Protein Family IF11918

Metagenome Isolate
118 Members
46 Samples
110 Scaffolds
214.04 Avg Length

🧬 Representative Sequence

ID
iso_pr_bacteria|2819994798|2819995759|
Length
231 aa
Sequence
VAAAAFYFSGFCGIIRKMEIIPNFAVFEGLDGSGTTSQQTLLAEYLEKNNAPFFATAEPTAGPVGTLLRQALKKNISLAPQTMARLFAADRCEHLYGKDGIAERSAKGQLVVCDRYVLSSLVYQGIECGDELPAALNADFPAPHLLVYLDIDPALAQQRLKSRQTLEIYEYPEFQAKVREKYLSLLDRFRQAGVEVAVIDAAKSPKEVFEQVLGAFAKMPIFKDMKMEKAR

📊 Sample Types

Isolate 6.8%
Metagenome 93.2%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 47.7%
Unclassified 20.5%
Kalotermitidae 20.5%
Termopsidae 6.8%
Rhinotermitidae 4.5%

🌳 Taxonomy

Archaea 0
Bacteria 114
Eukaryota 0
Viruses 0
Unclassified 4

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125658 Treponema sp. Emb289P3bin37 Isolate Unclassified
2 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
3 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
4 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
5 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
6 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
7 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
8 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
9 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
10 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
11 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
12 2781125683 Treponema sp. Lab288P1bin34 Isolate Unclassified
13 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
14 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
15 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
16 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
17 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
18 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
19 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
20 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
21 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
22 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
23 2781125692 Treponema sp. Th196P3bin31 Isolate Unclassified
24 2781125664 Treponema sp. Emb289P3bin139 Isolate Unclassified
25 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
26 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
27 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
28 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
29 2781125682 Treponema sp. Lab288P1bin107 Isolate Unclassified
30 2781125694 Treponema sp. Th196P3bin120 Isolate Unclassified
31 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
32 3300002508 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 Metagenome Termitidae
33 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
34 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
35 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
36 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
37 2781125689 Treponema sp. Mp193P4bin9 Isolate Unclassified
38 2819994798 Unclassified Spirochaetes Th196P1bin3 Isolate Unclassified
39 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
40 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
41 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
42 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
43 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
44 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
45 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
46 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466712_055037 3300042614 Bacteria 12103
2 Ga0466718_011466 3300042617 Bacteria 3967
3 Ga0466723_047750 3300042618 Bacteria 8066
4 Ga0466728_078303 3300042620 Bacteria 7175
5 Ga0123353_10166674 3300010167 Bacteria 3501
6 Ga0466720_089210 3300042607 Bacteria 18028
7 Ga0466722_176492 3300042609 Bacteria 1618
8 Ga0264413_119852 3300024493 Bacteria 10004
9 Ga0264413_125221 3300024493 Bacteria 11706
10 Ga0466690_042259 3300042590 Bacteria 3063
11 Ga0466690_350377 3300042590 Bacteria 16475
12 Ga0466692_006658 3300042591 Bacteria 5699
13 Ga0466692_015697 3300042591 Bacteria 1845
14 Ga0466694_015656 3300042594 Bacteria 26194
15 Ga0466699_149007 3300042597 Bacteria 4634
16 Ga0466699_316400 3300042597 Bacteria 7546
17 JGI24700J35501_10928559 3300002508 Bacteria 7798
18 Ga0072940_1019437 3300005200 Bacteria 3843
19 Ga0466732_021051 3300042656 Bacteria 5598
