Protein Family IF11837

Metagenome Isolate
149 Members
46 Samples
143 Scaffolds
82.41 Avg Length

🧬 Representative Sequence

ID
iso_pr_bacteria|2781125692|2781430987|
Length
94 aa
Sequence
MMSILLYLSIVMCKDDVYAAVKKLLMDKFGLQEDMISPDKLLEDELDFDSLDAVDLLIYLENHIEGKPESSIFRNVKTVQDVVDILYPLWKNEA

📊 Sample Types

Isolate 4.0%
Metagenome 96.0%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 46.5%
Kalotermitidae 20.9%
Unclassified 18.6%
Termopsidae 7.0%
Rhinotermitidae 4.7%
Hodotermitidae 2.3%

🌳 Taxonomy

Archaea 0
Bacteria 136
Eukaryota 0
Viruses 0
Unclassified 13

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
2 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
3 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
4 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
5 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
6 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
7 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
8 2781125630 Treponema sp. Nt197P3bin60 Isolate Unclassified
9 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
10 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
11 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
12 2030936001 Nasutitermes corniger hindgut microbial communities from Florida, USA Metagenome Termitidae
13 2819992462 Unclassified Spirochaetes Nc150P4bin14 Isolate Unclassified
14 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
15 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
16 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
17 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
18 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
19 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
20 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
21 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
22 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
23 2820020240 Unclassified Spirochaetes Nc150P3bin10 Isolate Unclassified
24 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
25 3300001880 Termite hindgut microbial communities from the Max Planck Institute, Bremen, Germany, analyzing fibers in the hindgut lumen - ASSEMBLED Fiber-Associated Metagenome Metagenome
26 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
27 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
28 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
29 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
30 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
31 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
32 2781125692 Treponema sp. Th196P3bin31 Isolate Unclassified
33 2819990093 Unclassified Spirochaetes Cu122P1bin9 Isolate Unclassified
34 3300005485 Termite gut microbial communities from Costa Rica - P3 luminal contents Metagenome Termitidae
35 2820134530 Unclassified Proteobacteria Emb289P3bin65 Isolate Unclassified
36 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
37 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
38 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
39 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
40 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
41 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
42 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
43 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
44 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
