Protein Family IF11909
Metagenome
Isolate
365
Members
287
Samples
155
Scaffolds
406.9
Avg Length
Representative Sequence
- ID
- iso_pr_bacteria|2816332503|2818125806|
- Length
- 419 aa
- Sequence
- MAEDLINSFMNGPDENGRFGIFGGRFVSETLMPLILSLEEEYEKAKVDPDFWAEMDDLWKNYVGRPSPLYFAERLTEHLGGAKVYLKRDELNHTGAHKVNNVLGQILLARRMGKTRIIAETGAGQHGVATATVCAKFGLKCVVYMGAHDVRRQAPNVFRMRLLGAEVIPVTSGRGTLKDAMNDALRDWVTNVRDTFYCIGTVAGPHPYPAMVRDFQSVIGKEVRWQLAEQEGEGRLPDTLVAAIGGGSNAMGLFHPFLDDKSVNIIGVEAGGKGVDEKMEHCASLTGGRPGVLHGNRTYLLQDDDGQILEGFSISAGLDYPGIGPEHAWLHETGRAQYVSITDKEALEAFQLSCAMEGIIPALEPSHALAHVMKIAPTLPKDHIIVMNMCGRGDKDIFTVARHLGFDMSDTEEGRDLEE
Sample Types
Isolate
57.5%
Metagenome
42.5%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Apidae
20.2%
Drosophilidae
14.8%
Coreidae
12.6%
Unclassified
10.5%
Elmidae
8.7%
Formicidae
5.8%
Termitidae
5.8%
Culicidae
4.0%
Curculionidae
4.0%
Kalotermitidae
3.2%
Armadillidiidae
2.2%
Rhinotermitidae
1.1%
Nephropidae
0.7%
Largidae
0.7%
Alydidae
0.7%
Termopsidae
0.7%
Daphniidae
0.4%
Passalidae
0.4%
Tenebrionidae
0.4%
Hodotermitidae
0.4%
Berytidae
0.4%
Nymphalidae
0.4%
Siricidae
0.4%
Trigoniulidae
0.4%
Noctuidae
0.4%
Muscidae
0.4%
Pediculidae
0.4%
Gryllidae
0.4%
Taxonomy
Archaea
0
Bacteria
341
Eukaryota
0
Viruses
0
Unclassified
24
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2065487013 | Fungus-growing termite worker microbial communities from South Africa - Oerleman's Farm | Metagenome | |
| 2 | 2556921669 | Shinella sp. DD12 | Isolate | Daphniidae |
| 3 | 2806310572 | Pukyongiella litopenaei SH-1 | Isolate | Unclassified |
| 4 | 2828301124 | Sphingomonas leidyi DSM 4733 | Isolate | Unclassified |
| 5 | 2834165886 | Saccharibacter sp. M18 | Isolate | Apidae |
| 6 | 2835143510 | Yoonia maritima YPC211 | Isolate | Nephropidae |
| 7 | 2854576727 | Acetobacter okinawensis DsW_060 | Isolate | Drosophilidae |
| 8 | 2858089842 | Acetobacter tropicalis DmW_042 | Isolate | Drosophilidae |
| 9 | 2858110640 | Acetobacter indonesiensis DmL_051 | Isolate | Drosophilidae |
| 10 | 2864739902 | Pseudomonas viridiflavia S00001 | Isolate | Elmidae |
| 11 | 2864853652 | Pseudomonas rhodesiae S00114 | Isolate | Elmidae |
| 12 | 2901819457 | Bombella sp. ESL0385 | Isolate | Apidae |
| 13 | 3300000036 | Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) | Metagenome | Passalidae |
| 14 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 15 | 3300002934 | Ant worker gut metagenome for colony PL005 | Metagenome | Formicidae |
| 16 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 17 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 18 | 3300012829 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG | Metagenome | Armadillidiidae |
| 19 | 3300012839 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG | Metagenome | Culicidae |
| 20 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 21 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 22 | 3300056564 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) | Metagenome | Tenebrionidae |
| 23 | 8021899934 | Acinetobacter sp. AR2-3 | Isolate | Culicidae |
| 24 | 8067579126 | Gluconobacter kondonii Dm-16 | Isolate | Drosophilidae |
| 25 | 8067581993 | Gluconobacter kondonii Dm-54 | Isolate | Drosophilidae |
| 26 | 8067598439 | Gluconobacter wancherniae Dm-17 | Isolate | Drosophilidae |
| 27 | 8068946563 | Bartonella apihabitans M0187 | Isolate | Apidae |
| 28 | 8074882376 | Commensalibacter sp. M0270 | Isolate | Apidae |
| 29 | 8102014801 | Caballeronia sp. ATUFL_M2_KS44 | Isolate | Coreidae |
| 30 | 8102208438 | Caballeronia sp. LZ032 | Isolate | Coreidae |
| 31 | 8102251710 | Caballeronia sp. LZ065 | Isolate | Coreidae |
| 32 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 33 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 34 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 35 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 36 | 2035918003 | Mountain Pine Beetle microbial communities from McBride, British Columbia, Canada - Lodgepole pine | Metagenome | Curculionidae |
| 37 | 2617271320 | Acetobacter pomorum DmCS_004 | Isolate | Drosophilidae |