20 Ga0466735_062315 3300042624 Bacteria 8963
21 Ga0466703_214579 3300042636 Bacteria 27555
22 Ga0466704_218768 3300042643 Bacteria 93221
23 Ga0466700_066919 3300042600 Unclassified 1792
24 Ga0466720_135734 3300042607 Bacteria 10226
25 Ga0466690_237296 3300042590 Bacteria 1108
26 Ga0466699_144876 3300042597 Bacteria 4826
27 JGI24698J34947_10120374 3300002449 Bacteria 1140
28 JGI24695J34938_10066555 3300002450 Bacteria 1518
29 JGI24699J35502_11113918 3300002509 Bacteria 2835
30 Ga0072941_1121025 3300005201 Bacteria 7084
31 Ga0466731_258276 3300042622 Bacteria 5062
32 Ga0466715_225624 3300042616 Bacteria 2630
33 Ga0466726_086381 3300042619 Bacteria 3935
34 Ga0123353_10175438 3300010167 Bacteria 3398
35 Ga0123353_10728542 3300010167 Bacteria 1385
36 Ga0466696_034295 3300042596 Bacteria 17146
37 Ga0466699_009139 3300042597 Bacteria 17874
38 Ga0466699_239217 3300042597 Bacteria 2316
39 JGI24698J34947_10040949 3300002449 Bacteria 2389
40 Ga0072941_1011114 3300005201 Bacteria 12795
41 Ga0072941_1048074 3300005201 Bacteria 12385
42 Ga0466712_083953 3300042614 Bacteria 1362
43 Ga0466718_031409 3300042617 Bacteria 1727
44 Ga0466718_042889 3300042617 Unclassified 5932
45 Ga0123356_10005618 3300010049 Bacteria 12745
46 Ga0466700_221794 3300042600 Bacteria 1604
47 Ga0466722_147725 3300042609 Bacteria 6876
48 Ga0466691_082415 3300042593 Bacteria 25944
49 Ga0466694_283593 3300042594 Bacteria 1590
50 Ga0466699_084875 3300042597 Bacteria 1754
51 Ga0466699_166378 3300042597 Bacteria 7559
52 JGI24698J34947_10023009 3300002449 Bacteria 3336
53 Ga0072941_1048790 3300005201 Bacteria 10733
54 Ga0466727_005630 3300042655 Bacteria 1891
55 Ga0466712_091130 3300042614 Bacteria 23740
56 Ga0466720_088136 3300042607 Bacteria 15980
57 Ga0466720_222315 3300042607 Bacteria 38494
58 Ga0466722_004699 3300042609 Bacteria 1515
59 Ga0264413_102291 3300024493 Bacteria 14873
60 Ga0264413_116756 3300024493 Bacteria 1857
61 Ga0466691_178757 3300042593 Bacteria 1978
62 Ga0466699_001160 3300042597 Bacteria 10346
63 Ga0466699_249100 3300042597 Bacteria 11668
64 Ga0072941_1019837 3300005201 Bacteria 10373
65 Ga0466734_172301 3300042623 Bacteria 1599
66 Ga0123354_10208830 3300010882 Unclassified 2118
67 Ga0466699_001476 3300042597 Bacteria 19710
68 Ga0466699_312427 3300042597 Bacteria 3958
69 Ga0466699_341864 3300042597 Bacteria 1082
70 AustNasuHG_c1000711 3300000089 Bacteria 11827
71 AustNasuHG_c1005740 3300000089 Bacteria 4435
72 JGI24695J34938_10045009 3300002450 Unclassified 1960
73 Ga0072940_1024945 3300005200 Bacteria 4669
74 Ga0072941_1000713 3300005201 Bacteria 13113
75 Ga0466719_044536 3300042606 Bacteria 15513
76 Ga0466720_027933 3300042607 Bacteria 34844
77 Ga0466722_129064 3300042609 Bacteria 2299
78 Ga0264413_120312 3300024493 Bacteria 10757
79 Ga0264413_127319 3300024493 Bacteria 1062
80 Ga0466690_101025 3300042590 Bacteria 1354
81 Ga0466693_056170 3300042592 Bacteria 10629
82 Ga0466699_159778 3300042597 Bacteria 14855
83 Ga0466699_294829 3300042597 Bacteria 18693
84 Ga0466699_362229 3300042597 Bacteria 1150
85 JGI24698J34947_10002494 3300002449 Bacteria 9933
86 JGI24698J34947_10002969 3300002449 Bacteria 9191
87 JGI24698J34947_10004859 3300002449 Bacteria 7359
88 JGI24698J34947_10062983 3300002449 Bacteria 1819
89 JGI24698J34947_10102996 3300002449 Bacteria 1278
90 JGI24695J34938_10024526 3300002450 Bacteria 2895
91 Ga0072940_1021629 3300005200 Bacteria 12883
92 Ga0072941_1035382 3300005201 Bacteria 10071
93 Ga0466732_152019 3300042656 Bacteria 13014
94 Ga0466712_130141 3300042614 Bacteria 11920
95 Ga0466712_227559 3300042614 Bacteria 24106
96 Ga0466723_147861 3300042618 Bacteria 4180
97 Ga0466723_297263 3300042618 Bacteria 29498
98 Ga0123355_10088956 3300009826 Bacteria 4902
99 Ga0123355_10193102 3300009826 Bacteria 2993
100 Ga0466707_060287 3300042601 Bacteria 3675
101 Ga0466719_511187 3300042606 Bacteria 2770
102 Ga0466720_093021 3300042607 Bacteria 4723
103 Ga0466720_107771 3300042607 Bacteria 24087
104 Ga0466698_328612 3300042610 Bacteria 1112
105 Ga0264413_143793 3300024493 Bacteria 1658
106 Ga0466690_170668 3300042590 Bacteria 1704
107 Ga0466694_039022 3300042594 Bacteria 2416
108 Ga0466694_154331 3300042594 Bacteria 3077
109 Ga0466696_287078 3300042596 Bacteria 3465
110 JGI24698J34947_10023735 3300002449 Bacteria 3280