45 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
46 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466732_236748 3300042656 Bacteria 8790
2 Ga0466717_210503 3300042604 Bacteria 2109
3 Ga0466716_093157 3300042605 Bacteria 36386
4 Ga0466719_392636 3300042606 Bacteria 1299
5 Ga0466720_027944 3300042607 Unclassified 5290
6 Ga0466698_032932 3300042610 Bacteria 1096
7 Ga0123353_10198812 3300010167 Bacteria 3156
8 Ga0264413_124817 3300024493 Unclassified 2125
9 Ga0264413_140934 3300024493 Bacteria 1133
10 Ga0466694_045110 3300042594 Bacteria 2414
11 Ga0466704_204916 3300042643 Bacteria 1514
12 Ga0466709_339137 3300042648 Bacteria 15454
13 Ga0466718_008586 3300042617 Bacteria 9677
14 Ga0466718_023427 3300042617 Bacteria 12924
15 Ga0466718_076527 3300042617 Bacteria 2008
16 Ga0466718_096052 3300042617 Bacteria 1026
17 Ga0466718_100257 3300042617 Bacteria 18237
18 Ga0466718_150315 3300042617 Bacteria 9710
19 AustNasuHG_c1004450 3300000089 Bacteria 5023
20 AustNasuHG_c1024011 3300000089 Bacteria 1938
21 AustNasuHG_c1024327 3300000089 Bacteria 1920
22 AustNasuHG_c1074103 3300000089 Bacteria 600
23 JGI24695J34938_10007363 3300002450 Bacteria 6454
24 Ga0072941_1022677 3300005201 Bacteria 18258
25 Ga0074263_141629 3300005485 Bacteria 788
26 Ga0466705_194468 3300042612 Bacteria 25394
27 Ga0466720_070459 3300042607 Bacteria 9574
28 Ga0466720_217425 3300042607 Bacteria 21579
29 Ga0123356_10534903 3300010049 Bacteria 1331
30 Ga0123356_12404205 3300010049 Bacteria 659
31 Ga0264413_117414 3300024493 Bacteria 1087
32 Ga0264413_121764 3300024493 Bacteria 2479
33 Ga0466704_049432 3300042643 Bacteria 1802
34 Ga0466715_254094 3300042616 Bacteria 18771
35 Ga0466718_028853 3300042617 Unclassified 2656
36 Ga0466718_092885 3300042617 Bacteria 6134
37 Ga0466729_127627 3300042621 Bacteria 1182
38 AustNasuHG_c1000619 3300000089 Bacteria 12570
39 AustNasuHG_c1000765 3300000089 Bacteria 11444
40 AustNasuHG_c1003122 3300000089 Bacteria 5973
41 AustNasuHG_c1016910 3300000089 Bacteria 2434
42 JGI24698J34947_10188718 3300002449 Bacteria 817
43 Ga0466732_177296 3300042656 Bacteria 2648
44 Ga0466732_262374 3300042656 Bacteria 16043
45 Ga0466732_292101 3300042656 Bacteria 1824
46 Ga0466707_048949 3300042601 Bacteria 1144
47 Ga0466707_372341 3300042601 Bacteria 1457
48 Ga0466719_119883 3300042606 Bacteria 32227
49 Ga0466720_040642 3300042607 Bacteria 7524
50 Ga0466720_051968 3300042607 Bacteria 35380
51 Ga0466720_072686 3300042607 Bacteria 20088
52 Ga0466720_138447 3300042607 Bacteria 2558
53 Ga0264413_118134 3300024493 Bacteria 5050
54 Ga0466709_349890 3300042648 Bacteria 1998
55 Ga0466718_125754 3300042617 Bacteria 3399
56 Nasutiter_Contig15472 2030936001 Bacteria 502
57 AustNasuHG_c1001691 3300000089 Bacteria 7967
58 AustNasuHG_c1024649 3300000089 Bacteria 1902
59 FAAS_10340050 3300001880 Bacteria 615
60 FAAS_10673681 3300001880 Bacteria 580
61 JGI24702J35022_10198460 3300002462 Bacteria 1147
62 Ga0466732_320499 3300042656 Bacteria 1060
63 Ga0466707_065240 3300042601 Bacteria 2550
64 Ga0264413_141604 3300024493 Bacteria 1513
65 Ga0466715_503150 3300042616 Bacteria 2228
66 Ga0466718_038059 3300042617 Bacteria 14472
67 Ga0466718_098678 3300042617 Bacteria 2873
68 AustNasuHG_c1020808 3300000089 Bacteria 2132
69 FAAS_10297014 3300001880 Unclassified 559
70 JGI24698J34947_10060315 3300002449 Bacteria 1872
71 JGI24705J35276_12220086 3300002504 Bacteria 2244
