Protein Family IF11830

Metagenome Isolate
214 Members
63 Samples
208 Scaffolds
150.53 Avg Length

🧬 Representative Sequence

ID
iso_pr_bacteria|2781125687|2781420511|
Length
170 aa
Sequence
MKVIVFIIFWILLARLLKLDNAITKKILFEMEQIDQLINDSSPLLNLCNVREPDFVERCGIALILQSFYNGIENIVVLIMKNKGIILSDGTKWHKDLLSKTFEGNENEYQMFREELKAPLNDYLQFRHFVRHTYGFQLKWGKMKNLFFDMNIIWGKIKEDLNKFLNGKSP

📊 Sample Types

Isolate 2.8%
Metagenome 97.2%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 54.1%
Kalotermitidae 23.0%
Unclassified 11.5%
Rhinotermitidae 4.9%
Termopsidae 4.9%
Hodotermitidae 1.6%

🌳 Taxonomy

Archaea 1
Bacteria 203
Eukaryota 0
Viruses 0
Unclassified 10

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125687 Treponema sp. Lab288P4bin29 Isolate Unclassified
2 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
3 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
4 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
5 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
6 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
7 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
8 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
9 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
10 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
11 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
12 3300005485 Termite gut microbial communities from Costa Rica - P3 luminal contents Metagenome Termitidae
13 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
14 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
15 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
16 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
17 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
18 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
19 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
20 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
21 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
22 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
23 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
24 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
25 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
26 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
27 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
28 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
29 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
30 2781125658 Treponema sp. Emb289P3bin37 Isolate Unclassified
31 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
32 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
33 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
34 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
35 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
36 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
37 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
38 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
39 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
40 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
41 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
42 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
43 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
44 3300002507 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 Metagenome Termitidae
45 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
46 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
47 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