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042600 Ga0466700_066919 Ga0466700_066919_1202_1768 188
2 iso_pr_bacteria 2781125664 2781339333 191
3 3300010167 Ga0123353_10728542 Ga0123353_107285421 198
4 3300042592 Ga0466693_056170 Ga0466693_056170_6124_6762 202
5 3300002450 JGI24695J34938_10045009 JGI24695J34938_100450092 203
6 3300042593 Ga0466691_082415 Ga0466691_082415_14670_15290 206
7 3300024493 Ga0264413_143793 Ga0264413_1437933 207
8 3300002450 JGI24695J34938_10024526 JGI24695J34938_100245262 208
9 3300024493 Ga0264413_102291 Ga0264413_1022912 208
10 3300042591 Ga0466692_015697 Ga0466692_015697_1132_1758 208
11 3300042594 Ga0466694_039022 Ga0466694_039022_530_1156 208
12 3300042601 Ga0466707_060287 Ga0466707_060287_2850_3476 208
13 3300042606 Ga0466719_044536 Ga0466719_044536_10634_11260 208
14 3300042607 Ga0466720_027933 Ga0466720_027933_18737_19363 208
15 3300042607 Ga0466720_107771 Ga0466720_107771_1663_2289 208
16 3300042614 Ga0466712_091130 Ga0466712_091130_3331_3957 208
17 3300042617 Ga0466718_042889 Ga0466718_042889_3549_4175 208
18 3300042622 Ga0466731_258276 Ga0466731_258276_3626_4252 208
19 3300042643 Ga0466704_218768 Ga0466704_218768_81488_82114 208
20 iso_pr_bacteria 2781125692 2781430427 208
21 3300042590 Ga0466690_350377 Ga0466690_350377_3249_3878 209
22 3300042607 Ga0466720_089210 Ga0466720_089210_12207_12836 209
23 3300042607 Ga0466720_093021 Ga0466720_093021_861_1490 209
24 3300042609 Ga0466722_176492 Ga0466722_176492_205_834 209
25 3300042614 Ga0466712_055037 Ga0466712_055037_10244_10873 209
26 3300042614 Ga0466712_130141 Ga0466712_130141_10722_11351 209
27 3300042656 Ga0466732_021051 Ga0466732_021051_3034_3663 209
28 iso_pr_bacteria 2781125658 2781326085 209
29 3300002449 JGI24698J34947_10023735 JGI24698J34947_100237352 210
30 3300002449 JGI24698J34947_10102996 JGI24698J34947_101029962 210
31 3300002449 JGI24698J34947_10120374 JGI24698J34947_101203742 210
32 3300010049 Ga0123356_10005618 Ga0123356_100056185 210
33 3300010167 Ga0123353_10166674 Ga0123353_101666742 210
34 3300010167 Ga0123353_10175438 Ga0123353_101754382 210
35 3300010882 Ga0123354_10208830 Ga0123354_102088302 210
36 3300024493 Ga0264413_119852 Ga0264413_1198524 210
37 3300024493 Ga0264413_125221 Ga0264413_1252213 210
38 3300042594 Ga0466694_154331 Ga0466694_154331_2120_2752 210
39 3300042597 Ga0466699_001476 Ga0466699_001476_15428_16060 210
40 3300042597 Ga0466699_009139 Ga0466699_009139_15841_16473 210