| 38 | 2724678956 | Methylobacterium sp. GXS13 | Isolate | Unclassified |
| 39 | 2839192570 | Gluconobacter sp. DsW_056 | Isolate | Drosophilidae |
| 40 | 2839785767 | Thalassobius sp. I31.1 | Isolate | Nephropidae |
| 41 | 2854518031 | Acetobacter indonesiensis DmW_046 | Isolate | Drosophilidae |
| 42 | 2891675627 | Commensalibacter melissae ESL0366 | Isolate | Apidae |
| 43 | 3300002938 | Larval gut metagenome for colony PL005 | Metagenome | Formicidae |
| 44 | 3300003973 | Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle | Metagenome | Curculionidae |
| 45 | 3300012813 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG | Metagenome | Culicidae |
| 46 | 3300012828 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E0 MG | Metagenome | |
| 47 | 3300012847 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG | Metagenome | Armadillidiidae |
| 48 | 3300029809 | Ant gut bacterial community from Dolichoderus sp. 3-PL2018, Madre de Dios, Puerto Maldonado, Peru - colony JSC188 | Metagenome | Formicidae |
| 49 | 8024014383 | Caballeronia sp. SL2Y3 | Isolate | Berytidae |
| 50 | 8073626464 | Bartonella apis W8152 | Isolate | Apidae |
| 51 | 8074832014 | Commensalibacter melissae M0391 | Isolate | Apidae |
| 52 | 8074875073 | Commensalibacter sp. M0265 | Isolate | Apidae |
| 53 | 8074878724 | Commensalibacter sp. M0267 | Isolate | Apidae |
| 54 | 8074880551 | Commensalibacter sp. M0268 | Isolate | Apidae |
| 55 | 8102109360 | Caballeronia sp. INML2 | Isolate | Coreidae |
| 56 | 8102223607 | Caballeronia sp. LZ034LL | Isolate | Coreidae |
| 57 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 58 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 59 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 60 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 61 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 62 | 2044078006 | Dendroctonus frontalis bacterial communities from Mississippi, USA | Metagenome | Curculionidae |
| 63 | 2556921622 | Terasakiella pusilla DSM 6293 | Isolate | Unclassified |
| 64 | 2597490292 | Acetobacter malorum DmCS_005 | Isolate | Drosophilidae |
| 65 | 2775507278 | Commensalibacter papalotli (ex Servin-Garciduenas et al. 2014) MX-MONARCH01 | Isolate | Nymphalidae |
| 66 | 2820123897 | Unclassified Proteobacteria Emb289P4bin18 | Isolate | Unclassified |
| 67 | 2820142992 | Unclassified Proteobacteria Emb289P3bin113 | Isolate | Unclassified |
| 68 | 2834143536 | Parasaccharibacter apium AS1 | Isolate | Apidae |
| 69 | 2834160066 | Parasaccharibacter apium B8 | Isolate | Apidae |
| 70 | 2837008993 | Oecophyllibacter saccharovorans Ta1 | Isolate | Formicidae |
| 71 | 2841175817 | Komagataeibacter saccharivorans JH1 | Isolate | Unclassified |
| 72 | 2864745180 | Pseudomonas rhodesiae S00002 | Isolate | Elmidae |
| 73 | 2864804954 | Acinetobacter johnsonii S00050 | Isolate | Elmidae |
| 74 | 2864847319 | Pseudomonas alcaligenes S00099 | Isolate | Elmidae |
| 75 | 2864973726 | Acinetobacter schindleri S00243 | Isolate | Elmidae |
| 76 | 2864976888 | Novosphingobium chloroacetimidivorans S00245 | Isolate | Elmidae |
| 77 | 2899194184 | Bombella sp. ESL0378 | Isolate | Apidae |
| 78 | 2920413932 | Bombella sp. ESL0380 | Isolate | Apidae |
| 79 | 3006190525 | Acinetobacter sp. S54 | Isolate | Curculionidae |
| 80 | 3300007188 | Ant gut microbial communities from Cephalotes rohweri, Arizona, USA | Metagenome | Formicidae |
| 81 | 3300009460 | Microbial communities of aphids from Pistacia texana in Langtry, TX, USA - Geopemphigus sp. seqcov | Metagenome | |
| 82 | 3300012824 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG | Metagenome | Armadillidiidae |
| 83 | 3300012835 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG | Metagenome | Culicidae |
| 84 | 3300012837 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG | Metagenome | Armadillidiidae |
| 85 | 3300012849 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG | Metagenome | Culicidae |
| 86 | 8025666332 | Caballeronia grimmiae LZ050 | Isolate | Coreidae |
| 87 | 8025694439 | Caballeronia cordobensis LZ033 | Isolate | Coreidae |