48 2778260939 Unclassified Fibrobacteres Co191P4bin13 Isolate Unclassified
49 2781125662 Treponema sp. Emb289P3bin141 Isolate Unclassified
50 2781125689 Treponema sp. Mp193P4bin9 Isolate Unclassified
51 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
52 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
53 3300001880 Termite hindgut microbial communities from the Max Planck Institute, Bremen, Germany, analyzing fibers in the hindgut lumen - ASSEMBLED Fiber-Associated Metagenome Metagenome
54 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
55 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
56 2781125656 Treponema sp. Emb289P1bin65 Isolate Unclassified
57 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
58 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
59 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
60 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
61 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
62 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
63 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_040355 3300042612 Bacteria 26196
2 Ga0466732_187863 3300042656 Bacteria 6315
3 Ga0466732_310688 3300042656 Bacteria 10531
4 Ga0123353_10181958 3300010167 Bacteria 3326
5 AustNasuHG_c1004000 3300000089 Bacteria 5305
6 JGI24698J34947_10004479 3300002449 Bacteria 7607
7 JGI24698J34947_10023295 3300002449 Bacteria 3313
8 JGI24698J34947_10144295 3300002449 Bacteria 998
9 Ga0466712_256218 3300042614 Bacteria 1367
10 Ga0466711_444940 3300042615 Bacteria 15784
11 Ga0466715_134335 3300042616 Bacteria 1708
12 Ga0466718_048280 3300042617 Bacteria 1030
13 Ga0466718_086068 3300042617 Bacteria 1310
14 Ga0466723_019475 3300042618 Bacteria 3461
15 Ga0466723_134318 3300042618 Bacteria 1248
16 Ga0466728_239086 3300042620 Bacteria 1649
17 Ga0466702_104693 3300042635 Bacteria 1153
18 Ga0466704_083808 3300042643 Bacteria 2403
19 Ga0466704_291206 3300042643 Bacteria 5471
20 Ga0466691_016356 3300042593 Bacteria 2597
21 Ga0466691_179503 3300042593 Bacteria 8017
22 Ga0466695_243244 3300042595 Bacteria 1064
23 Ga0466699_175106 3300042597 Bacteria 2197
24 Ga0466699_247948 3300042597 Bacteria 1981
25 Ga0123355_10065326 3300009826 Bacteria 5860
26 Ga0123356_10509245 3300010049 Bacteria 1361
27 Ga0123356_10725869 3300010049 Bacteria 1163
28 Ga0466707_356097 3300042601 Bacteria 1291
29 Ga0466719_176651 3300042606 Bacteria 1961
30 Ga0466721_052794 3300042608 Bacteria 1333
31 Ga0466698_193884 3300042610 Bacteria 1103
32 AustNasuHG_c1034553 3300000089 Bacteria 1351
33 JGI24698J34947_10065535 3300002449 Unclassified 1771
34 JGI24696J40584_12847462 3300002834 Bacteria 971
35 Ga0466705_413540 3300042612 Unclassified 4232
36 Ga0466712_013430 3300042614 Bacteria 12564
37 Ga0466712_134438 3300042614 Bacteria 2734
38 Ga0466711_083561 3300042615 Bacteria 3207
39 Ga0466728_166145 3300042620 Bacteria 2056
40 Ga0466731_113984 3300042622 Bacteria 2730
41 Ga0466704_317066 3300042643 Bacteria 1325
42 Ga0466709_336207 3300042648 Bacteria 2537
43 Ga0466727_125378 3300042655 Bacteria 7325
44 Ga0466705_223477 3300042612 Bacteria 17532
45 Ga0466705_363789 3300042612 Archaea 3906
46 Ga0466733_014241 3300042659 Bacteria 4053
47 Ga0466690_280933 3300042590 Bacteria 1235
48 Ga0466694_088498 3300042594 Bacteria 2539
49 Ga0466694_134104 3300042594 Bacteria 1012
50 Ga0466696_251570 3300042596 Bacteria 1767
51 Ga0123356_10031278 3300010049 Bacteria 4981
52 Ga0466701_095731 3300042598 Bacteria 1177