72 Ga0072940_1033097 3300005200 Bacteria 2425
73 Ga0072940_1111573 3300005200 Unclassified 802
74 Ga0072941_1000456 3300005201 Bacteria 20789
75 Ga0072941_1325384 3300005201 Bacteria 660
76 Ga0074263_131512 3300005485 Unclassified 833
77 Ga0466732_341646 3300042656 Bacteria 2625
78 Ga0466719_285275 3300042606 Bacteria 4555
79 Ga0466720_002785 3300042607 Bacteria 44479
80 Ga0466720_003238 3300042607 Bacteria 32291
81 Ga0466720_025415 3300042607 Bacteria 22188
82 Ga0466720_105231 3300042607 Bacteria 17684
83 Ga0466698_372570 3300042610 Bacteria 1302
84 Ga0123356_10013787 3300010049 Bacteria 7784
85 Ga0123353_10078122 3300010167 Bacteria 5319
86 Ga0264413_101697 3300024493 Bacteria 51877
87 Ga0466692_000624 3300042591 Bacteria 3251
88 Ga0466735_006661 3300042624 Bacteria 12528
89 Ga0466718_016063 3300042617 Bacteria 36821
90 Ga0466718_160855 3300042617 Unclassified 1903
91 Ga0466726_299538 3300042619 Bacteria 2652
92 AustNasuHG_c1052450 3300000089 Bacteria 858
93 FAAS_10434924 3300001880 Bacteria 556
94 JGI24698J34947_10009676 3300002449 Bacteria 5283
95 JGI24698J34947_10242742 3300002449 Unclassified 677
96 Ga0072940_1004784 3300005200 Bacteria 2435
97 Ga0072940_1211173 3300005200 Bacteria 633
98 Ga0466732_368313 3300042656 Bacteria 6284
99 Ga0466706_106808 3300042599 Bacteria 1298
100 Ga0466720_022958 3300042607 Bacteria 5494
101 Ga0466720_228907 3300042607 Unclassified 1546
102 Ga0415639_156335 3300038395 Bacteria 1439
103 Ga0466692_024793 3300042591 Bacteria 12426
104 Ga0466691_206393 3300042593 Bacteria 20362
105 Ga0466708_246011 3300042652 Bacteria 47079
106 Ga0466718_027705 3300042617 Bacteria 21984
107 Ga0466718_091199 3300042617 Bacteria 4679
108 Ga0466718_166483 3300042617 Bacteria 4599
109 AustNasuHG_c1007134 3300000089 Bacteria 3982
110 AustNasuHG_c1018814 3300000089 Bacteria 2273
111 JGI24698J34947_10207409 3300002449 Bacteria 762
112 Ga0072940_1066091 3300005200 Bacteria 1294
113 Ga0074263_129515 3300005485 Bacteria 870
114 Ga0466706_179332 3300042599 Unclassified 1136
115 Ga0466713_093051 3300042602 Bacteria 6833
116 Ga0466717_149847 3300042604 Bacteria 1110
117 Ga0466720_165736 3300042607 Bacteria 6870
118 Ga0466720_213041 3300042607 Bacteria 2185
119 Ga0466698_107671 3300042610 Bacteria 2015
120 Ga0466691_063132 3300042593 Bacteria 13644
121 Ga0466696_270025 3300042596 Unclassified 1656
122 Ga0466718_021939 3300042617 Bacteria 2261
123 Ga0466718_088518 3300042617 Bacteria 10423
124 Ga0466718_122256 3300042617 Bacteria 26403
125 Ga0466700_118877 3300042600 Bacteria 1077
126 Ga0466700_450911 3300042600 Bacteria 1010
127 Ga0466720_045068 3300042607 Unclassified 4347
128 Ga0466720_102668 3300042607 Bacteria 5497
129 Ga0466720_128458 3300042607 Bacteria 29477
130 Ga0466720_149293 3300042607 Bacteria 43020
131 Ga0466720_238860 3300042607 Bacteria 102895
132 Ga0123356_11159382 3300010049 Bacteria 940
133 Ga0264413_131730 3300024493 Bacteria 1171
134 Ga0264413_145429 3300024493 Bacteria 3903
135 Ga0466695_101625 3300042595 Unclassified 5793
136 Ga0466727_161892 3300042655 Bacteria 1020
137 Ga0466712_266351 3300042614 Bacteria 2066
138 Ga0466718_005222 3300042617 Bacteria 8367
139 AustNasuHG_c1000146 3300000089 Bacteria 22298
140 JGI24698J34947_10124781 3300002449 Bacteria 1111
141 Ga0072940_1004782 3300005200 Bacteria 999
142 Ga0072941_1278405 3300005201 Bacteria 2466
143 Ga0074263_117356 3300005485 Bacteria 2694