| 88 | 8052469819 | Pseudomonas putida DZ-F23 | Isolate | |
| 89 | 8067594896 | Gluconobacter kondonii Dm-18 | Isolate | Drosophilidae |
| 90 | 8068953321 | Bartonella apihabitans M0190 | Isolate | Apidae |
| 91 | 8074745029 | Commensalibacter melissae M0407 | Isolate | Apidae |
| 92 | 8074748739 | Commensalibacter sp. W8133 | Isolate | Apidae |
| 93 | 8100531325 | Gluconobacter sp. Dm-73 | Isolate | Drosophilidae |
| 94 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 95 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 96 | 2100351016 | Sirex noctilio microbial communities from Pennsylvania, USA - adult community | Metagenome | Siricidae |
| 97 | 2524614573 | Marinospirillum minutulum DSM 6287 | Isolate | Unclassified |
| 98 | 2751185853 | Bartonella apis BBC0178 | Isolate | Apidae |
| 99 | 2786546124 | Acetobacter sp. JWB | Isolate | Drosophilidae |
| 100 | 2843073756 | Oecophyllibacter saccharovorans Jb2 | Isolate | Formicidae |
| 101 | 2854520951 | Acetobacter pasteurianus AD | Isolate | Unclassified |
| 102 | 2854536247 | Acetobacter senegalensis DmL_050 | Isolate | Drosophilidae |
| 103 | 2858102877 | Acetobacter orientalis DmW_048 | Isolate | Drosophilidae |
| 104 | 2858129007 | Acetobacter orientalis DmW_045 | Isolate | Drosophilidae |
| 105 | 2864812326 | Chitinimonas taiwanensis S00057 | Isolate | Elmidae |
| 106 | 2864866972 | Brevundimonas bullata S00123 | Isolate | Elmidae |
| 107 | 2864874997 | Acinetobacter lwoffii S00127 | Isolate | Elmidae |
| 108 | 2864944480 | Pseudomonas fluvialis S00202 | Isolate | Elmidae |
| 109 | 2987233858 | Stutzerimonas stutzeri AR9-4 | Isolate | Unclassified |
| 110 | 2997878596 | Pseudomonas bohemica IA9 | Isolate | Unclassified |
| 111 | 3300002464 | Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 | Metagenome | Culicidae |
| 112 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 113 | 3300012809 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E11 MG | Metagenome | |
| 114 | 3300012812 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E11 MG | Metagenome | Culicidae |
| 115 | 8025678175 | Caballeronia hypogeia LZ043 | Isolate | Coreidae |
| 116 | 8035321120 | Pseudomonas prosekii A2-NA12 | Isolate | Curculionidae |
| 117 | 8067591850 | Gluconobacter kondonii Dm-47 | Isolate | Drosophilidae |
| 118 | 8068944069 | Bartonella choladocola W8125 | Isolate | Apidae |
| 119 | 8068955631 | Bartonella apihabitans M0280 | Isolate | Apidae |
| 120 | 8069775773 | Caballeronia sp. LZ062 | Isolate | Coreidae |
| 121 | 8073628750 | Bartonella sp. W8167 | Isolate | Apidae |
| 122 | 8074737057 | Commensalibacter sp. M0357 | Isolate | Apidae |
| 123 | 8074867669 | Commensalibacter sp. B14384M2 | Isolate | Apidae |
| 124 | 8074869529 | Commensalibacter sp. B14384M3 | Isolate | Apidae |
| 125 | 8074873247 | Commensalibacter sp. M0134 | Isolate | Apidae |
| 126 | 8074876897 | Commensalibacter sp. M0266 | Isolate | Apidae |
| 127 | 8100528075 | Gluconobacter sp. Dm-44 | Isolate | Drosophilidae |
| 128 | 8102020860 | Caballeronia sp. AZ10_KS36 | Isolate | Coreidae |
| 129 | 2513237339 | Commensalibacter intestini A911 | Isolate | Drosophilidae |
| 130 | 2519899622 | Pseudomonas sp. Ag1 | Isolate | Culicidae |
| 131 | 2711768164 | Tritonibacter mobilis S1942 | Isolate | Unclassified |
| 132 | 2751185856 | Bartonella apis BBC0244 | Isolate | Apidae |
| 133 | 2816332478 | Acetobacter tropicalis BDGP1 | Isolate | Drosophilidae |
| 134 | 2816332545 | Tritonibacter mobilis S1923 | Isolate | Unclassified |
| 135 | 2843864159 | Acetobacter pomorum SH | Isolate | Drosophilidae |
| 136 | 2864863795 | Acinetobacter johnsonii S00116 | Isolate | Elmidae |
| 137 | 2864951976 | Brevundimonas bullata S00223 | Isolate | Elmidae |
| 138 | 2868677537 | Acetobacter orientalis DsW_061 | Isolate | Drosophilidae |
| 139 | 2884203697 | Commensalibacter melissae ESL0284 | Isolate | Apidae |
| 140 | 2891591111 | Commensalibacter sp. ESL0382 | Isolate | Unclassified |
| 141 | 2891610497 | Commensalibacter melissae ESL0367 | Isolate | Apidae |
