Protein Family IF11849

Metagenome Isolate
165 Members
46 Samples
156 Scaffolds
802.31 Avg Length

🧬 Representative Sequence

ID
iso_pr_bacteria|2781125695|2781437960|
Length
939 aa
Sequence
MVIAIDGPAGSGKSTIAKLLAQKLHDAEGKGFDYINSGKLYRAIALGCLRTGIDPADNESVITFARDASIQYQNDRLVLNGEDVTEKLHTDEIDLFSAPLSAIVPVRHIVNDIIRNIAKGENVVVEGRDMTSVVFPNAEHRFFLDASVETRAMRRFGQGVSQLGLDEIKTTITQRDEIDRNKIEGSLVISEKVVYIDTSDLTINQVYDILEEKIKWGNQNRGKKMDNLEVVADTSPLDNSPAGNSLAGKGSYGTNQLNLQSPDISESDALKKNTPNAGLADETADSASVKNANSFPGESKDEENIQTQLQEEYLKTLEQLEEGQLVVGVVVQVNEDHVFIDVGYKSEGKIPISAFAQTPKIGDSVPVVLIAKENKRGEVIVSKQKADEKITWKNIKSAHQDNSVVEGTIEKAIKGGFEVNLGSGIKAFLPIRQADVLKIDSPEKLVGEKTFFHVERVYSEGKINIIVNRRKYLEEEFERKRKEFFDTIPIGTDVNGIVKSFTSFGAFIDLGGFDGLLHINDMSWGHVTRPKEFVRKGQEIRLKVIRIDRAEKRINLSLKHFTDDPWVHFEDKYHVNDIVKGKVTKLTEFGAFIEIEEGIEGLAHISEFSWVKKIQKPQEFVKPNDVVECMILGYDLQAGRVSLGLKQVTANPWDDIENRYPLGLRLSRTVVKITNAGAFINLEEGIDGFLHGDDISWTKKIKHPGSELSVGQEIEVMVISLDKENRNIRLGIKQLTDNPWQSFSESYHHGSQVEGEVASVTDFGIFVRVPGGIEGLIHKTNLIENRNDNPDDALKKFKVGDKIRAVVLEVQGDKQKLAFSIKDYQKKMQREELSRYMTEEEDGASTFTLGDIXKSKNNAAEEQSALNTDKDTQQNSEVPDAEGSKAGEEPADMHPADNNPIENQADNPEDSHVENTPDKQPVDFQSEETQPEDSSPESS

📊 Sample Types

Isolate 5.5%
Metagenome 94.5%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 37.8%
Kalotermitidae 31.1%
Unclassified 22.2%
Rhinotermitidae 4.4%
Hodotermitidae 2.2%
Termopsidae 2.2%