53 Ga0466706_136686 3300042599 Bacteria 1223
54 Ga0466716_323901 3300042605 Bacteria 1359
55 Ga0466719_314946 3300042606 Bacteria 1135
56 Ga0466721_327903 3300042608 Bacteria 1181
57 Ga0466722_112204 3300042609 Bacteria 1971
58 JGI24698J34947_10000063 3300002449 Bacteria 33343
59 JGI24698J34947_10017947 3300002449 Bacteria 3830
60 Ga0466705_428010 3300042612 Bacteria 1087
61 Ga0466712_040915 3300042614 Bacteria 2752
62 Ga0466712_191479 3300042614 Bacteria 2373
63 Ga0466718_004027 3300042617 Bacteria 1641
64 Ga0466728_299057 3300042620 Bacteria 1181
65 Ga0466702_262439 3300042635 Bacteria 1445
66 Ga0466702_379432 3300042635 Bacteria 1807
67 Ga0466703_162391 3300042636 Bacteria 1308
68 Ga0466704_450823 3300042643 Bacteria 2444
69 Ga0466708_160025 3300042652 Bacteria 1266
70 Ga0466708_362710 3300042652 Bacteria 1094
71 Ga0466705_237127 3300042612 Bacteria 1489
72 Ga0466732_225393 3300042656 Bacteria 3122
73 Ga0466732_401143 3300042656 Bacteria 2684
74 Ga0466733_068272 3300042659 Bacteria 11849
75 Ga0264413_123129 3300024493 Unclassified 3603
76 Ga0415639_162705 3300038395 Bacteria 1514
77 Ga0456237_0004015 3300041968 Bacteria 2368
78 Ga0466690_307181 3300042590 Bacteria 1263
79 Ga0466694_023028 3300042594 Bacteria 61948
80 Ga0466695_212494 3300042595 Bacteria 1524
81 Ga0466696_035760 3300042596 Bacteria 1468
82 Ga0123356_10151137 3300010049 Bacteria 2305
83 Ga0466717_027610 3300042604 Bacteria 1399
84 Ga0466720_103230 3300042607 Bacteria 5340
85 Ga0466720_150669 3300042607 Bacteria 89971
86 Ga0466721_397095 3300042608 Bacteria 1350
87 JGI24698J34947_10056246 3300002449 Bacteria 1957
88 JGI24698J34947_10245704 3300002449 Bacteria 671
89 JGI24702J35022_10005984 3300002462 Bacteria 7065
90 JGI24697J35500_11111771 3300002507 Bacteria 1200
91 Ga0072940_1003501 3300005200 Bacteria 6886
92 Ga0074263_134527 3300005485 Bacteria 889
93 Ga0466712_122612 3300042614 Bacteria 1231
94 Ga0466712_265305 3300042614 Bacteria 8092
95 Ga0466728_174359 3300042620 Bacteria 6330
96 Ga0466703_414975 3300042636 Bacteria 9788
97 Ga0466704_027790 3300042643 Bacteria 3865
98 Ga0466704_111836 3300042643 Bacteria 3204
99 Ga0466705_347102 3300042612 Bacteria 1817
100 Ga0466732_321011 3300042656 Bacteria 1317
101 Ga0466733_046107 3300042659 Bacteria 1016
102 Ga0264413_142071 3300024493 Bacteria 1595
103 Ga0466696_071110 3300042596 Bacteria 1115
104 Ga0466696_179518 3300042596 Bacteria 1753
105 Ga0123356_10211681 3300010049 Bacteria 1988
106 Ga0123353_11564385 3300010167 Bacteria 835
107 Ga0466700_477060 3300042600 Bacteria 1406
108 Ga0466720_055641 3300042607 Bacteria 5519
109 JGI24698J34947_10070842 3300002449 Bacteria 1676
110 JGI24698J34947_10317743 3300002449 Unclassified 555
111 Ga0466712_296131 3300042614 Bacteria 2523
112 Ga0466711_142810 3300042615 Bacteria 1295
113 Ga0466726_028924 3300042619 Bacteria 2097
114 Ga0466731_163395 3300042622 Bacteria 1887
115 Ga0466731_367980 3300042622 Bacteria 5289
116 Ga0466702_171886 3300042635 Bacteria 2531
117 Ga0466709_351589 3300042648 Bacteria 1170
118 Ga0466705_101330 3300042612 Bacteria 1893
119 Ga0466705_193600 3300042612 Bacteria 1747
120 Ga0466732_044983 3300042656 Unclassified 1019
121 Ga0466732_063648 3300042656 Bacteria 1809
122 Ga0466733_096849 3300042659 Bacteria 1317
123 Ga0466657_192472 3300042582 Bacteria 1155
124 Ga0466690_330910 3300042590 Bacteria 8873
125 Ga0466695_043199 3300042595 Bacteria 1217
126 Ga0123355_10171569 3300009826 Bacteria 3241