| 142 | 2920412021 | Bombella sp. ESL0387 | Isolate | Apidae |
| 143 | 2967491045 | Entomobacter blattae G55GP | Isolate | Unclassified |
| 144 | 3002394112 | Gluconobacter sp. Gdi | Isolate | Drosophilidae |
| 145 | 3003869270 | Paraburkholderia sp. PGU16 | Isolate | Largidae |
| 146 | 3006156446 | Acinetobacter baretiae B10A | Isolate | Apidae |
| 147 | 3007473699 | Pseudomonas sp. S30 | Isolate | Curculionidae |
| 148 | 3300000333 | Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony | Metagenome | Apidae |
| 149 | 3300028918 | Ant gut bacterial community from Dolichoderus sp. 2-PL2018, Madre de Dios, Puerto Maldonado, Peru - colony JSC085 | Metagenome | Formicidae |
| 150 | 3300029810 | Ant gut bacterial community from Dolichoderus sp. 4-PL2018, Madre de Dios, Puerto Maldonado, Peru - colony JSC189 | Metagenome | Formicidae |
| 151 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 152 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 153 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 154 | 651324000 | Acetobacter pomorum DM001 | Isolate | Drosophilidae |
| 155 | 8011329375 | Pseudomonas sp. S31 | Isolate | Curculionidae |
| 156 | 8011357093 | Pseudomonas schmalbachii Milli4 | Isolate | Trigoniulidae |
| 157 | 8023747282 | Caballeronia zhejiangensis LZ019 | Isolate | Coreidae |
| 158 | 8024025509 | Caballeronia grimmiae Lep1A1 | Isolate | Coreidae |
| 159 | 8025685901 | Caballeronia fortuita LZ035 | Isolate | Coreidae |
| 160 | 8025723035 | Caballeronia grimmiae LZ025 | Isolate | Coreidae |
| 161 | 8067588748 | Gluconobacter kondonii Dm-42 | Isolate | Drosophilidae |
| 162 | 8073617375 | Bartonella apis W8098 | Isolate | Apidae |
| 163 | 8074809037 | Bombella apis MRM1 | Isolate | Apidae |
| 164 | 8078130113 | Caballeronia sp. INDeC2 | Isolate | Coreidae |
| 165 | 8082291289 | Bartonella apihabitans K-FP28 | Isolate | Apidae |
| 166 | 8102054868 | Caballeronia sp. GAFFF1 | Isolate | Coreidae |
| 167 | 8102102351 | Caballeronia sp. INML1 | Isolate | Coreidae |
| 168 | 8102246966 | Caballeronia sp. LZ050 | Isolate | Coreidae |
| 169 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 170 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 171 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 172 | 8116947750 | Gluconacetobacter sacchari DSM 12717 | Isolate | Unclassified |
| 173 | 2531839311 | Acinetobacter sp. HA | Isolate | Noctuidae |
| 174 | 2597489944 | Caballeronia insecticola RPE64 | Isolate | Alydidae |
| 175 | 2718218026 | Phaeobacter porticola P97 | Isolate | Unclassified |
| 176 | 2751185679 | Parasaccharibacter apium G7_7_3c | Isolate | Apidae |
| 177 | 2831736028 | Parasaccharibacter apium A29 | Isolate | Apidae |
| 178 | 2834230000 | Pandoraea novymonadis E262 | Isolate | Unclassified |
| 179 | 2834852038 | Acetobacter cibinongensis DsW_47 | Isolate | Drosophilidae |
| 180 | 2841330038 | Sulfitobacter sp. D7 | Isolate | |
| 181 | 2858105562 | Acetobacter sp. DsW_059 | Isolate | Drosophilidae |
| 182 | 2864808494 | Chitinimonas taiwanensis S00056 | Isolate | Elmidae |
| 183 | 2864926767 | Pseudomonas nitritireducens S00179 | Isolate | Elmidae |
| 184 | 2864934081 | Brevundimonas vesicularis S00192 | Isolate | Elmidae |
| 185 | 2864993140 | Agrobacterium vitis S00303 | Isolate | Elmidae |
| 186 | 2889908211 | Bowmanella denitrificans JL63 | Isolate | Unclassified |
| 187 | 2891605396 | Commensalibacter melissae ESL0392 | Isolate | Apidae |
| 188 | 2891614855 | Commensalibacter melissae ESL0379 | Isolate | Apidae |
| 189 | 3002401049 | Gluconobacter sp. Dm-62 | Isolate | Drosophilidae |
| 190 | 3003878002 | Paraburkholderia sp. PGU19 | Isolate | Largidae |
| 191 | 3300002932 | Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 | Metagenome | Formicidae |
| 192 | 3300005721 | Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 | Metagenome | Apidae |
| 193 | 3300007067 | Ant gut microbial communities from Cephalotes spinosus, Peru | Metagenome | Formicidae |
| 194 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 195 | 3300012820 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E6 MG | Metagenome | Armadillidiidae |
