Protein Family IF11814

Metagenome Isolate
183 Members
57 Samples
173 Scaffolds
423.04 Avg Length

🧬 Representative Sequence

ID
iso_pr_bacteria|2781125681|2781407486|
Length
485 aa
Sequence
LRLKCCYCTYHCNGKNRQKAQRPLHYTSISLPGVENKIAARPIPFPRLLLYSGTMNDDIRRALCENYCEPVRDMLWGHIYLTPALAAITQSAPFMRLHRIMQLGPTFMVYPGATHTRASHSIGVYHLARRLLCHLAGQGADSWLSAEGVKSFLCAALLHDAGHFPYTHSLKELPLKDHESLTASLIVSEPLKSLISAAGGDPYMAAAIVDTQAESGGGSGGSADGEVLFYRRLLSGALDPDKLDYLSRDGRYCGVPYGAQDVDFIFSRLQPDRERGVVIDSRGIPAVESLLFAKYLMYRAVYWHKAVRSATAMIKKALFAALESRAIAPEELYNLDDQGLFARAAARACPLFSLAESVKNGRFFTLAAEIPFNEHAHGDALRLSARPRMEESLAQALSPCLGTALRADELIIDVGEPVSFESGLFVTDENCLFSEGSSVFKGSFPDAFATSLRTIRIFVEPGFERDIEKSREGILHTAEKWLTLL

📊 Sample Types

Isolate 5.5%
Metagenome 94.5%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 36.4%
Kalotermitidae 25.5%
Unclassified 20.0%
Rhinotermitidae 7.3%
Termopsidae 7.3%
Hodotermitidae 1.8%
Blaberidae 1.8%

🌳 Taxonomy

Archaea 0
Bacteria 174
Eukaryota 0
Viruses 0
Unclassified 9

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
2 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
3 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
4 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
5 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
6 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
7 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
8 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
9 2781125681 Treponema sp. Lab288P1bin11 Isolate Unclassified
10 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
11 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
12 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
13 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
14 2781125653 Treponema sp. Emb289P1bin107 Isolate Unclassified
15 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
16 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
17 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
18 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
19 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
20 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
21 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
22 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
23 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
24 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
25 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
26 2772190975 Treponema sp. RmG30 Isolate Blaberidae
27 2781125637 Treponema sp. Co191P1bin9 Isolate Unclassified
28 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
29 2772190978 Treponema sp. Nt197P3bin57 Isolate Unclassified
30 2781125655 Treponema sp. Emb289P1bin105 Isolate Unclassified
31 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
32 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
33 2781125629 Treponema sp. Nt197P3bin20 Isolate Unclassified
34 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
35 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
36 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
37 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
38 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
39 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