41 3300042597 Ga0466699_144876 Ga0466699_144876_269_901 210
42 3300042607 Ga0466720_088136 Ga0466720_088136_9819_10451 210
43 3300042607 Ga0466720_135734 Ga0466720_135734_299_931 210
44 3300042610 Ga0466698_328612 Ga0466698_328612_109_741 210
45 3300042623 Ga0466734_172301 Ga0466734_172301_56_688 210
46 3300042624 Ga0466735_062315 Ga0466735_062315_2667_3299 210
47 3300042655 Ga0466727_005630 Ga0466727_005630_481_1113 210
48 iso_pr_bacteria 2781125694 2781436378 210
49 3300000089 AustNasuHG_c1005740 AustNasuHG_10057404 211
50 3300005201 Ga0072941_1048790 Ga0072941_10487907 211
51 3300005201 Ga0072941_1121025 Ga0072941_11210254 211
52 3300042597 Ga0466699_239217 Ga0466699_239217_1429_2064 211
53 3300042609 Ga0466722_147725 Ga0466722_147725_5535_6170 211
54 3300042614 Ga0466712_083953 Ga0466712_083953_302_937 211
55 3300000089 AustNasuHG_c1000711 AustNasuHG_10007115 212
56 3300005200 Ga0072940_1024945 Ga0072940_10249453 212
57 3300005201 Ga0072941_1048074 Ga0072941_10480745 212
58 3300024493 Ga0264413_116756 Ga0264413_1167563 212
59 3300024493 Ga0264413_127319 Ga0264413_1273191 212
60 3300042590 Ga0466690_042259 Ga0466690_042259_1647_2285 212
61 3300042590 Ga0466690_237296 Ga0466690_237296_67_705 212
62 3300042607 Ga0466720_222315 Ga0466720_222315_15701_16339 212
63 3300042617 Ga0466718_011466 Ga0466718_011466_2669_3307 212
64 3300042617 Ga0466718_031409 Ga0466718_031409_72_710 212
65 iso_pr_bacteria 2781125689 2781424960 212
66 3300002449 JGI24698J34947_10002494 JGI24698J34947_100024944 213
67 3300002449 JGI24698J34947_10002969 JGI24698J34947_100029695 213
68 3300005200 Ga0072940_1019437 Ga0072940_10194376 213
69 3300005200 Ga0072940_1021629 Ga0072940_10216291 213
70 3300005201 Ga0072941_1011114 Ga0072941_10111147 213
71 3300005201 Ga0072941_1019837 Ga0072941_10198376 213
72 3300042590 Ga0466690_170668 Ga0466690_170668_470_1111 213
73 3300042596 Ga0466696_287078 Ga0466696_287078_703_1344 213
74 3300002449 JGI24698J34947_10040949 JGI24698J34947_100409493 214
75 3300005201 Ga0072941_1035382 Ga0072941_10353822 214
76 3300042590 Ga0466690_101025 Ga0466690_101025_137_781 214
77 3300042593 Ga0466691_178757 Ga0466691_178757_496_1140 214
78 3300042597 Ga0466699_001160 Ga0466699_001160_8943_9587 214
79 3300042597 Ga0466699_159778 Ga0466699_159778_11137_11781 214
80 3300042597 Ga0466699_249100 Ga0466699_249100_917_1561 214
81 3300042597 Ga0466699_362229 Ga0466699_362229_343_987 214
82 3300042618 Ga0466723_147861 Ga0466723_147861_2070_2714 214