| 196 | 3300012825 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG | Metagenome | |
| 197 | 3300012845 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG | Metagenome | Culicidae |
| 198 | 3300012861 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG | Metagenome | Culicidae |
| 199 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 200 | 8023752828 | Caballeronia grimmiae LZ062 | Isolate | Coreidae |
| 201 | 8024019580 | Caballeronia sp. Lep1P3 | Isolate | Coreidae |
| 202 | 8024031916 | Cupriavidus pauculus BHJ32i | Isolate | Alydidae |
| 203 | 8024044713 | Caballeronia sp. Sq4a | Isolate | Coreidae |
| 204 | 8035422605 | Pseudomonas monteilii CY06 | Isolate | |
| 205 | 8067483258 | Ochrobactrum soli MTP-C0764 | Isolate | Muscidae |
| 206 | 8067585538 | Gluconobacter kondonii Dm-68 | Isolate | Drosophilidae |
| 207 | 8068950955 | Bartonella apihabitans W8097 | Isolate | Apidae |
| 208 | 8073621894 | Bartonella apis W8099 | Isolate | Apidae |
| 209 | 8074743123 | Commensalibacter melissae M0402 | Isolate | Apidae |
| 210 | 8074812948 | Bombella apis MRM1 | Isolate | Apidae |
| 211 | 8102169119 | Caballeronia sp. LZ016 | Isolate | Coreidae |
| 212 | 8102181083 | Caballeronia sp. LZ025 | Isolate | Coreidae |
| 213 | 648028015 | Candidatus Zinderia insecticola CARI | Isolate | |
| 214 | 2032320009 | Mountain Pine Beetle microbial communities from Grand Prairie, Alberta, sample from Hybrid pine | Metagenome | Curculionidae |
| 215 | 2513237393 | Gluconobacter morbifer G707 | Isolate | Drosophilidae |
| 216 | 2603880173 | Pseudomonas SP. | Isolate | Unclassified |
| 217 | 2816332503 | Tritonibacter mobilis S1611 | Isolate | Unclassified |
| 218 | 2820086750 | Unclassified Proteobacteria Lab288P3bin98 | Isolate | Unclassified |
| 219 | 2833052049 | Commensalibacter melissae AMU001 | Isolate | Apidae |
| 220 | 2835008077 | Commensalibacter intestini DmL_052 | Isolate | Drosophilidae |
| 221 | 2841821538 | Psychrobacter sp. YP14 | Isolate | Unclassified |
| 222 | 2854548700 | Acetobacter persici DmL_053 | Isolate | Drosophilidae |
| 223 | 2864843793 | Acinetobacter johnsonii S00075 | Isolate | Elmidae |
| 224 | 2864903489 | Pseudomonas aeuginosa S00161 | Isolate | Elmidae |
| 225 | 2868683769 | Acetobacter sp. DmW_043 | Isolate | Drosophilidae |
| 226 | 2870361953 | Entomomonas moraniae QZS01 | Isolate | Apidae |
| 227 | 2873468275 | Agrobacterium vitis S00131 | Isolate | Elmidae |
| 228 | 2987037630 | Oecophyllibacter saccharovorans Ha5 | Isolate | Formicidae |
| 229 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 230 | 3300012857 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG | Metagenome | Culicidae |
| 231 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 232 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 233 | 641522603 | Acinetobacter baumannii SDF | Isolate | Pediculidae |
| 234 | 8025650824 | Caballeronia hypogeia LZ032 | Isolate | Coreidae |
| 235 | 8025671076 | Caballeronia cordobensis LZ034LL | Isolate | Coreidae |
| 236 | 8025735396 | Caballeronia zhejiangensis LZ016 | Isolate | Coreidae |
| 237 | 8073624232 | Bartonella sp. W8151 | Isolate | Apidae |
| 238 | 8074810961 | Bombella apis SME1 | Isolate | Apidae |
| 239 | 8074871419 | Commensalibacter sp. M0133 | Isolate | Apidae |
| 240 | 8074884171 | Commensalibacter sp. M0355 | Isolate | Apidae |
| 241 | 8100534375 | Gluconobacter sp. Dm-74 | Isolate | Drosophilidae |
| 242 | 8102081745 | Caballeronia sp. GAWG1-5s-s | Isolate | Coreidae |
| 243 | 8102117041 | Caballeronia sp. INML3 | Isolate | Coreidae |
| 244 | 8102138357 | Caballeronia sp. INSB1 | Isolate | Coreidae |
| 245 | 8102216467 | Caballeronia sp. LZ033 | Isolate | Coreidae |
| 246 | 8102230706 | Caballeronia sp. LZ035 | Isolate | Coreidae |
| 247 | 8102239244 | Caballeronia sp. LZ043 | Isolate | Coreidae |
| 248 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 249 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 250 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 251 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 252 | 2751185858 | Bartonella apis BBC0122 | Isolate | Apidae |