40 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
41 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
42 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
43 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
44 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
45 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
46 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
47 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
48 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
49 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
50 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
51 2781125630 Treponema sp. Nt197P3bin60 Isolate Unclassified
52 2781125694 Treponema sp. Th196P3bin120 Isolate Unclassified
53 2781125697 Treponema sp. Th196P4bin17 Isolate Unclassified
54 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
55 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
56 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
57 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_344293 3300042612 Bacteria 7980
2 Ga0466733_005128 3300042659 Bacteria 4190
3 Ga0466705_425024 3300042612 Bacteria 3694
4 Ga0466711_031615 3300042615 Unclassified 6969
5 Ga0466726_245815 3300042619 Bacteria 2901
6 Ga0466726_489544 3300042619 Bacteria 2803
7 Ga0466728_115604 3300042620 Bacteria 3221
8 Ga0466729_037172 3300042621 Bacteria 4895
9 Ga0123353_10101124 3300010167 Bacteria 4647
10 Ga0123353_10132365 3300010167 Bacteria 4001
11 Ga0123353_10388108 3300010167 Bacteria 2085
12 Ga0466690_190397 3300042590 Bacteria 8163
13 Ga0466699_021772 3300042597 Bacteria 7324
14 Ga0466699_195846 3300042597 Bacteria 7086
15 Ga0466731_257601 3300042622 Bacteria 2462
16 Ga0466735_086953 3300042624 Bacteria 4887
17 Ga0466735_091395 3300042624 Bacteria 3678
18 Ga0466735_205217 3300042624 Bacteria 1518
19 Ga0466703_213128 3300042636 Bacteria 9079
20 Ga0466704_117745 3300042643 Bacteria 2337
21 Ga0466704_537498 3300042643 Unclassified 5974
22 Ga0466709_259608 3300042648 Bacteria 8752
23 Ga0466708_020232 3300042652 Bacteria 68940
24 Ga0466716_162561 3300042605 Unclassified 6350
25 Ga0466719_299197 3300042606 Bacteria 7351
26 Ga0466722_161964 3300042609 Bacteria 9253
27 Ga0466722_197120 3300042609 Bacteria 8691
28 JGI24695J34938_10002992 3300002450 Bacteria 12175
29 Ga0466733_199864 3300042659 Bacteria 4258
30 Ga0466718_149328 3300042617 Bacteria 9484
31 Ga0466723_029135 3300042618 Bacteria 2068
32 Ga0123355_10000286 3300009826 Bacteria 64768
33 Ga0466693_032981 3300042592 Bacteria 51645
34 Ga0466696_011429 3300042596 Bacteria 10032
35 Ga0466699_079254 3300042597 Bacteria 2173
36 Ga0466699_247881 3300042597 Bacteria 2673
37 Ga0466703_288386 3300042636 Bacteria 6099
38 Ga0466709_099530 3300042648 Bacteria 2242
39 Ga0466708_009753 3300042652 Bacteria 3762
40 Ga0466713_110332 3300042602 Bacteria 5684
41 Ga0466716_063393 3300042605 Bacteria 14618
42 JGI24695J34938_10007055 3300002450 Bacteria 6646
43 Ga0466711_509107 3300042615 Bacteria 1925
44 Ga0466723_122079 3300042618 Bacteria 5702
45 Ga0466723_166091 3300042618 Bacteria 8165
46 Ga0466728_191402 3300042620 Bacteria 14340
47 Ga0415639_001719 3300038395 Bacteria 19674
48 Ga0466696_499418 3300042596 Bacteria 3028