127 Ga0466706_213418 3300042599 Bacteria 1054
128 Ga0466707_401167 3300042601 Bacteria 1187
129 Ga0466720_074835 3300042607 Bacteria 1124
130 Ga0466720_097047 3300042607 Bacteria 1104
131 Ga0466722_105825 3300042609 Bacteria 4495
132 JGI24698J34947_10034886 3300002449 Bacteria 2629
133 JGI24698J34947_10096245 3300002449 Bacteria 1343
134 JGI24698J34947_10120211 3300002449 Bacteria 1141
135 JGI24698J34947_10192788 3300002449 Unclassified 805
136 JGI24698J34947_10293225 3300002449 Unclassified 589
137 Ga0466711_398683 3300042615 Bacteria 1105
138 Ga0466729_293501 3300042621 Bacteria 2665
139 Ga0466734_163135 3300042623 Bacteria 1047
140 Ga0466704_220960 3300042643 Bacteria 1686
141 Ga0466724_15938 3300042649 Bacteria 2072
142 Ga0466727_202453 3300042655 Bacteria 2072
143 Ga0466727_335948 3300042655 Bacteria 3321
144 Ga0466705_009414 3300042612 Bacteria 4547
145 Ga0466705_183230 3300042612 Bacteria 2997
146 Ga0466733_019020 3300042659 Bacteria 5238
147 Ga0264413_136415 3300024493 Bacteria 1561
148 Ga0456237_0022496 3300041968 Bacteria 866
149 Ga0466656_241966 3300042550 Bacteria 1512
150 Ga0466690_217694 3300042590 Bacteria 1311
151 Ga0466691_040466 3300042593 Bacteria 8214
152 Ga0466696_500810 3300042596 Bacteria 2618
153 Ga0466699_393806 3300042597 Bacteria 1518
154 Ga0123356_10000505 3300010049 Bacteria 43649
155 Ga0123356_11302124 3300010049 Bacteria 890
156 Ga0123353_10921046 3300010167 Bacteria 1187
157 Ga0466701_095066 3300042598 Bacteria 3269
158 Ga0466716_381512 3300042605 Bacteria 1093
159 Ga0466719_105837 3300042606 Bacteria 1050
160 Ga0466719_261350 3300042606 Bacteria 1274
161 Ga0466719_279440 3300042606 Bacteria 17066
162 AustNasuHG_c1022694 3300000089 Bacteria 2013
163 AustNasuHG_c1047764 3300000089 Bacteria 950
164 JGI24698J34947_10024664 3300002449 Bacteria 3210
165 JGI24698J34947_10038600 3300002449 Bacteria 2476
166 JGI24695J34938_10122867 3300002450 Bacteria 1057
167 JGI24695J34938_10582037 3300002450 Bacteria 520
168 JGI24702J35022_10850880 3300002462 Bacteria 568
169 JGI24705J35276_11878040 3300002504 Bacteria 734
170 JGI24696J40584_12624527 3300002834 Unclassified 674
171 JGI24696J40584_12953755 3300002834 Bacteria 2530
172 JGI24696J40584_12955244 3300002834 Unclassified 2793
173 Ga0466729_065484 3300042621 Bacteria 2328
174 Ga0466735_193781 3300042624 Bacteria 1058
175 Ga0466702_462006 3300042635 Bacteria 1670
176 Ga0466704_563100 3300042643 Bacteria 1736
177 Ga0466727_331133 3300042655 Bacteria 1518
178 Ga0466733_081226 3300042659 Bacteria 2704
179 Ga0466694_091434 3300042594 Bacteria 1183
180 Ga0466694_198946 3300042594 Bacteria 14685
181 Ga0466694_227051 3300042594 Bacteria 2187
182 Ga0123357_10461722 3300009784 Bacteria 1091
183 Ga0123356_10012541 3300010049 Bacteria 8218
184 Ga0123356_10098416 3300010049 Bacteria 2801
185 Ga0123356_10122362 3300010049 Unclassified 2534
186 Ga0123356_11407743 3300010049 Bacteria 857
187 Ga0123353_12225673 3300010167 Bacteria 662
188 Ga0466717_289334 3300042604 Bacteria 4292
189 Ga0466719_008609 3300042606 Bacteria 2778
190 Ga0466719_359600 3300042606 Bacteria 2206
191 AustNasuHG_c1031948 3300000089 Bacteria 1473
192 FAAS_10267415 3300001880 Bacteria 512
193 JGI24698J34947_10019745 3300002449 Bacteria 3632
194 JGI24698J34947_10027520 3300002449 Bacteria 3016
195 Ga0072940_1045227 3300005200 Bacteria 1034
196 Ga0466712_068659 3300042614 Bacteria 15970
197 Ga0466712_077906 3300042614 Bacteria 3200
198 Ga0466712_240664 3300042614 Bacteria 1302