| 253 | 2756170209 | Commensalibacter sp. ESL0284 | Isolate | Unclassified |
| 254 | 2791354941 | Bombella intestini R-52487 | Isolate | Unclassified |
| 255 | 2820110010 | Unclassified Proteobacteria Emb289P4bin35 | Isolate | Unclassified |
| 256 | 2834038347 | Gluconobacter sp. DsW_058 | Isolate | Drosophilidae |
| 257 | 2858084324 | Acetobacter sp. DsW_54 | Isolate | Drosophilidae |
| 258 | 2858119979 | Acetobacter malorum DsW_057 | Isolate | Drosophilidae |
| 259 | 2864751016 | Pseudomonas oryzihabitans S00005 | Isolate | Elmidae |
| 260 | 2864840607 | Acinetobacter johnsonii S00071 | Isolate | Elmidae |
| 261 | 2864955722 | Sphingomonas kyeonggiensis S00224 | Isolate | Elmidae |
| 262 | 2864968865 | Paucibacter oligotrophus S00239 | Isolate | Elmidae |
| 263 | 2891690481 | Commensalibacter melissae ESL0390 | Isolate | Apidae |
| 264 | 2990166910 | Pseudomonas typographi CA3A | Isolate | Curculionidae |
| 265 | 3000478755 | Entomomonas asaccharolytica F2A | Isolate | Gryllidae |
| 266 | 3007478678 | Pseudomonas sp. S37 | Isolate | Curculionidae |
| 267 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 268 | 3300007150 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 3 gut | Metagenome | Drosophilidae |
| 269 | 3300007505 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut | Metagenome | Drosophilidae |
| 270 | 3300012815 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E1 MG | Metagenome | |
| 271 | 3300026175 | Army ant gut microbial communities from Eciton burchelli, Monteverde, Costa Rica - colony MVEbp1 | Metagenome | Formicidae |
| 272 | 3300030930 | Ant gut bacterial community from Pseudomyrmex nigropilosus larvae, the Area de Conservacion Guanacaste, Costa Rica - colony BER0554 | Metagenome | Formicidae |
| 273 | 2972038244 | Pseudomonas sp. DS1 | Isolate | Formicidae |
| 274 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 275 | 637000219 | Pseudomonas entomophila L48 | Isolate | Unclassified |
| 276 | 8025658853 | Caballeronia temeraria LZ065 | Isolate | Coreidae |
| 277 | 8035326735 | Pseudomonas prosekii A2-NA13 | Isolate | Curculionidae |
| 278 | 8067604290 | Gluconobacter wancherniae Dm-19 | Isolate | Drosophilidae |
| 279 | 8067607133 | Gluconobacter wancherniae Dm-15 | Isolate | Drosophilidae |
| 280 | 8068941587 | Bartonella choladocola B10834H15 | Isolate | Apidae |
| 281 | 8069770227 | Caballeronia sp. LZ019 | Isolate | Coreidae |
| 282 | 8073619611 | Bartonella apis B10834G6 | Isolate | Apidae |
| 283 | 8074746876 | Commensalibacter sp. W6292M3 | Isolate | Apidae |
| 284 | 8074750600 | Commensalibacter sp. W8163 | Isolate | Apidae |
| 285 | 8102124461 | Caballeronia sp. INML3B | Isolate | Coreidae |
| 286 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 287 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466722_207379 | 3300042609 | Bacteria | 3637 |
| 2 | Ga0160467_100119 | 3300012829 | Bacteria | 111101 |
| 3 | Ga0160455_101444 | 3300012837 | Bacteria | 7074 |
| 4 | Ga0160472_100304 | 3300012839 | Unclassified | 50571 |
| 5 | Ga0160460_100643 | 3300012845 | Unclassified | 17466 |
| 6 | Ga0160460_100841 | 3300012845 | Bacteria | 13543 |
| 7 | Ga0160433_103730 | 3300012846 | Bacteria | 2621 |
| 8 | Ga0160447_102082 | 3300012849 | Unclassified | 7282 |
| 9 | Ga0466657_231303 | 3300042582 | Bacteria | 2027 |
| 10 | Ga0466657_347582 | 3300042582 | Bacteria | 27209 |
| 11 | Ga0466692_071110 | 3300042591 | Bacteria | 106079 |
| 12 | Meta3P_1002986 | 3300002464 | Unclassified | 15978 |
| 13 | CVPL005W_1000418 | 3300002934 | Bacteria | 17419 |
| 14 | Ga0063521_1000611 | 3300003973 | Bacteria | 14822 |
| 15 | Ga0104019_1003938 | 3300007150 | Bacteria | 3517 |
| 16 | Ga0466730_091663 | 3300042625 | Bacteria | 5756 |
| 17 | Ga0466725_167494 | 3300042654 | Bacteria | 2193 |
| 18 | Ga0466725_383524 | 3300042654 | Bacteria | 30057 |
| 19 | Ga0466727_213853 | 3300042655 | Bacteria | 5159 |
| 20 | Ga0123355_10318955 | 3300009826 | Unclassified | 2096 |
| 21 | Ga0123356_10073006 | 3300010049 | Bacteria | 3225 |