🌳 Taxonomy

Archaea 0
Bacteria 161
Eukaryota 0
Viruses 0
Unclassified 4

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125687 Treponema sp. Lab288P4bin29 Isolate Unclassified
2 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
3 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
4 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
5 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
6 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
7 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
8 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
9 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
10 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
11 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
12 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
13 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
14 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
15 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
16 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
17 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
18 2781125633 Treponema sp. Co191P1bin38 Isolate Unclassified
19 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
20 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
21 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
22 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
23 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
24 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
25 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
26 2819994798 Unclassified Spirochaetes Th196P1bin3 Isolate Unclassified
27 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
28 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
29 2781125682 Treponema sp. Lab288P1bin107 Isolate Unclassified
30 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
31 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
32 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
33 2820016619 Unclassified Spirochaetes Nt197P3bin71 Isolate Unclassified
34 2781125658 Treponema sp. Emb289P3bin37 Isolate Unclassified
35 2781125690 Treponema sp. Th196P3bin63 Isolate Unclassified
36 2781125695 Treponema sp. Th196P4bin30 Isolate Unclassified
37 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
38 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
39 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
40 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
41 2781125686 Treponema sp. Lab288P4bin22 Isolate Unclassified
42 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
43 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
44 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
45 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
46 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_018142 3300042612 Unclassified 10666
2 Ga0466705_027941 3300042612 Bacteria 5941
3 Ga0466709_172940 3300042648 Bacteria 6127
4 Ga0466708_138698 3300042652 Bacteria 2155
5 Ga0264413_106755 3300024493 Bacteria 25715
6 Ga0466696_053753 3300042596 Bacteria 23190
7 Ga0466696_178214 3300042596 Bacteria 7433
8 Ga0466699_089262 3300042597 Bacteria 27561
9 Ga0466722_126248 3300042609 Bacteria 4738
10 Ga0466711_504467 3300042615 Bacteria 25230
11 Ga0466715_419773 3300042616 Bacteria 10459
12 Ga0466723_123393 3300042618 Bacteria 21773