199 Ga0466712_307523 3300042614 Bacteria 8537
200 Ga0466718_068909 3300042617 Bacteria 9706
201 Ga0466726_454512 3300042619 Bacteria 3958
202 Ga0466728_232400 3300042620 Bacteria 6693
203 Ga0466703_071104 3300042636 Bacteria 4128
204 Ga0466704_089593 3300042643 Bacteria 3762
205 Ga0466704_322121 3300042643 Bacteria 10700
206 Ga0466704_366372 3300042643 Bacteria 6412
207 Ga0466709_326808 3300042648 Bacteria 1321
208 Ga0466708_034520 3300042652 Bacteria 1001

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300000089 AustNasuHG_c1047764 AustNasuHG_10477642 126
2 3300042596 Ga0466696_179518 Ga0466696_179518_1307_1711 134
3 3300041968 Ga0456237_0022496 Ga0456237_0022496_301_750 135
4 3300042594 Ga0466694_134104 Ga0466694_134104_517_924 135
5 3300042598 Ga0466701_095066 Ga0466701_095066_2747_3154 135
6 3300042601 Ga0466707_401167 Ga0466707_401167_592_1002 136
7 3300042643 Ga0466704_291206 Ga0466704_291206_3809_4228 139
8 3300002449 JGI24698J34947_10034886 JGI24698J34947_100348863 140
9 3300005485 Ga0074263_134527 Ga0074263_1345272 140
10 3300042597 Ga0466699_175106 Ga0466699_175106_761_1213 140
11 3300042614 Ga0466712_307523 Ga0466712_307523_1216_1638 140
12 3300042615 Ga0466711_398683 Ga0466711_398683_336_791 141
13 3300005200 Ga0072940_1045227 Ga0072940_10452271 142
14 3300042593 Ga0466691_040466 Ga0466691_040466_6787_7215 142
15 3300042624 Ga0466735_193781 Ga0466735_193781_243_695 142
16 3300042614 Ga0466712_040915 Ga0466712_040915_928_1383 143
17 3300010049 Ga0123356_10000505 Ga0123356_1000050526 144
18 3300042609 Ga0466722_105825 Ga0466722_105825_3862_4296 144
19 3300042643 Ga0466704_366372 Ga0466704_366372_3893_4330 145
20 3300042614 Ga0466712_134438 Ga0466712_134438_1451_1891 146
21 3300042604 Ga0466717_289334 Ga0466717_289334_511_954 147
22 3300042659 Ga0466733_068272 Ga0466733_068272_1903_2346 147
23 3300000089 AustNasuHG_c1031948 AustNasuHG_10319483 148
24 3300001880 FAAS_10267415 FAAS_102674151 148
25 3300042655 Ga0466727_202453 Ga0466727_202453_556_1002 148
26 3300042655 Ga0466727_335948 Ga0466727_335948_521_967 148
27 iso_pr_bacteria 2778260939 2778351936 148
28 3300002449 JGI24698J34947_10027520 JGI24698J34947_100275201 149
29 3300002834 JGI24696J40584_12955244 JGI24696J40584_129552445 149
30 3300042599 Ga0466706_213418 Ga0466706_213418_476_925 149
31 3300042614 Ga0466712_013430 Ga0466712_013430_9743_10192 149
32 3300042614 Ga0466712_068659 Ga0466712_068659_12915_13364 149
33 3300042614 Ga0466712_077906 Ga0466712_077906_219_668 149
34 3300042614 Ga0466712_122612 Ga0466712_122612_456_905 149
35 3300042614 Ga0466712_256218 Ga0466712_256218_112_561 149
36 3300042614 Ga0466712_296131 Ga0466712_296131_400_849 149
37 3300042635 Ga0466702_171886 Ga0466702_171886_1094_1543 149
38 3300042659 Ga0466733_019020 Ga0466733_019020_465_914 149
39 3300002449 JGI24698J34947_10000063 JGI24698J34947_1000006335 150
40 3300002449 JGI24698J34947_10004479 JGI24698J34947_100044794 150
41 3300002449 JGI24698J34947_10024664 JGI24698J34947_100246642 150
42 3300002449 JGI24698J34947_10038600 JGI24698J34947_100386005 150
43 3300002449 JGI24698J34947_10065535 JGI24698J34947_100655351 150
44 3300002449 JGI24698J34947_10096245 JGI24698J34947_100962451 150
45 3300002449 JGI24698J34947_10120211 JGI24698J34947_101202113 150
46 3300002449 JGI24698J34947_10144295 JGI24698J34947_101442952 150
47 3300002449 JGI24698J34947_10192788 JGI24698J34947_101927881 150
48 3300002449 JGI24698J34947_10245704 JGI24698J34947_102457041 150