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042617 Ga0466718_166483 Ga0466718_166483_4377_4586 69
2 3300001880 FAAS_10340050 FAAS_103400502 74
3 3300024493 Ga0264413_145429 Ga0264413_1454296 74
4 3300042596 Ga0466696_270025 Ga0466696_270025_801_1052 77
5 3300042607 Ga0466720_072686 Ga0466720_072686_12505_12738 77
6 3300001880 FAAS_10434924 FAAS_104349242 78
7 3300042607 Ga0466720_025415 Ga0466720_025415_12738_12974 78
8 3300042600 Ga0466700_450911 Ga0466700_450911_188_427 79
9 3300042601 Ga0466707_065240 Ga0466707_065240_1464_1703 79
10 3300042601 Ga0466707_372341 Ga0466707_372341_952_1191 79
11 3300042621 Ga0466729_127627 Ga0466729_127627_460_699 79
12 3300000089 AustNasuHG_c1074103 AustNasuHG_10741032 80
13 3300042604 Ga0466717_210503 Ga0466717_210503_940_1182 80
14 iso_pr_bacteria 2820134530 2820136406 80
15 3300002450 JGI24695J34938_10007363 JGI24695J34938_100073635 81
16 3300010049 Ga0123356_10013787 Ga0123356_100137873 81
17 3300024493 Ga0264413_118134 Ga0264413_1181343 81
18 3300042599 Ga0466706_179332 Ga0466706_179332_769_1014 81
19 3300042602 Ga0466713_093051 Ga0466713_093051_2928_3173 81
20 3300042606 Ga0466719_119883 Ga0466719_119883_18193_18438 81
21 2030936001 Nasutiter_Contig15472 Nasutiterm_1000690 82
22 3300000089 AustNasuHG_c1016910 AustNasuHG_10169102 82
23 3300024493 Ga0264413_101697 Ga0264413_10169713 82
24 3300024493 Ga0264413_117414 Ga0264413_1174142 82
25 3300024493 Ga0264413_121764 Ga0264413_1217644 82
26 3300024493 Ga0264413_124817 Ga0264413_1248173 82
27 3300024493 Ga0264413_140934 Ga0264413_1409342 82
28 3300038395 Ga0415639_156335 Ga0415639_156335_779_1027 82
29 3300042593 Ga0466691_063132 Ga0466691_063132_4315_4563 82
30 3300042593 Ga0466691_206393 Ga0466691_206393_14974_15222 82
31 3300042594 Ga0466694_045110 Ga0466694_045110_746_994 82
32 3300042600 Ga0466700_118877 Ga0466700_118877_666_914 82
33 3300042604 Ga0466717_149847 Ga0466717_149847_257_505 82
34 3300042605 Ga0466716_093157 Ga0466716_093157_21606_21854 82
35 3300042606 Ga0466719_285275 Ga0466719_285275_3637_3885 82
36 3300042607 Ga0466720_002785 Ga0466720_002785_36589_36837 82
37 3300042607 Ga0466720_003238 Ga0466720_003238_9244_9492 82
38 3300042607 Ga0466720_022958 Ga0466720_022958_1908_2156 82
39 3300042607 Ga0466720_027944 Ga0466720_027944_3792_4040 82
40 3300042607 Ga0466720_040642 Ga0466720_040642_4043_4291 82
41 3300042607 Ga0466720_051968 Ga0466720_051968_34228_34476 82
42 3300042607 Ga0466720_070459 Ga0466720_070459_7250_7498 82
43 3300042607 Ga0466720_102668 Ga0466720_102668_1106_1354 82
44 3300042607 Ga0466720_105231 Ga0466720_105231_9457_9705 82
45 3300042607 Ga0466720_128458 Ga0466720_128458_28341_28589 82
46 3300042607 Ga0466720_138447 Ga0466720_138447_284_532 82
47 3300042607 Ga0466720_149293 Ga0466720_149293_36368_36616 82
48 3300042607 Ga0466720_165736 Ga0466720_165736_4015_4263 82
49 3300042607 Ga0466720_213041 Ga0466720_213041_1338_1586 82
50 3300042607 Ga0466720_217425 Ga0466720_217425_19302_19550 82