13 Ga0466723_134571 3300042618 Bacteria 37387
14 Ga0466726_149859 3300042619 Bacteria 7852
15 JGI24698J34947_10004178 3300002449 Bacteria 7847
16 JGI24695J34938_10010925 3300002450 Bacteria 4930
17 Ga0466705_091160 3300042612 Bacteria 7851
18 Ga0466705_281182 3300042612 Bacteria 4283
19 Ga0466703_081386 3300042636 Bacteria 31630
20 Ga0466703_293153 3300042636 Bacteria 14467
21 Ga0466704_147894 3300042643 Bacteria 10113
22 Ga0466704_266541 3300042643 Bacteria 32514
23 Ga0466704_440467 3300042643 Bacteria 11523
24 Ga0466704_570199 3300042643 Bacteria 12828
25 Ga0466709_403643 3300042648 Bacteria 15968
26 Ga0466690_048663 3300042590 Bacteria 11095
27 Ga0466690_240917 3300042590 Bacteria 13473
28 Ga0466691_040280 3300042593 Bacteria 50816
29 Ga0466699_076425 3300042597 Bacteria 21448
30 Ga0466716_140116 3300042605 Bacteria 14119
31 Ga0466720_099821 3300042607 Bacteria 83537
32 Ga0466723_048411 3300042618 Bacteria 6855
33 Ga0466726_103660 3300042619 Bacteria 15823
34 Ga0466726_104003 3300042619 Bacteria 8639
35 Ga0466726_130430 3300042619 Bacteria 11919
36 Ga0466726_189992 3300042619 Bacteria 49531
37 Ga0466728_127377 3300042620 Bacteria 3120
38 JGI24698J34947_10012515 3300002449 Bacteria 4649
39 Ga0466705_015293 3300042612 Bacteria 20878
40 Ga0466705_162123 3300042612 Bacteria 8295
41 Ga0466704_495134 3300042643 Bacteria 48700
42 Ga0466708_064422 3300042652 Bacteria 47318
43 Ga0466690_072934 3300042590 Bacteria 14264
44 Ga0466706_207839 3300042599 Bacteria 7638
45 Ga0466719_141499 3300042606 Bacteria 48503
46 Ga0466720_156846 3300042607 Bacteria 86259
47 Ga0466721_137114 3300042608 Bacteria 43430
48 Ga0466722_013053 3300042609 Bacteria 15524
49 Ga0466712_008465 3300042614 Bacteria 10621
50 Ga0466712_298873 3300042614 Bacteria 12241
51 Ga0466715_051723 3300042616 Bacteria 23274
52 Ga0466723_101229 3300042618 Bacteria 13955
53 Ga0466705_049995 3300042612 Bacteria 25525
54 Ga0466705_232109 3300042612 Bacteria 13291
55 Ga0466704_070677 3300042643 Bacteria 16242
56 Ga0466704_154976 3300042643 Bacteria 32964
57 Ga0466709_016920 3300042648 Bacteria 17380
58 Ga0466708_264829 3300042652 Bacteria 3776
59 Ga0466708_320973 3300042652 Bacteria 9674
60 Ga0466708_397974 3300042652 Bacteria 25866
61 Ga0466690_001088 3300042590 Bacteria 2125
62 Ga0466692_176309 3300042591 Bacteria 4861
63 Ga0466691_004271 3300042593 Bacteria 8625
64 Ga0466694_301329 3300042594 Bacteria 6015
65 Ga0466699_006774 3300042597 Bacteria 22044
66 Ga0123355_10006185 3300009826 Bacteria 17680
67 Ga0123354_10034170 3300010882 Bacteria 7951
68 Ga0466720_233314 3300042607 Bacteria 12092
69 Ga0466722_035847 3300042609 Bacteria 10338
70 Ga0466705_403670 3300042612 Unclassified 13382
71 Ga0466712_021785 3300042614 Bacteria 7884
72 Ga0466712_313598 3300042614 Bacteria 19352
73 Ga0466715_081158 3300042616 Bacteria 4319
74 Ga0466715_304351 3300042616 Bacteria 6676
75 Ga0466715_552925 3300042616 Bacteria 6469
76 Ga0466723_040574 3300042618 Bacteria 12285
77 Ga0466723_050256 3300042618 Bacteria 7351
78 Ga0466728_041627 3300042620 Bacteria 18579
79 Ga0466728_333868 3300042620 Bacteria 8162
80 JGI24695J34938_10024446 3300002450 Bacteria 2901
81 Ga0466705_078397 3300042612 Bacteria 9275
82 Ga0466692_075206 3300042591 Bacteria 8997
83 Ga0466691_184069 3300042593 Bacteria 5338
84 Ga0466699_181043 3300042597 Bacteria 7010
85 Ga0466722_022288 3300042609 Bacteria 20823