83 iso_pr_bacteria 2781125682 2781408425 214
84 3300002508 JGI24700J35501_10928559 JGI24700J35501_109285591 215
85 3300042597 Ga0466699_294829 Ga0466699_294829_2832_3479 215
86 3300042620 Ga0466728_078303 Ga0466728_078303_1033_1680 215
87 3300009826 Ga0123355_10088956 Ga0123355_100889562 216
88 3300042597 Ga0466699_341864 Ga0466699_341864_338_988 216
89 3300042606 Ga0466719_511187 Ga0466719_511187_544_1194 216
90 iso_pr_bacteria 2781125683 2781410863 216
91 3300002449 JGI24698J34947_10062983 JGI24698J34947_100629832 217
92 3300009826 Ga0123355_10193102 Ga0123355_101931025 217
93 3300042614 Ga0466712_227559 Ga0466712_227559_823_1476 217
94 3300042618 Ga0466723_047750 Ga0466723_047750_6392_7045 217
95 3300002449 JGI24698J34947_10004859 JGI24698J34947_100048594 218
96 3300002450 JGI24695J34938_10066555 JGI24695J34938_100665552 219
97 3300042597 Ga0466699_149007 Ga0466699_149007_2448_3107 219
98 3300042616 Ga0466715_225624 Ga0466715_225624_1170_1829 219
99 3300042609 Ga0466722_004699 Ga0466722_004699_838_1500 220
100 3300042597 Ga0466699_084875 Ga0466699_084875_838_1503 221
101 3300042600 Ga0466700_221794 Ga0466700_221794_856_1521 221
102 3300024493 Ga0264413_120312 Ga0264413_1203124 223
103 3300042594 Ga0466694_015656 Ga0466694_015656_11765_12436 223
104 3300042596 Ga0466696_034295 Ga0466696_034295_3636_4310 224
105 3300042618 Ga0466723_297263 Ga0466723_297263_11680_12354 224
106 3300002449 JGI24698J34947_10023009 JGI24698J34947_100230092 225
107 3300002509 JGI24699J35502_11113918 JGI24699J35502_111139182 226
108 3300042619 Ga0466726_086381 Ga0466726_086381_633_1313 226
109 3300042594 Ga0466694_283593 Ga0466694_283593_735_1418 227
110 3300042597 Ga0466699_312427 Ga0466699_312427_3201_3884 227
111 3300005201 Ga0072941_1000713 Ga0072941_10007137 228
112 3300042656 Ga0466732_152019 Ga0466732_152019_11483_12172 229
113 3300042636 Ga0466703_214579 Ga0466703_214579_19342_20037 231
114 iso_pr_bacteria 2819994798 2819995759 231
115 3300042609 Ga0466722_129064 Ga0466722_129064_262_963 233
116 3300042591 Ga0466692_006658 Ga0466692_006658_2377_3084 235
117 3300042597 Ga0466699_166378 Ga0466699_166378_6693_7472 259
118 3300042597 Ga0466699_316400 Ga0466699_316400_6693_7472 259

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF02223 Thymidylate_kin Thymidylate kinase 27 211 0.95

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.84 0.87 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.