49 Ga0466699_435306 3300042597 Bacteria 2953
50 Ga0466735_072806 3300042624 Bacteria 12912
51 Ga0466704_412183 3300042643 Bacteria 2235
52 Ga0466708_111799 3300042652 Bacteria 28295
53 Ga0466727_162737 3300042655 Bacteria 1727
54 Ga0466727_253025 3300042655 Bacteria 2639
55 Ga0466722_013559 3300042609 Bacteria 8177
56 Ga0466722_082473 3300042609 Bacteria 31404
57 JGI24695J34938_10000013 3300002450 Bacteria 122387
58 JGI24695J34938_10009049 3300002450 Bacteria 5580
59 Ga0068302_10051253 3300005071 Bacteria 3099
60 Ga0466711_507069 3300042615 Bacteria 12280
61 Ga0466723_067599 3300042618 Bacteria 49452
62 Ga0466726_393929 3300042619 Bacteria 1820
63 Ga0264413_101672 3300024493 Bacteria 9287
64 Ga0466692_059576 3300042591 Bacteria 31204
65 Ga0466692_155795 3300042591 Bacteria 10948
66 Ga0466696_189327 3300042596 Bacteria 5609
67 Ga0466696_219304 3300042596 Bacteria 7061
68 Ga0466699_191775 3300042597 Bacteria 8516
69 Ga0466704_177135 3300042643 Bacteria 5770
70 Ga0466704_366974 3300042643 Bacteria 3457
71 Ga0466727_247113 3300042655 Bacteria 6478
72 Ga0466714_167860 3300042603 Bacteria 7386
73 JGI24698J34947_10028894 3300002449 Bacteria 2934
74 Ga0466705_031714 3300042612 Bacteria 8942
75 Ga0466705_195811 3300042612 Bacteria 5858
76 Ga0466705_281761 3300042612 Bacteria 9213
77 Ga0466711_057516 3300042615 Bacteria 8983
78 Ga0466718_025034 3300042617 Bacteria 6018
79 Ga0466726_286702 3300042619 Bacteria 1858
80 Ga0123353_10004345 3300010167 Bacteria 18232
81 Ga0264413_101673 3300024493 Unclassified 5409
82 Ga0415639_045388 3300038395 Bacteria 6433
83 Ga0456237_0005014 3300041968 Bacteria 2112
84 Ga0466690_094153 3300042590 Bacteria 5182
85 Ga0466693_129023 3300042592 Bacteria 2677
86 Ga0466696_361474 3300042596 Bacteria 23704
87 Ga0466703_265699 3300042636 Bacteria 25659
88 Ga0466704_457236 3300042643 Unclassified 8626
89 Ga0466709_303070 3300042648 Bacteria 12922
90 Ga0466708_065604 3300042652 Bacteria 3169
91 Ga0466707_030102 3300042601 Bacteria 3101
92 Ga0466713_145304 3300042602 Bacteria 22025
93 Ga0466716_210886 3300042605 Unclassified 5518
94 Ga0466719_168309 3300042606 Bacteria 26888
95 JGI24695J34938_10002724 3300002450 Bacteria 13032
96 Ga0072941_1045898 3300005201 Bacteria 6032
97 Ga0123357_10002863 3300009784 Bacteria 19445
98 Ga0466711_178740 3300042615 Bacteria 3536
99 Ga0466711_181310 3300042615 Bacteria 18546
100 Ga0466711_445019 3300042615 Bacteria 49797
101 Ga0466715_026836 3300042616 Bacteria 2352
102 Ga0466723_110770 3300042618 Bacteria 12010
103 Ga0466723_240146 3300042618 Bacteria 11432
104 Ga0466723_277331 3300042618 Bacteria 9909
105 Ga0466728_053339 3300042620 Bacteria 4467
106 Ga0264413_101674 3300024493 Bacteria 16699
107 Ga0466691_216612 3300042593 Bacteria 8410
108 Ga0466696_433920 3300042596 Bacteria 4819
109 Ga0466699_073794 3300042597 Bacteria 8806
110 Ga0466699_214657 3300042597 Bacteria 7396
111 Ga0466735_074907 3300042624 Bacteria 3626
112 Ga0466735_099903 3300042624 Bacteria 15007
113 Ga0466735_196606 3300042624 Bacteria 5002
114 Ga0466708_291525 3300042652 Bacteria 19495
115 Ga0466706_093260 3300042599 Bacteria 27323
116 Ga0466719_146331 3300042606 Bacteria 13061
117 Ga0466719_328708 3300042606 Bacteria 47326