86 Ga0466711_354889 3300042615 Bacteria 35161
87 Ga0466711_373146 3300042615 Bacteria 8238
88 Ga0466726_118348 3300042619 Bacteria 4202
89 JGI24698J34947_10010349 3300002449 Bacteria 5115
90 Ga0466703_046056 3300042636 Bacteria 73078
91 Ga0466703_052378 3300042636 Bacteria 9197
92 Ga0466703_404885 3300042636 Bacteria 3496
93 Ga0466709_195575 3300042648 Bacteria 43370
94 Ga0466691_202726 3300042593 Bacteria 11524
95 Ga0466691_222002 3300042593 Bacteria 16050
96 Ga0466694_053998 3300042594 Bacteria 22359
97 Ga0123353_10141072 3300010167 Bacteria 3860
98 Ga0466716_263448 3300042605 Bacteria 10485
99 Ga0466719_365881 3300042606 Bacteria 27169
100 Ga0466722_175249 3300042609 Bacteria 63620
101 Ga0466705_483888 3300042612 Bacteria 4305
102 Ga0466712_046625 3300042614 Bacteria 8991
103 Ga0466711_172875 3300042615 Bacteria 9490
104 Ga0466726_026746 3300042619 Bacteria 13331
105 Ga0466726_054689 3300042619 Bacteria 6939
106 Ga0466728_082151 3300042620 Bacteria 22320
107 JGI24698J34947_10002711 3300002449 Bacteria 9565
108 JGI24698J34947_10005244 3300002449 Bacteria 7111
109 JGI24695J34938_10009341 3300002450 Unclassified 5460
110 Ga0466705_183474 3300042612 Bacteria 93595
111 Ga0466705_213716 3300042612 Bacteria 8249
112 Ga0466705_220240 3300042612 Bacteria 7731
113 Ga0466732_235512 3300042656 Bacteria 8682
114 Ga0466704_105260 3300042643 Bacteria 45472
115 Ga0466704_470046 3300042643 Bacteria 7561
116 Ga0466708_098923 3300042652 Bacteria 5410
117 Ga0466708_135402 3300042652 Bacteria 8442
118 Ga0466708_235833 3300042652 Bacteria 24736
119 Ga0466693_182738 3300042592 Bacteria 29264
120 Ga0466699_171808 3300042597 Bacteria 7731
121 Ga0123356_10001933 3300010049 Bacteria 22428
122 Ga0466719_102691 3300042606 Bacteria 22550
123 Ga0466711_186535 3300042615 Bacteria 4226
124 Ga0466715_132799 3300042616 Bacteria 20317
125 Ga0466715_420362 3300042616 Bacteria 36991
126 Ga0466715_428670 3300042616 Bacteria 32474
127 Ga0466715_511031 3300042616 Bacteria 17662
128 Ga0466718_010368 3300042617 Bacteria 37109
129 Ga0466718_086776 3300042617 Bacteria 73105
130 Ga0466723_048331 3300042618 Bacteria 25354
131 Ga0466728_066942 3300042620 Bacteria 22999
132 Ga0466728_154650 3300042620 Bacteria 24366
133 Ga0466728_238773 3300042620 Bacteria 5819
134 JGI24698J34947_10003940 3300002449 Bacteria 8072
135 JGI24696J40584_12960052 3300002834 Bacteria 6192
136 Ga0068305_10017959 3300005083 Bacteria 9399
137 Ga0466732_084887 3300042656 Bacteria 9304
138 Ga0466733_188879 3300042659 Bacteria 16600
139 Ga0466703_184110 3300042636 Bacteria 17468
140 Ga0466709_215478 3300042648 Bacteria 19677
141 Ga0466708_288506 3300042652 Bacteria 17766
142 Ga0466694_102765 3300042594 Bacteria 18692
143 Ga0466699_010488 3300042597 Bacteria 10326
144 Ga0466699_043337 3300042597 Unclassified 19509
145 Ga0466719_104615 3300042606 Bacteria 13046
146 Ga0466720_034297 3300042607 Bacteria 26071
147 Ga0466720_114099 3300042607 Bacteria 44632
148 Ga0466722_176545 3300042609 Bacteria 11203
149 Ga0466711_011902 3300042615 Bacteria 8117
150 Ga0466711_107728 3300042615 Bacteria 9042
151 Ga0466711_424059 3300042615 Bacteria 6683
152 Ga0466726_200973 3300042619 Bacteria 13994
153 JGI24698J34947_10002544 3300002449 Bacteria 9840
154 JGI24695J34938_10001541 3300002450 Bacteria 19418
155 JGI24702J35022_10003367 3300002462 Bacteria 9660
156 Ga0068305_10017261 3300005083 Bacteria 18339