49 3300002449 JGI24698J34947_10317743 JGI24698J34947_103177431 150
50 3300002507 JGI24697J35500_11111771 JGI24697J35500_111117713 150
51 3300024493 Ga0264413_123129 Ga0264413_1231298 150
52 3300024493 Ga0264413_136415 Ga0264413_1364152 150
53 3300024493 Ga0264413_142071 Ga0264413_1420713 150
54 3300041968 Ga0456237_0004015 Ga0456237_0004015_180_632 150
55 3300042550 Ga0466656_241966 Ga0466656_241966_511_963 150
56 3300042582 Ga0466657_192472 Ga0466657_192472_137_589 150
57 3300042590 Ga0466690_330910 Ga0466690_330910_8370_8822 150
58 3300042594 Ga0466694_023028 Ga0466694_023028_22661_23113 150
59 3300042594 Ga0466694_198946 Ga0466694_198946_3639_4091 150
60 3300042595 Ga0466695_043199 Ga0466695_043199_516_968 150
61 3300042595 Ga0466695_212494 Ga0466695_212494_480_932 150
62 3300042595 Ga0466695_243244 Ga0466695_243244_278_730 150
63 3300042596 Ga0466696_251570 Ga0466696_251570_519_971 150
64 3300042597 Ga0466699_247948 Ga0466699_247948_245_697 150
65 3300042597 Ga0466699_393806 Ga0466699_393806_517_969 150
66 3300042598 Ga0466701_095731 Ga0466701_095731_503_955 150
67 3300042600 Ga0466700_477060 Ga0466700_477060_101_553 150
68 3300042601 Ga0466707_356097 Ga0466707_356097_448_900 150
69 3300042604 Ga0466717_027610 Ga0466717_027610_527_979 150
70 3300042606 Ga0466719_261350 Ga0466719_261350_560_1012 150
71 3300042607 Ga0466720_055641 Ga0466720_055641_2896_3348 150
72 3300042607 Ga0466720_074835 Ga0466720_074835_164_616 150
73 3300042607 Ga0466720_097047 Ga0466720_097047_472_924 150
74 3300042608 Ga0466721_052794 Ga0466721_052794_866_1318 150
75 3300042608 Ga0466721_327903 Ga0466721_327903_642_1094 150
76 3300042608 Ga0466721_397095 Ga0466721_397095_490_942 150
77 3300042612 Ga0466705_040355 Ga0466705_040355_23760_24212 150
78 3300042612 Ga0466705_101330 Ga0466705_101330_1221_1673 150
79 3300042612 Ga0466705_183230 Ga0466705_183230_1884_2336 150
80 3300042612 Ga0466705_193600 Ga0466705_193600_1129_1581 150
81 3300042612 Ga0466705_223477 Ga0466705_223477_16956_17408 150
82 3300042612 Ga0466705_413540 Ga0466705_413540_1658_2110 150
83 3300042612 Ga0466705_428010 Ga0466705_428010_130_582 150
84 3300042614 Ga0466712_240664 Ga0466712_240664_395_847 150
85 3300042615 Ga0466711_083561 Ga0466711_083561_1935_2387 150
86 3300042615 Ga0466711_444940 Ga0466711_444940_4459_4911 150
87 3300042617 Ga0466718_004027 Ga0466718_004027_1081_1533 150
88 3300042617 Ga0466718_048280 Ga0466718_048280_283_735 150
89 3300042617 Ga0466718_068909 Ga0466718_068909_4896_5348 150
90 3300042617 Ga0466718_086068 Ga0466718_086068_738_1190 150
91 3300042618 Ga0466723_134318 Ga0466723_134318_188_640 150
92 3300042619 Ga0466726_454512 Ga0466726_454512_2858_3310 150
93 3300042621 Ga0466729_065484 Ga0466729_065484_1845_2297 150
94 3300042621 Ga0466729_293501 Ga0466729_293501_377_829 150
95 3300042622 Ga0466731_113984 Ga0466731_113984_327_779 150
96 3300042623 Ga0466734_163135 Ga0466734_163135_179_631 150
97 3300042635 Ga0466702_379432 Ga0466702_379432_1264_1716 150
98 3300042635 Ga0466702_462006 Ga0466702_462006_274_726 150
99 3300042636 Ga0466703_162391 Ga0466703_162391_591_1043 150
100 3300042636 Ga0466703_414975 Ga0466703_414975_8393_8845 150
101 3300042643 Ga0466704_089593 Ga0466704_089593_759_1211 150
102 3300042643 Ga0466704_111836 Ga0466704_111836_491_943 150
103 3300042643 Ga0466704_220960 Ga0466704_220960_601_1053 150
104 3300042643 Ga0466704_317066 Ga0466704_317066_363_815 150
105 3300042648 Ga0466709_336207 Ga0466709_336207_840_1292 150