| 22 | Ga0466715_266792 | 3300042616 | Bacteria | 3016 |
| 23 | Ga0160441_100741 | 3300012825 | Bacteria | 17789 |
| 24 | Ga0160433_100005 | 3300012846 | Bacteria | 450229 |
| 25 | Ga0316159_10036 | 3300030930 | Bacteria | 24911 |
| 26 | Ga0466695_204136 | 3300042595 | Bacteria | 6226 |
| 27 | FGTW_contig30468 | 2065487013 | Bacteria | 27157 |
| 28 | SWWA_contig21212__length_4347___numreads_242 | 2100351016 | Bacteria | 4347 |
| 29 | IMNBGM34_c000109 | 3300000036 | Bacteria | 23365 |
| 30 | CVPL010W_10002819 | 3300002931 | Bacteria | 20260 |
| 31 | CVPL010L_1000178 | 3300002932 | Bacteria | 18276 |
| 32 | CVPL005W_1000329 | 3300002934 | Bacteria | 20623 |
| 33 | Ga0102734_1000874 | 3300007129 | Bacteria | 8575 |
| 34 | Ga0102734_1002299 | 3300007129 | Bacteria | 4522 |
| 35 | Ga0103264_1000058 | 3300007188 | Bacteria | 64660 |
| 36 | Ga0127649_100606 | 3300009460 | Bacteria | 38058 |
| 37 | Ga0466734_053157 | 3300042623 | Bacteria | 4897 |
| 38 | Ga0466730_078144 | 3300042625 | Unclassified | 21437 |
| 39 | Ga0530661_000046 | 3300056564 | Bacteria | 137604 |
| 40 | Ga0466716_264558 | 3300042605 | Bacteria | 2396 |
| 41 | Ga0123355_10380509 | 3300009826 | Bacteria | 1840 |
| 42 | Ga0123355_10472564 | 3300009826 | Bacteria | 1566 |
| 43 | Ga0123356_10015593 | 3300010049 | Bacteria | 7278 |
| 44 | Ga0160471_100884 | 3300012812 | Bacteria | 6832 |
| 45 | Ga0160470_100002 | 3300012813 | Bacteria | 1115787 |
| 46 | Ga0466723_139737 | 3300042618 | Bacteria | 33850 |
| 47 | Ga0160447_101667 | 3300012849 | Bacteria | 8406 |
| 48 | Ga0160435_1000319 | 3300012857 | Bacteria | 19961 |
| 49 | Ga0415639_235121 | 3300038395 | Bacteria | 3093 |
| 50 | Ga0466696_342786 | 3300042596 | Bacteria | 2308 |
| 51 | Ga0466701_001528 | 3300042598 | Bacteria | 84063 |
| 52 | DPOL_contig13788 | 2035918003 | Unclassified | 14739 |
| 53 | Ga0074278_117259 | 3300005721 | Bacteria | 176018 |
| 54 | Ga0103266_1000028 | 3300007067 | Bacteria | 136279 |
| 55 | Ga0104019_1191990 | 3300007150 | Unclassified | 1693 |
| 56 | Ga0466704_310732 | 3300042643 | Bacteria | 5472 |
| 57 | Ga0466724_37160 | 3300042649 | Bacteria | 33126 |
| 58 | Ga0466724_47083 | 3300042649 | Bacteria | 378486 |
| 59 | Ga0466707_099973 | 3300042601 | Bacteria | 2620 |
| 60 | Ga0466721_087496 | 3300042608 | Unclassified | 2735 |
| 61 | Ga0466722_079503 | 3300042609 | Bacteria | 26921 |
| 62 | Ga0123355_10271488 | 3300009826 | Bacteria | 2355 |
| 63 | Ga0123356_10003959 | 3300010049 | Bacteria | 15397 |
| 64 | Ga0123356_10155593 | 3300010049 | Unclassified | 2276 |
| 65 | Ga0160466_100190 | 3300012809 | Unclassified | 46352 |
| 66 | Ga0160471_100916 | 3300012812 | Bacteria | 6685 |
| 67 | Ga0160455_100380 | 3300012837 | Unclassified | 25315 |
| 68 | Ga0160433_100769 | 3300012846 | Bacteria | 11758 |
| 69 | Ga0160436_1002918 | 3300012861 | Unclassified | 4261 |
| 70 | Ga0103264_1000088 | 3300007188 | Bacteria | 92446 |
| 71 | Ga0466724_01436 | 3300042649 | Bacteria | 47495 |
| 72 | Ga0466724_21263 | 3300042649 | Unclassified | 2384 |
| 73 | Ga0466724_48325 | 3300042649 | Unclassified | 34409 |
| 74 | Ga0466701_035889 | 3300042598 | Bacteria | 85327 |
| 75 | Ga0466701_054583 | 3300042598 | Bacteria | 8790 |
| 76 | Ga0466701_096949 | 3300042598 | Bacteria | 149718 |
| 77 | Ga0466715_174165 | 3300042616 | Bacteria | 4318 |
| 78 | Ga0466726_347789 | 3300042619 | Bacteria | 126502 |
| 79 | Ga0466729_168231 | 3300042621 | Bacteria | 9378 |
| 80 | Ga0160470_100196 | 3300012813 | Bacteria | 52165 |
| 81 | Ga0160446_100050 | 3300012835 | Bacteria | 126412 |
| 82 | Ga0160460_100210 | 3300012845 | Unclassified | 58769 |
| 83 | Ga0309903_100007 | 3300029809 | Bacteria | 59556 |
| 84 | Ga0466657_390823 | 3300042582 | Bacteria | 58911 |
| 85 | Ga0466696_334333 | 3300042596 | Bacteria | 4029 |
| 86 | DPO_contig06698 | 2032320009 | Unclassified | 45230 |
| 87 | SPBB_contig11519 | 2044078006 | Bacteria | 88906 |
| 88 | CVPL005L_10000023 | 3300002938 | Bacteria | 93435 |
| 89 | CVPL005L_10005701 | 3300002938 | Bacteria | 12690 |
| 90 | Ga0074278_106541 | 3300005721 | Bacteria | 5472 |