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042643 Ga0466704_070677 Ga0466704_070677_3523_5580 665
2 3300042590 Ga0466690_001088 Ga0466690_001088_55_2109 684
3 3300042652 Ga0466708_138698 Ga0466708_138698_89_2143 684
4 3300042612 Ga0466705_018142 Ga0466705_018142_1352_3676 754
5 3300042612 Ga0466705_027941 Ga0466705_027941_3058_5382 754
6 3300042612 Ga0466705_403670 Ga0466705_403670_8114_10438 754
7 3300042636 Ga0466703_052378 Ga0466703_052378_4872_7196 754
8 3300042636 Ga0466703_293153 Ga0466703_293153_7695_10019 754
9 3300042643 Ga0466704_147894 Ga0466704_147894_3495_5819 754
10 3300042643 Ga0466704_470046 Ga0466704_470046_1359_3683 754
11 3300042605 Ga0466716_263448 Ga0466716_263448_7807_10131 755
12 3300042609 Ga0466722_176545 Ga0466722_176545_2473_5088 757
13 3300042616 Ga0466715_511031 Ga0466715_511031_6517_8934 772
14 3300042615 Ga0466711_107728 Ga0466711_107728_5440_7815 773
15 3300042620 Ga0466728_082151 Ga0466728_082151_16474_18849 773
16 3300042616 Ga0466715_419773 Ga0466715_419773_5864_8227 776
17 3300042609 Ga0466722_022288 Ga0466722_022288_13671_16067 778
18 3300042614 Ga0466712_298873 Ga0466712_298873_9335_11764 780
19 3300042616 Ga0466715_051723 Ga0466715_051723_13418_15853 781
20 3300042616 Ga0466715_081158 Ga0466715_081158_1537_3939 781
21 3300042593 Ga0466691_040280 Ga0466691_040280_1697_4090 782
22 3300042593 Ga0466691_184069 Ga0466691_184069_961_3366 783
23 3300042591 Ga0466692_075206 Ga0466692_075206_1389_3746 785
24 3300042605 Ga0466716_140116 Ga0466716_140116_3257_5632 785
25 3300042652 Ga0466708_320973 Ga0466708_320973_5318_7675 785
26 3300042620 Ga0466728_127377 Ga0466728_127377_110_2470 786
27 3300042659 Ga0466733_188879 Ga0466733_188879_7643_10003 786
28 3300042591 Ga0466692_176309 Ga0466692_176309_1290_3653 787
29 3300042596 Ga0466696_178214 Ga0466696_178214_2687_5101 787
30 3300042612 Ga0466705_078397 Ga0466705_078397_4280_6643 787
31 3300042615 Ga0466711_373146 Ga0466711_373146_3019_5382 787
32 3300042636 Ga0466703_404885 Ga0466703_404885_505_2868 787
33 3300042643 Ga0466704_154976 Ga0466704_154976_24259_26622 787
34 3300002450 JGI24695J34938_10001541 JGI24695J34938_100015416 789
35 3300002450 JGI24695J34938_10024446 JGI24695J34938_100244462 789
36 3300042636 Ga0466703_046056 Ga0466703_046056_40405_42810 789
37 3300042619 Ga0466726_054689 Ga0466726_054689_4353_6725 790
38 3300042619 Ga0466726_118348 Ga0466726_118348_1172_3544 790
39 3300042619 Ga0466726_130430 Ga0466726_130430_502_2874 790
40 3300042619 Ga0466726_149859 Ga0466726_149859_4270_6642 790
41 3300042619 Ga0466726_200973 Ga0466726_200973_3683_6055 790
42 3300042596 Ga0466696_053753 Ga0466696_053753_6049_8424 791
43 3300042618 Ga0466723_101229 Ga0466723_101229_6898_9273 791
44 3300042590 Ga0466690_072934 Ga0466690_072934_11520_13913 792
45 3300042597 Ga0466699_181043 Ga0466699_181043_4038_6470 792
46 3300042616 Ga0466715_304351 Ga0466715_304351_2355_4733 792
47 iso_pr_bacteria 2820016619 2820017314 792
48 3300042606 Ga0466719_141499 Ga0466719_141499_22256_24637 793
49 3300042609 Ga0466722_126248 Ga0466722_126248_674_3055 793
50 3300042612 Ga0466705_015293 Ga0466705_015293_3360_5765 794
51 3300042643 Ga0466704_495134 Ga0466704_495134_3142_5547 794
52 3300042597 Ga0466699_006774 Ga0466699_006774_12822_15263 795
53 3300042612 Ga0466705_183474 Ga0466705_183474_68535_70994 795
54 3300042618 Ga0466723_134571 Ga0466723_134571_21588_23999 795
55 3300042609 Ga0466722_175249 Ga0466722_175249_20014_22404 796
56 3300042615 Ga0466711_504467 Ga0466711_504467_13068_15458 796
57 3300042606 Ga0466719_102691 Ga0466719_102691_19949_22342 797