118 Ga0466722_165225 3300042609 Bacteria 1547
119 JGI24702J35022_10019232 3300002462 Unclassified 3715
120 Ga0466732_189863 3300042656 Bacteria 5370
121 Ga0466712_138271 3300042614 Bacteria 13571
122 Ga0466711_107323 3300042615 Bacteria 7677
123 Ga0466715_066854 3300042616 Bacteria 6116
124 Ga0466723_195953 3300042618 Bacteria 7073
125 Ga0466728_121813 3300042620 Bacteria 2629
126 Ga0466728_122042 3300042620 Unclassified 2502
127 Ga0466690_151401 3300042590 Bacteria 12638
128 Ga0466694_271629 3300042594 Bacteria 6847
129 Ga0466696_004747 3300042596 Bacteria 4797
130 Ga0466699_172193 3300042597 Bacteria 17697
131 Ga0466708_340197 3300042652 Bacteria 51194
132 Ga0466708_437744 3300042652 Bacteria 51835
133 Ga0466727_210023 3300042655 Bacteria 3634
134 Ga0466727_243084 3300042655 Bacteria 8470
135 Ga0466707_296992 3300042601 Bacteria 4132
136 Ga0466707_379252 3300042601 Bacteria 5351
137 Ga0466713_044982 3300042602 Bacteria 3358
138 Ga0466720_110599 3300042607 Bacteria 7340
139 Ga0466720_143785 3300042607 Bacteria 9849
140 Ga0466698_180637 3300042610 Bacteria 1349
141 AustNasuHG_c1003066 3300000089 Bacteria 6026
142 Ga0466705_050508 3300042612 Bacteria 4964
143 Ga0466715_014207 3300042616 Bacteria 16080
144 Ga0466715_381125 3300042616 Bacteria 4286
145 Ga0466718_004456 3300042617 Bacteria 7697
146 Ga0466723_044054 3300042618 Bacteria 6709
147 Ga0466723_100840 3300042618 Bacteria 26748
148 Ga0466728_154082 3300042620 Bacteria 4123
149 Ga0123355_10049231 3300009826 Bacteria 6852
150 Ga0123355_10219908 3300009826 Bacteria 2734
151 Ga0264413_135444 3300024493 Bacteria 8551
152 Ga0466690_142656 3300042590 Bacteria 2817
153 Ga0466691_087298 3300042593 Bacteria 6685
154 Ga0466691_227462 3300042593 Bacteria 4972
155 Ga0466696_414094 3300042596 Bacteria 2429
156 Ga0466729_299260 3300042621 Bacteria 3299
157 Ga0466702_251188 3300042635 Bacteria 2930
158 Ga0466703_195995 3300042636 Bacteria 7235
159 Ga0466703_235899 3300042636 Bacteria 23764
160 Ga0466704_015776 3300042643 Bacteria 5664
161 Ga0466704_110734 3300042643 Unclassified 9807
162 Ga0466704_183081 3300042643 Bacteria 7416
163 Ga0466704_424800 3300042643 Bacteria 7701
164 Ga0466709_167670 3300042648 Bacteria 6316
165 Ga0466709_338748 3300042648 Bacteria 2204
166 Ga0466716_007119 3300042605 Bacteria 4240
167 Ga0466719_274664 3300042606 Bacteria 7523
168 Ga0466720_014621 3300042607 Bacteria 102324
169 Ga0466722_054524 3300042609 Bacteria 1808
170 Ga0466722_149888 3300042609 Bacteria 10566
171 Ga0466722_224137 3300042609 Bacteria 2471
172 AustNasuHG_c1006056 3300000089 Bacteria 4320
173 JGI24698J34947_10002441 3300002449 Bacteria 10013

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042648 Ga0466709_303070 Ga0466709_303070_633_1649 338
2 3300042621 Ga0466729_299260 Ga0466729_299260_2118_3197 359
3 3300042620 Ga0466728_115604 Ga0466728_115604_2115_3203 362
4 3300042652 Ga0466708_437744 Ga0466708_437744_22729_23865 378
5 3300009826 Ga0123355_10049231 Ga0123355_100492312 384
6 3300042612 Ga0466705_050508 Ga0466705_050508_2768_3922 384
7 3300042610 Ga0466698_180637 Ga0466698_180637_152_1336 388
8 3300010167 Ga0123353_10101124 Ga0123353_101011243 389
9 3300042614 Ga0466712_138271 Ga0466712_138271_3729_4898 389
