 |
| 102 | 3300024493 | Ga0264413_120312 | Ga0264413_1203124 | 223 |
| 103 | 3300042594 | Ga0466694_015656 | Ga0466694_015656_11765_12436 | 223 |
| 104 | 3300042596 | Ga0466696_034295 | Ga0466696_034295_3636_4310 | 224 |
| 105 | 3300042618 | Ga0466723_297263 | Ga0466723_297263_11680_12354 | 224 |
| 106 | 3300002449 | JGI24698J34947_10023009 | JGI24698J34947_100230092 | 225 |
| 107 | 3300002509 | JGI24699J35502_11113918 | JGI24699J35502_111139182 | 226 |
| 108 | 3300042619 | Ga0466726_086381 | Ga0466726_086381_633_1313 | 226 |
| 109 | 3300042594 | Ga0466694_283593 | Ga0466694_283593_735_1418 | 227 |
| 110 | 3300042597 | Ga0466699_312427 | Ga0466699_312427_3201_3884 | 227 |
| 111 | 3300005201 | Ga0072941_1000713 | Ga0072941_10007137 | 228 |
| 112 | 3300042656 | Ga0466732_152019 | Ga0466732_152019_11483_12172 | 229 |
| 113 | 3300042636 | Ga0466703_214579 | Ga0466703_214579_19342_20037 | 231 |
| 114 | iso_pr_bacteria | 2819994798 | 2819995759 | 231 |
| 115 | 3300042609 | Ga0466722_129064 | Ga0466722_129064_262_963 | 233 |
| 116 | 3300042591 | Ga0466692_006658 | Ga0466692_006658_2377_3084 | 235 |
| 117 | 3300042597 | Ga0466699_166378 | Ga0466699_166378_6693_7472 | 259 |
| 118 | 3300042597 | Ga0466699_316400 | Ga0466699_316400_6693_7472 | 259 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF02223 | Thymidylate_kin | Thymidylate kinase | 27 | 211 | 0.95 |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.84 | 0.87 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.