106 3300042652 Ga0466708_034520 Ga0466708_034520_12_464 150
107 3300042652 Ga0466708_160025 Ga0466708_160025_531_983 150
108 3300042652 Ga0466708_362710 Ga0466708_362710_40_492 150
109 3300042656 Ga0466732_044983 Ga0466732_044983_416_868 150
110 3300042656 Ga0466732_063648 Ga0466732_063648_396_848 150
111 3300042656 Ga0466732_187863 Ga0466732_187863_4474_4926 150
112 3300042656 Ga0466732_225393 Ga0466732_225393_2225_2677 150
113 3300042656 Ga0466732_321011 Ga0466732_321011_193_645 150
114 3300042656 Ga0466732_401143 Ga0466732_401143_1360_1812 150
115 3300042659 Ga0466733_014241 Ga0466733_014241_2539_2991 150
116 3300042659 Ga0466733_081226 Ga0466733_081226_2149_2601 150
117 3300042659 Ga0466733_096849 Ga0466733_096849_830_1282 150
118 iso_pr_bacteria 2781125656 2781321251 150
119 iso_pr_bacteria 2781125658 2781324757 150
120 iso_pr_bacteria 2781125689 2781425696 150
121 3300000089 AustNasuHG_c1022694 AustNasuHG_10226942 151
122 3300000089 AustNasuHG_c1034553 AustNasuHG_10345533 151
123 3300002449 JGI24698J34947_10017947 JGI24698J34947_100179472 151
124 3300002449 JGI24698J34947_10019745 JGI24698J34947_100197454 151
125 3300002449 JGI24698J34947_10056246 JGI24698J34947_100562462 151
126 3300002449 JGI24698J34947_10293225 JGI24698J34947_102932251 151
127 3300002450 JGI24695J34938_10122867 JGI24695J34938_101228672 151
128 3300002450 JGI24695J34938_10582037 JGI24695J34938_105820371 151
129 3300002462 JGI24702J35022_10850880 JGI24702J35022_108508801 151
130 3300002834 JGI24696J40584_12847462 JGI24696J40584_128474622 151
131 3300002834 JGI24696J40584_12953755 JGI24696J40584_129537552 151
132 3300005200 Ga0072940_1003501 Ga0072940_10035014 151
133 3300009826 Ga0123355_10065326 Ga0123355_100653264 151
134 3300010049 Ga0123356_10122362 Ga0123356_101223623 151
135 3300010049 Ga0123356_10725869 Ga0123356_107258691 151
136 3300010049 Ga0123356_11302124 Ga0123356_113021242 151
137 3300010167 Ga0123353_10921046 Ga0123353_109210463 151
138 3300042590 Ga0466690_217694 Ga0466690_217694_432_887 151
139 3300042590 Ga0466690_280933 Ga0466690_280933_274_729 151
140 3300042590 Ga0466690_307181 Ga0466690_307181_419_874 151
141 3300042593 Ga0466691_179503 Ga0466691_179503_6710_7165 151
142 3300042596 Ga0466696_035760 Ga0466696_035760_810_1265 151
143 3300042605 Ga0466716_323901 Ga0466716_323901_309_764 151
144 3300042606 Ga0466719_008609 Ga0466719_008609_1479_1934 151
145 3300042606 Ga0466719_105837 Ga0466719_105837_110_565 151
146 3300042606 Ga0466719_314946 Ga0466719_314946_16_471 151
147 3300042606 Ga0466719_359600 Ga0466719_359600_1011_1466 151
148 3300042607 Ga0466720_103230 Ga0466720_103230_2395_2850 151
149 3300042607 Ga0466720_150669 Ga0466720_150669_76192_76647 151
150 3300042609 Ga0466722_112204 Ga0466722_112204_1379_1834 151
151 3300042612 Ga0466705_347102 Ga0466705_347102_702_1157 151
152 3300042616 Ga0466715_134335 Ga0466715_134335_1043_1498 151
153 3300042620 Ga0466728_174359 Ga0466728_174359_5211_5666 151
154 3300042620 Ga0466728_232400 Ga0466728_232400_1909_2364 151
155 3300042620 Ga0466728_299057 Ga0466728_299057_220_675 151
156 3300042643 Ga0466704_027790 Ga0466704_027790_353_808 151
157 3300042643 Ga0466704_450823 Ga0466704_450823_522_977 151
158 3300042643 Ga0466704_563100 Ga0466704_563100_559_1014 151
159 3300042648 Ga0466709_326808 Ga0466709_326808_497_952 151
160 3300042648 Ga0466709_351589 Ga0466709_351589_660_1115 151
161 3300042659 Ga0466733_046107 Ga0466733_046107_531_986 151