10 3300024493 Ga0264413_135444 Ga0264413_1354443 390
11 3300042648 Ga0466709_338748 Ga0466709_338748_1014_2186 390
12 3300038395 Ga0415639_001719 Ga0415639_001719_3153_4331 392
13 3300042591 Ga0466692_155795 Ga0466692_155795_2881_4059 392
14 3300042615 Ga0466711_509107 Ga0466711_509107_91_1377 397
15 3300002450 JGI24695J34938_10002992 JGI24695J34938_100029926 398
16 3300002450 JGI24695J34938_10007055 JGI24695J34938_100070556 398
17 3300042607 Ga0466720_110599 Ga0466720_110599_3572_4783 398
18 3300042618 Ga0466723_110770 Ga0466723_110770_1238_2473 398
19 3300042622 Ga0466731_257601 Ga0466731_257601_36_1232 398
20 3300000089 AustNasuHG_c1003066 AustNasuHG_10030663 401
21 3300042590 Ga0466690_190397 Ga0466690_190397_642_1847 401
22 3300042596 Ga0466696_219304 Ga0466696_219304_943_2148 401
23 3300042606 Ga0466719_328708 Ga0466719_328708_3622_4827 401
24 3300009826 Ga0123355_10000286 Ga0123355_1000028634 402
25 3300042609 Ga0466722_165225 Ga0466722_165225_88_1305 405
26 3300042603 Ga0466714_167860 Ga0466714_167860_3582_4874 409
27 3300042609 Ga0466722_197120 Ga0466722_197120_3918_5147 409
28 3300042596 Ga0466696_189327 Ga0466696_189327_3978_5261 410
29 3300024493 Ga0264413_101672 Ga0264413_1016726 411
30 3300041968 Ga0456237_0005014 Ga0456237_0005014_86_1321 411
31 3300042606 Ga0466719_274664 Ga0466719_274664_1003_2277 411
32 3300042643 Ga0466704_537498 Ga0466704_537498_181_1467 411
33 3300042619 Ga0466726_286702 Ga0466726_286702_428_1717 412
34 3300042643 Ga0466704_366974 Ga0466704_366974_1506_2789 412
35 3300042590 Ga0466690_094153 Ga0466690_094153_3374_4636 414
36 3300042596 Ga0466696_011429 Ga0466696_011429_7175_8422 415
37 3300042596 Ga0466696_433920 Ga0466696_433920_2506_3780 415
38 3300042609 Ga0466722_082473 Ga0466722_082473_15004_16251 415
39 iso_pr_bacteria 2781125630 2781266094 415
40 3300042602 Ga0466713_110332 Ga0466713_110332_428_1711 416
41 3300042602 Ga0466713_145304 Ga0466713_145304_14405_15709 416
42 3300042615 Ga0466711_178740 Ga0466711_178740_2154_3404 416
43 3300042643 Ga0466704_015776 Ga0466704_015776_2256_3536 416
44 3300042659 Ga0466733_005128 Ga0466733_005128_1599_2849 416
45 3300042659 Ga0466733_199864 Ga0466733_199864_2883_4133 416
46 3300002450 JGI24695J34938_10009049 JGI24695J34938_100090495 417
47 3300042592 Ga0466693_129023 Ga0466693_129023_968_2242 417
48 3300042601 Ga0466707_030102 Ga0466707_030102_803_2056 417
49 iso_pr_bacteria 2781125694 2781437063 417
50 3300042618 Ga0466723_100840 Ga0466723_100840_10060_11316 418
51 3300042624 Ga0466735_196606 Ga0466735_196606_1150_2406 418
52 3300042590 Ga0466690_151401 Ga0466690_151401_4354_5658 419
53 3300042596 Ga0466696_414094 Ga0466696_414094_329_1588 419
54 iso_pr_bacteria 2772190975 2773723948 419
55 iso_pr_bacteria 2781125629 2781263227 419
56 3300002449 JGI24698J34947_10002441 JGI24698J34947_100024414 420
57 3300002450 JGI24695J34938_10000013 JGI24695J34938_1000001321 420
58 3300042593 Ga0466691_227462 Ga0466691_227462_3352_4614 420
59 3300042615 Ga0466711_031615 Ga0466711_031615_1056_2318 420
60 3300042607 Ga0466720_014621 Ga0466720_014621_24381_25646 421
61 3300042617 Ga0466718_004456 Ga0466718_004456_5098_6363 421
62 3300042619 Ga0466726_245815 Ga0466726_245815_369_1634 421