58 3300042618 Ga0466723_123393 Ga0466723_123393_7536_9929 797
59 3300042648 Ga0466709_016920 Ga0466709_016920_5743_8136 797
60 3300042597 Ga0466699_171808 Ga0466699_171808_5266_7716 798
61 3300005083 Ga0068305_10017959 Ga0068305_100179592 799
62 3300042597 Ga0466699_043337 Ga0466699_043337_3304_5781 799
63 3300042608 Ga0466721_137114 Ga0466721_137114_31767_34166 799
64 iso_pr_bacteria 2781125658 2781325445 799
65 3300002834 JGI24696J40584_12960052 JGI24696J40584_129600522 800
66 3300010049 Ga0123356_10001933 Ga0123356_1000193310 800
67 3300002449 JGI24698J34947_10004178 JGI24698J34947_100041785 801
68 3300010167 Ga0123353_10141072 Ga0123353_101410722 801
69 3300024493 Ga0264413_106755 Ga0264413_1067554 801
70 3300042597 Ga0466699_010488 Ga0466699_010488_3097_5556 801
71 3300042597 Ga0466699_089262 Ga0466699_089262_17230_19689 801
72 3300042615 Ga0466711_354889 Ga0466711_354889_12138_14543 801
73 3300042592 Ga0466693_182738 Ga0466693_182738_23294_25750 802
74 3300042593 Ga0466691_222002 Ga0466691_222002_10346_12754 802
75 3300042607 Ga0466720_114099 Ga0466720_114099_27838_30270 802
76 3300042612 Ga0466705_483888 Ga0466705_483888_224_2632 802
77 3300042615 Ga0466711_186535 Ga0466711_186535_80_2488 802
78 3300042617 Ga0466718_086776 Ga0466718_086776_11700_14132 802
79 3300042618 Ga0466723_048331 Ga0466723_048331_13397_15805 802
80 3300002450 JGI24695J34938_10009341 JGI24695J34938_100093414 803
81 3300002450 JGI24695J34938_10010925 JGI24695J34938_100109251 803
82 3300042606 Ga0466719_104615 Ga0466719_104615_8419_10830 803
83 3300042620 Ga0466728_041627 Ga0466728_041627_12066_14477 803
84 3300042652 Ga0466708_135402 Ga0466708_135402_5457_7868 803
85 3300042590 Ga0466690_240917 Ga0466690_240917_7113_9527 804
86 3300042619 Ga0466726_026746 Ga0466726_026746_23_2437 804
87 3300042620 Ga0466728_154650 Ga0466728_154650_9751_12165 804
88 3300042636 Ga0466703_184110 Ga0466703_184110_3618_6053 805
89 3300042590 Ga0466690_048663 Ga0466690_048663_8298_10718 806
90 iso_pr_bacteria 2781125690 2781428648 806
91 3300042594 Ga0466694_053998 Ga0466694_053998_15496_17919 807
92 3300042614 Ga0466712_021785 Ga0466712_021785_3540_5963 807
93 3300042636 Ga0466703_081386 Ga0466703_081386_27117_29540 807
94 3300042652 Ga0466708_064422 Ga0466708_064422_20579_23002 807
95 3300042619 Ga0466726_103660 Ga0466726_103660_9858_12284 808
96 3300042656 Ga0466732_235512 Ga0466732_235512_2840_5290 808
97 3300042597 Ga0466699_076425 Ga0466699_076425_1682_4111 809
98 3300042612 Ga0466705_049995 Ga0466705_049995_11246_13675 809
99 3300042612 Ga0466705_281182 Ga0466705_281182_873_3302 809
100 3300042619 Ga0466726_189992 Ga0466726_189992_21476_23977 809
101 3300042643 Ga0466704_570199 Ga0466704_570199_5157_7586 809
102 3300042648 Ga0466709_195575 Ga0466709_195575_236_2665 809
103 iso_pr_bacteria 2819994798 2819996711 809
104 3300042594 Ga0466694_102765 Ga0466694_102765_8992_11424 810
105 3300042609 Ga0466722_013053 Ga0466722_013053_9071_11548 810
106 3300042652 Ga0466708_098923 Ga0466708_098923_2437_4869 810
107 3300042652 Ga0466708_288506 Ga0466708_288506_14016_16448 810
108 3300042593 Ga0466691_202726 Ga0466691_202726_2064_4499 811
109 3300042612 Ga0466705_162123 Ga0466705_162123_2910_5345 811
110 3300042614 Ga0466712_046625 Ga0466712_046625_1900_4353 811
111 3300042614 Ga0466712_313598 Ga0466712_313598_14691_17126 811
112 3300042616 Ga0466715_420362 Ga0466715_420362_10146_12581 811
113 3300042618 Ga0466723_040574 Ga0466723_040574_2552_4987 811
114 3300042618 Ga0466723_048411 Ga0466723_048411_3532_5967 811