| 91 | Ga0103264_1000057 | 3300007188 | Bacteria | 130228 |
| 92 | Ga0105005_1024785 | 3300007505 | Unclassified | 4524 |
| 93 | Ga0466704_562007 | 3300042643 | Bacteria | 20618 |
| 94 | Ga0466725_162566 | 3300042654 | Unclassified | 3409 |
| 95 | Ga0466713_029614 | 3300042602 | Bacteria | 3240 |
| 96 | Ga0466719_216407 | 3300042606 | Bacteria | 1588 |
| 97 | Ga0123357_10053803 | 3300009784 | Bacteria | 5430 |
| 98 | Ga0123356_10005094 | 3300010049 | Bacteria | 13469 |
| 99 | Ga0160456_100023 | 3300012820 | Bacteria | 261249 |
| 100 | Ga0160441_100004 | 3300012825 | Bacteria | 718192 |
| 101 | Ga0160446_102036 | 3300012835 | Bacteria | 3774 |
| 102 | Ga0160460_100263 | 3300012845 | Bacteria | 43732 |
| 103 | Ga0160433_100081 | 3300012846 | Bacteria | 100611 |
| 104 | Ga0160445_105600 | 3300012847 | Bacteria | 2132 |
| 105 | Ga0160436_1005386 | 3300012861 | Bacteria | 3010 |
| 106 | Ga0309901_1000013 | 3300028918 | Bacteria | 346588 |
| 107 | CVPL005L_10003536 | 3300002938 | Bacteria | 17845 |
| 108 | Ga0074278_124338 | 3300005721 | Bacteria | 7243 |
| 109 | Ga0466734_141634 | 3300042623 | Bacteria | 54922 |
| 110 | Ga0466704_001744 | 3300042643 | Bacteria | 1985 |
| 111 | Ga0466709_195383 | 3300042648 | Bacteria | 5433 |
| 112 | Ga0466701_045787 | 3300042598 | Bacteria | 122306 |
| 113 | Ga0466721_240476 | 3300042608 | Bacteria | 1676 |
| 114 | Ga0466710_381390 | 3300042613 | Bacteria | 32855 |
| 115 | Ga0466711_064875 | 3300042615 | Bacteria | 9284 |
| 116 | Ga0466715_002821 | 3300042616 | Bacteria | 3172 |
| 117 | Ga0466718_075979 | 3300042617 | Bacteria | 8572 |
| 118 | Ga0466729_127434 | 3300042621 | Bacteria | 6850 |
| 119 | Ga0160469_100377 | 3300012824 | Unclassified | 23943 |
| 120 | Ga0160472_100507 | 3300012839 | Bacteria | 25850 |
| 121 | Ga0466657_027577 | 3300042582 | Bacteria | 10723 |
| 122 | Ga0466657_072059 | 3300042582 | Bacteria | 1724 |
| 123 | Ga0466696_034402 | 3300042596 | Bacteria | 11934 |
| 124 | Ga0466699_017239 | 3300042597 | Bacteria | 3289 |
| 125 | SPBB_contig11590 | 2044078006 | Unclassified | 23047 |
| 126 | HBC_ctgsDRAFT_1000367 | 3300000333 | Bacteria | 10378 |
| 127 | Ga0102734_1001114 | 3300007129 | Bacteria | 13472 |
| 128 | Ga0466734_172277 | 3300042623 | Bacteria | 4917 |
| 129 | Ga0466709_241557 | 3300042648 | Bacteria | 20578 |
| 130 | Ga0466725_040951 | 3300042654 | Bacteria | 5537 |
| 131 | Ga0466705_367383 | 3300042612 | Bacteria | 23862 |
| 132 | Ga0530661_007319 | 3300056564 | Bacteria | 3138 |
| 133 | Ga0466706_116326 | 3300042599 | Bacteria | 7282 |
| 134 | Ga0466721_003567 | 3300042608 | Bacteria | 7563 |
| 135 | Ga0123355_10143900 | 3300009826 | Bacteria | 3640 |
| 136 | Ga0123355_10147875 | 3300009826 | Bacteria | 3577 |
| 137 | Ga0123355_10230948 | 3300009826 | Unclassified | 2642 |
| 138 | Ga0123356_10002997 | 3300010049 | Bacteria | 17863 |
| 139 | Ga0123353_10006164 | 3300010167 | Bacteria | 15919 |
| 140 | Ga0160440_100299 | 3300012815 | Unclassified | 26925 |
| 141 | Ga0160431_100455 | 3300012828 | Unclassified | 17828 |
| 142 | Ga0160460_100027 | 3300012845 | Bacteria | 328478 |
| 143 | Ga0160445_105474 | 3300012847 | Bacteria | 2169 |
| 144 | Ga0255572_1000119 | 3300026175 | Bacteria | 68049 |
| 145 | Ga0309904_1000009 | 3300029810 | Bacteria | 34343 |
| 146 | DPO_contig00193 | 2032320009 | Bacteria | 10943 |
| 147 | CVPL005L_10000003 | 3300002938 | Bacteria | 280771 |
| 148 | Ga0103264_1000117 | 3300007188 | Bacteria | 53254 |
| 149 | Ga0103264_1004681 | 3300007188 | Bacteria | 6776 |
| 150 | Ga0466734_028212 | 3300042623 | Bacteria | 8400 |
| 151 | Ga0466730_037750 | 3300042625 | Bacteria | 29585 |
| 152 | Ga0466730_057518 | 3300042625 | Bacteria | 2386 |
| 153 | Ga0466724_66004 | 3300042649 | Bacteria | 70192 |
| 154 | Ga0466725_038809 | 3300042654 | Bacteria | 70980 |
| 155 | Ga0466725_461122 | 3300042654 | Bacteria | 9117 |
Family Sequences
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00291 | PALP | Pyridoxal-phosphate dependent enzyme | 64 | 391 | 0.81 |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.93 | 0.95 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.