51 3300042607 Ga0466720_238860 Ga0466720_238860_91832_92080 82
52 3300042610 Ga0466698_107671 Ga0466698_107671_1346_1594 82
53 3300042610 Ga0466698_372570 Ga0466698_372570_672_920 82
54 3300042614 Ga0466712_266351 Ga0466712_266351_1667_1915 82
55 3300042617 Ga0466718_005222 Ga0466718_005222_4175_4423 82
56 3300042617 Ga0466718_008586 Ga0466718_008586_8868_9116 82
57 3300042617 Ga0466718_016063 Ga0466718_016063_34892_35140 82
58 3300042617 Ga0466718_021939 Ga0466718_021939_824_1072 82
59 3300042617 Ga0466718_023427 Ga0466718_023427_2653_2901 82
60 3300042617 Ga0466718_027705 Ga0466718_027705_19666_19914 82
61 3300042617 Ga0466718_028853 Ga0466718_028853_344_592 82
62 3300042617 Ga0466718_038059 Ga0466718_038059_12026_12274 82
63 3300042617 Ga0466718_076527 Ga0466718_076527_402_650 82
64 3300042617 Ga0466718_088518 Ga0466718_088518_4117_4365 82
65 3300042617 Ga0466718_091199 Ga0466718_091199_4340_4588 82
66 3300042617 Ga0466718_092885 Ga0466718_092885_645_893 82
67 3300042617 Ga0466718_096052 Ga0466718_096052_656_904 82
68 3300042617 Ga0466718_098678 Ga0466718_098678_2219_2467 82
69 3300042617 Ga0466718_100257 Ga0466718_100257_11212_11460 82
70 3300042617 Ga0466718_122256 Ga0466718_122256_5192_5440 82
71 3300042617 Ga0466718_125754 Ga0466718_125754_624_872 82
72 3300042617 Ga0466718_150315 Ga0466718_150315_1986_2234 82
73 3300042617 Ga0466718_160855 Ga0466718_160855_1500_1748 82
74 3300042619 Ga0466726_299538 Ga0466726_299538_717_965 82
75 3300042648 Ga0466709_339137 Ga0466709_339137_14756_15004 82
76 3300042652 Ga0466708_246011 Ga0466708_246011_42324_42572 82
77 3300042655 Ga0466727_161892 Ga0466727_161892_259_507 82
78 3300042656 Ga0466732_177296 Ga0466732_177296_2022_2270 82
79 3300042656 Ga0466732_236748 Ga0466732_236748_1022_1270 82
80 3300042656 Ga0466732_262374 Ga0466732_262374_1334_1582 82
81 3300042656 Ga0466732_292101 Ga0466732_292101_1022_1270 82
82 3300042656 Ga0466732_320499 Ga0466732_320499_113_361 82
83 3300042656 Ga0466732_341646 Ga0466732_341646_755_1003 82
84 3300042656 Ga0466732_368313 Ga0466732_368313_3014_3262 82
85 iso_pr_bacteria 2781125630 2781265626 82
86 iso_pr_bacteria 2819990093 2819991598 82
87 iso_pr_bacteria 2819992462 2819993778 82
88 iso_pr_bacteria 2820020240 2820020488 82
89 3300000089 AustNasuHG_c1000146 AustNasuHG_10001469 83
90 3300000089 AustNasuHG_c1000619 AustNasuHG_10006198 83
91 3300000089 AustNasuHG_c1000765 AustNasuHG_100076511 83
92 3300000089 AustNasuHG_c1001691 AustNasuHG_10016917 83
93 3300000089 AustNasuHG_c1003122 AustNasuHG_10031227 83
94 3300000089 AustNasuHG_c1004450 AustNasuHG_10044502 83
95 3300000089 AustNasuHG_c1007134 AustNasuHG_10071346 83
96 3300000089 AustNasuHG_c1018814 AustNasuHG_10188143 83
97 3300000089 AustNasuHG_c1020808 AustNasuHG_10208083 83
98 3300000089 AustNasuHG_c1024327 AustNasuHG_10243272 83
99 3300000089 AustNasuHG_c1024649 AustNasuHG_10246492 83
100 3300000089 AustNasuHG_c1052450 AustNasuHG_10524502 83
101 3300001880 FAAS_10297014 FAAS_102970142 83
102 3300002449 JGI24698J34947_10009676 JGI24698J34947_100096762 83