115 3300002449 JGI24698J34947_10002711 JGI24698J34947_100027118 812
116 3300005083 Ga0068305_10017261 Ga0068305_100172615 812
117 3300042593 Ga0466691_004271 Ga0466691_004271_3508_5946 812
118 3300042606 Ga0466719_365881 Ga0466719_365881_12791_15229 812
119 3300042618 Ga0466723_050256 Ga0466723_050256_97_2535 812
120 3300042620 Ga0466728_238773 Ga0466728_238773_2645_5083 812
121 3300042648 Ga0466709_172940 Ga0466709_172940_2204_4642 812
122 3300002449 JGI24698J34947_10002544 JGI24698J34947_100025444 813
123 3300002449 JGI24698J34947_10012515 JGI24698J34947_100125153 813
124 3300042614 Ga0466712_008465 Ga0466712_008465_4512_6953 813
125 3300042619 Ga0466726_104003 Ga0466726_104003_1385_3826 813
126 3300042620 Ga0466728_333868 Ga0466728_333868_2440_4881 813
127 3300002449 JGI24698J34947_10005244 JGI24698J34947_100052445 814
128 3300002449 JGI24698J34947_10010349 JGI24698J34947_100103492 814
129 3300042620 Ga0466728_066942 Ga0466728_066942_15332_17776 814
130 3300042599 Ga0466706_207839 Ga0466706_207839_2437_4887 816
131 3300042612 Ga0466705_220240 Ga0466705_220240_3188_5668 816
132 3300042615 Ga0466711_011902 Ga0466711_011902_4034_6547 816
133 3300042648 Ga0466709_403643 Ga0466709_403643_9247_11745 816
134 3300042652 Ga0466708_264829 Ga0466708_264829_797_3286 817
135 3300042615 Ga0466711_172875 Ga0466711_172875_2216_4819 818
136 3300042616 Ga0466715_428670 Ga0466715_428670_24144_26645 819
137 3300042607 Ga0466720_034297 Ga0466720_034297_9239_11701 820
138 3300042607 Ga0466720_099821 Ga0466720_099821_76751_79213 820
139 3300042607 Ga0466720_156846 Ga0466720_156846_10834_13296 820
140 3300042607 Ga0466720_233314 Ga0466720_233314_3175_5637 820
141 3300042616 Ga0466715_132799 Ga0466715_132799_14896_17688 820
142 3300010882 Ga0123354_10034170 Ga0123354_100341705 821
143 3300042612 Ga0466705_232109 Ga0466705_232109_3218_5683 821
144 3300042648 Ga0466709_215478 Ga0466709_215478_3470_5935 821
145 3300042652 Ga0466708_397974 Ga0466708_397974_20674_23232 821
146 3300042652 Ga0466708_235833 Ga0466708_235833_2070_4538 822
147 3300042656 Ga0466732_084887 Ga0466732_084887_3254_5746 822
148 3300042609 Ga0466722_035847 Ga0466722_035847_5150_7624 824
149 3300042616 Ga0466715_552925 Ga0466715_552925_269_2749 826
150 3300042612 Ga0466705_091160 Ga0466705_091160_3268_5751 827
151 3300042617 Ga0466718_010368 Ga0466718_010368_21050_23533 827
152 3300042643 Ga0466704_440467 Ga0466704_440467_2593_5076 827
153 3300042612 Ga0466705_213716 Ga0466705_213716_2812_5298 828
154 3300042643 Ga0466704_266541 Ga0466704_266541_13830_16316 828
155 3300009826 Ga0123355_10006185 Ga0123355_1000618512 829
156 3300042643 Ga0466704_105260 Ga0466704_105260_23889_26393 834
157 3300042594 Ga0466694_301329 Ga0466694_301329_3370_5955 835
158 3300002449 JGI24698J34947_10003940 JGI24698J34947_100039405 849
159 3300042615 Ga0466711_424059 Ga0466711_424059_2905_5511 854
160 iso_pr_bacteria 2781125633 2781272425 860
161 iso_pr_bacteria 2781125687 2781420145 863
162 3300002462 JGI24702J35022_10003367 JGI24702J35022_100033674 866
163 iso_pr_bacteria 2781125682 2781408893 871
164 iso_pr_bacteria 2781125686 2781418921 915
165 iso_pr_bacteria 2781125695 2781437960 939

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00575 S1 S1 RNA binding domain 669 733 0.97
PF02224 Cytidylate_kin Cytidylate kinase 3 214 0.96
PF23459 579 643 0.86

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF00575 GO:0003676 nucleic acid binding MF

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.47 0.57 Medium

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.