63 iso_pr_bacteria 2781125637 2781282362 421
64 3300042597 Ga0466699_247881 Ga0466699_247881_88_1356 422
65 3300042618 Ga0466723_166091 Ga0466723_166091_5310_6641 422
66 3300042655 Ga0466727_243084 Ga0466727_243084_571_1863 422
67 3300002450 JGI24695J34938_10002724 JGI24695J34938_100027249 423
68 3300042594 Ga0466694_271629 Ga0466694_271629_2422_3693 423
69 3300042597 Ga0466699_435306 Ga0466699_435306_1191_2462 423
70 3300042615 Ga0466711_507069 Ga0466711_507069_697_1968 423
71 3300042616 Ga0466715_014207 Ga0466715_014207_3365_4636 423
72 3300042618 Ga0466723_044054 Ga0466723_044054_969_2240 423
73 3300042624 Ga0466735_205217 Ga0466735_205217_233_1504 423
74 3300042648 Ga0466709_259608 Ga0466709_259608_1281_2552 423
75 3300042652 Ga0466708_340197 Ga0466708_340197_36999_38270 423
76 iso_pr_bacteria 2772190978 2773729950 423
77 3300042597 Ga0466699_191775 Ga0466699_191775_834_2108 424
78 3300042615 Ga0466711_445019 Ga0466711_445019_12069_13343 424
79 3300042618 Ga0466723_195953 Ga0466723_195953_1277_2551 424
80 3300042590 Ga0466690_142656 Ga0466690_142656_850_2127 425
81 3300042605 Ga0466716_162561 Ga0466716_162561_1418_2695 425
82 3300042605 Ga0466716_210886 Ga0466716_210886_3071_4348 425
83 3300042618 Ga0466723_029135 Ga0466723_029135_533_1810 425
84 3300042635 Ga0466702_251188 Ga0466702_251188_819_2096 425
85 3300042643 Ga0466704_117745 Ga0466704_117745_816_2093 425
86 3300042652 Ga0466708_020232 Ga0466708_020232_25300_26577 425
87 3300042591 Ga0466692_059576 Ga0466692_059576_22951_24231 426
88 3300042606 Ga0466719_299197 Ga0466719_299197_3175_4455 426
89 3300042624 Ga0466735_086953 Ga0466735_086953_1774_3054 426
90 3300042643 Ga0466704_177135 Ga0466704_177135_621_1931 426
91 3300042643 Ga0466704_183081 Ga0466704_183081_2757_4037 426
92 3300042655 Ga0466727_253025 Ga0466727_253025_425_1705 426
93 3300042596 Ga0466696_361474 Ga0466696_361474_11061_12344 427
94 3300042601 Ga0466707_379252 Ga0466707_379252_111_1394 427
95 3300042605 Ga0466716_007119 Ga0466716_007119_158_1441 427
96 3300042609 Ga0466722_054524 Ga0466722_054524_32_1315 427
97 3300042617 Ga0466718_025034 Ga0466718_025034_4390_5673 427
98 3300042620 Ga0466728_154082 Ga0466728_154082_1403_2686 427
99 3300042643 Ga0466704_412183 Ga0466704_412183_321_1604 427
100 3300042652 Ga0466708_065604 Ga0466708_065604_520_1803 427
101 3300042655 Ga0466727_247113 Ga0466727_247113_3812_5095 427
102 3300038395 Ga0415639_045388 Ga0415639_045388_2014_3300 428
103 3300042596 Ga0466696_499418 Ga0466696_499418_492_1778 428
104 3300042606 Ga0466719_146331 Ga0466719_146331_8989_10275 428
105 3300042609 Ga0466722_149888 Ga0466722_149888_1062_2348 428
106 3300042609 Ga0466722_224137 Ga0466722_224137_334_1620 428
107 3300042619 Ga0466726_489544 Ga0466726_489544_878_2164 428
108 3300042624 Ga0466735_074907 Ga0466735_074907_992_2278 428
109 3300042624 Ga0466735_099903 Ga0466735_099903_12433_13719 428
110 3300042636 Ga0466703_195995 Ga0466703_195995_1349_2635 428
111 3300042636 Ga0466703_288386 Ga0466703_288386_3813_5099 428
112 3300042655 Ga0466727_162737 Ga0466727_162737_82_1368 428
113 3300042655 Ga0466727_210023 Ga0466727_210023_1833_3119 428
114 3300010167 Ga0123353_10004345 Ga0123353_100043455 429