103 3300002449 JGI24698J34947_10124781 JGI24698J34947_101247812 83
104 3300002449 JGI24698J34947_10188718 JGI24698J34947_101887182 83
105 3300002449 JGI24698J34947_10207409 JGI24698J34947_102074091 83
106 3300002449 JGI24698J34947_10242742 JGI24698J34947_102427422 83
107 3300002504 JGI24705J35276_12220086 JGI24705J35276_122200862 83
108 3300005200 Ga0072940_1004782 Ga0072940_10047822 83
109 3300005200 Ga0072940_1004784 Ga0072940_10047843 83
110 3300005200 Ga0072940_1033097 Ga0072940_10330975 83
111 3300005200 Ga0072940_1066091 Ga0072940_10660912 83
112 3300005200 Ga0072940_1111573 Ga0072940_11115732 83
113 3300005200 Ga0072940_1211173 Ga0072940_12111732 83
114 3300005201 Ga0072941_1000456 Ga0072941_100045622 83
115 3300005485 Ga0074263_117356 Ga0074263_1173562 83
116 3300005485 Ga0074263_129515 Ga0074263_1295152 83
117 3300005485 Ga0074263_131512 Ga0074263_1315122 83
118 3300005485 Ga0074263_141629 Ga0074263_1416292 83
119 3300010049 Ga0123356_11159382 Ga0123356_111593823 83
120 3300010167 Ga0123353_10078122 Ga0123353_100781226 83
121 3300010167 Ga0123353_10198812 Ga0123353_101988126 83
122 3300024493 Ga0264413_131730 Ga0264413_1317302 83
123 3300042591 Ga0466692_000624 Ga0466692_000624_459_710 83
124 3300042591 Ga0466692_024793 Ga0466692_024793_3096_3347 83
125 3300010049 Ga0123356_10534903 Ga0123356_105349032 84
126 3300010049 Ga0123356_12404205 Ga0123356_124042052 84
127 3300024493 Ga0264413_141604 Ga0264413_1416043 84
128 3300042606 Ga0466719_392636 Ga0466719_392636_305_559 84
129 3300042607 Ga0466720_045068 Ga0466720_045068_1047_1301 84
130 3300042607 Ga0466720_228907 Ga0466720_228907_756_1010 84
131 3300042612 Ga0466705_194468 Ga0466705_194468_12320_12574 84
132 3300042616 Ga0466715_503150 Ga0466715_503150_1245_1499 84
133 3300042643 Ga0466704_049432 Ga0466704_049432_198_452 84
134 3300042648 Ga0466709_349890 Ga0466709_349890_1236_1490 84
135 3300002449 JGI24698J34947_10060315 JGI24698J34947_100603151 85
136 3300042595 Ga0466695_101625 Ga0466695_101625_4709_4966 85
137 3300042601 Ga0466707_048949 Ga0466707_048949_625_882 85
138 3300042616 Ga0466715_254094 Ga0466715_254094_16900_17157 85
139 3300000089 AustNasuHG_c1024011 AustNasuHG_10240113 86
140 3300001880 FAAS_10673681 FAAS_106736811 86
141 3300002462 JGI24702J35022_10198460 JGI24702J35022_101984603 86
142 3300005201 Ga0072941_1022677 Ga0072941_10226779 87
143 3300005201 Ga0072941_1278405 Ga0072941_12784053 87
144 3300005201 Ga0072941_1325384 Ga0072941_13253842 87
145 3300042599 Ga0466706_106808 Ga0466706_106808_566_832 88
146 3300042610 Ga0466698_032932 Ga0466698_032932_246_512 88
147 3300042624 Ga0466735_006661 Ga0466735_006661_11942_12208 88
148 3300042643 Ga0466704_204916 Ga0466704_204916_408_677 89
149 iso_pr_bacteria 2781125692 2781430987 94

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00550 PP-binding Phosphopantetheine attachment site 20 85 0.94

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.75 0.8 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.