162 3300000089 AustNasuHG_c1004000 AustNasuHG_10040004 152
163 3300002462 JGI24702J35022_10005984 JGI24702J35022_100059843 152
164 3300009826 Ga0123355_10171569 Ga0123355_101715696 152
165 3300038395 Ga0415639_162705 Ga0415639_162705_943_1401 152
166 3300042593 Ga0466691_016356 Ga0466691_016356_448_906 152
167 3300042596 Ga0466696_500810 Ga0466696_500810_1770_2228 152
168 3300042606 Ga0466719_279440 Ga0466719_279440_1283_1741 152
169 3300042620 Ga0466728_166145 Ga0466728_166145_182_640 152
170 3300042622 Ga0466731_367980 Ga0466731_367980_701_1159 152
171 3300042635 Ga0466702_262439 Ga0466702_262439_254_712 152
172 3300042656 Ga0466732_310688 Ga0466732_310688_8823_9281 152
173 3300002449 JGI24698J34947_10023295 JGI24698J34947_100232951 153
174 3300002834 JGI24696J40584_12624527 JGI24696J40584_126245271 153
175 3300010049 Ga0123356_11407743 Ga0123356_114077432 153
176 3300010167 Ga0123353_12225673 Ga0123353_122256731 153
177 3300042606 Ga0466719_176651 Ga0466719_176651_29_490 153
178 3300042612 Ga0466705_237127 Ga0466705_237127_690_1151 153
179 3300042615 Ga0466711_142810 Ga0466711_142810_526_987 153
180 3300042622 Ga0466731_163395 Ga0466731_163395_1009_1470 153
181 3300042655 Ga0466727_331133 Ga0466727_331133_449_910 153
182 3300010049 Ga0123356_10012541 Ga0123356_100125417 154
183 3300010049 Ga0123356_10031278 Ga0123356_100312783 154
184 3300010167 Ga0123353_11564385 Ga0123353_115643851 154
185 3300042620 Ga0466728_239086 Ga0466728_239086_357_821 154
186 iso_pr_bacteria 2781125662 2781335886 154
187 3300002449 JGI24698J34947_10070842 JGI24698J34947_100708423 155
188 3300010049 Ga0123356_10211681 Ga0123356_102116811 155
189 3300042599 Ga0466706_136686 Ga0466706_136686_718_1185 155
190 3300042605 Ga0466716_381512 Ga0466716_381512_371_838 155
191 3300042612 Ga0466705_363789 Ga0466705_363789_59_526 155
192 3300042643 Ga0466704_083808 Ga0466704_083808_848_1315 155
193 3300042655 Ga0466727_125378 Ga0466727_125378_6767_7234 155
194 3300009784 Ga0123357_10461722 Ga0123357_104617222 156
195 3300042649 Ga0466724_15938 Ga0466724_15938_1484_1954 156
196 3300010049 Ga0123356_10151137 Ga0123356_101511373 157
197 3300010167 Ga0123353_10181958 Ga0123353_101819585 157
198 3300042594 Ga0466694_088498 Ga0466694_088498_765_1238 157
199 3300042594 Ga0466694_091434 Ga0466694_091434_395_868 157
200 3300042594 Ga0466694_227051 Ga0466694_227051_1483_1956 157
201 3300042596 Ga0466696_071110 Ga0466696_071110_172_645 157
202 3300042612 Ga0466705_009414 Ga0466705_009414_1728_2201 157
203 3300042614 Ga0466712_191479 Ga0466712_191479_808_1281 157
204 3300042614 Ga0466712_265305 Ga0466712_265305_6237_6710 157
205 3300042618 Ga0466723_019475 Ga0466723_019475_2827_3300 157
206 3300042619 Ga0466726_028924 Ga0466726_028924_599_1078 159
207 3300010049 Ga0123356_10098416 Ga0123356_100984163 160
208 3300042643 Ga0466704_322121 Ga0466704_322121_1215_1703 162
209 3300002504 JGI24705J35276_11878040 JGI24705J35276_118780401 163
210 3300042610 Ga0466698_193884 Ga0466698_193884_474_965 163
211 3300010049 Ga0123356_10509245 Ga0123356_105092452 165
212 3300042636 Ga0466703_071104 Ga0466703_071104_268_765 165
213 3300042635 Ga0466702_104693 Ga0466702_104693_555_1058 167
214 iso_pr_bacteria 2781125687 2781420511 170

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF20797 HepT-like_2 HepT-like protein 61 165 0.96

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.78 0.82 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.