115 3300042593 Ga0466691_216612 Ga0466691_216612_276_1565 429
116 3300042607 Ga0466720_143785 Ga0466720_143785_2953_4242 429
117 3300042609 Ga0466722_013559 Ga0466722_013559_6515_7804 429
118 3300042612 Ga0466705_425024 Ga0466705_425024_733_2022 429
119 3300042621 Ga0466729_037172 Ga0466729_037172_2496_3785 429
120 3300042624 Ga0466735_091395 Ga0466735_091395_270_1559 429
121 iso_pr_bacteria 2781125697 2781443692 429
122 3300002462 JGI24702J35022_10019232 JGI24702J35022_100192323 430
123 3300042597 Ga0466699_073794 Ga0466699_073794_4323_5615 430
124 3300042597 Ga0466699_214657 Ga0466699_214657_1042_2334 430
125 3300042612 Ga0466705_031714 Ga0466705_031714_2484_3776 430
126 3300042615 Ga0466711_107323 Ga0466711_107323_1764_3056 430
127 3300042620 Ga0466728_053339 Ga0466728_053339_1739_3031 430
128 3300042620 Ga0466728_121813 Ga0466728_121813_428_1720 430
129 3300042620 Ga0466728_122042 Ga0466728_122042_301_1593 430
130 3300042636 Ga0466703_235899 Ga0466703_235899_7559_8851 430
131 3300042643 Ga0466704_457236 Ga0466704_457236_5016_6308 430
132 3300042596 Ga0466696_004747 Ga0466696_004747_1215_2510 431
133 3300042597 Ga0466699_195846 Ga0466699_195846_840_2135 431
134 3300042616 Ga0466715_381125 Ga0466715_381125_2451_3746 431
135 3300042618 Ga0466723_122079 Ga0466723_122079_771_2066 431
136 3300042620 Ga0466728_191402 Ga0466728_191402_11735_13030 431
137 3300002449 JGI24698J34947_10028894 JGI24698J34947_100288941 432
138 3300042593 Ga0466691_087298 Ga0466691_087298_1856_3154 432
139 3300042602 Ga0466713_044982 Ga0466713_044982_1074_2372 432
140 3300042609 Ga0466722_161964 Ga0466722_161964_5060_6358 432
141 3300042615 Ga0466711_181310 Ga0466711_181310_1344_2642 432
142 3300042648 Ga0466709_099530 Ga0466709_099530_897_2195 432
143 3300005071 Ga0068302_10051253 Ga0068302_100512533 433
144 3300042597 Ga0466699_021772 Ga0466699_021772_848_2149 433
145 3300042597 Ga0466699_079254 Ga0466699_079254_122_1423 433
146 3300042606 Ga0466719_168309 Ga0466719_168309_24063_25364 433
147 3300042612 Ga0466705_195811 Ga0466705_195811_1660_2961 433
148 3300042592 Ga0466693_032981 Ga0466693_032981_32580_33884 434
149 3300042612 Ga0466705_281761 Ga0466705_281761_3969_5273 434
150 3300042643 Ga0466704_110734 Ga0466704_110734_3271_4575 434
151 3300042656 Ga0466732_189863 Ga0466732_189863_703_2007 434
152 3300010167 Ga0123353_10132365 Ga0123353_101323652 435
153 3300010167 Ga0123353_10388108 Ga0123353_103881082 435
154 3300042605 Ga0466716_063393 Ga0466716_063393_2468_3775 435
155 3300005201 Ga0072941_1045898 Ga0072941_10458985 436
156 3300042617 Ga0466718_149328 Ga0466718_149328_5952_7262 436
157 3300042618 Ga0466723_277331 Ga0466723_277331_4196_5506 436
158 3300042619 Ga0466726_393929 Ga0466726_393929_475_1785 436
159 3300009826 Ga0123355_10219908 Ga0123355_102199082 437
160 3300024493 Ga0264413_101673 Ga0264413_1016736 437
161 3300042612 Ga0466705_344293 Ga0466705_344293_2252_3568 438
162 3300042616 Ga0466715_026836 Ga0466715_026836_532_1848 438
163 3300042616 Ga0466715_066854 Ga0466715_066854_4758_6074 438
164 3300042636 Ga0466703_265699 Ga0466703_265699_20265_21581 438
165 iso_pr_bacteria 2781125655 2781316885 438
166 3300024493 Ga0264413_101674 Ga0264413_1016748 439
167 3300042599 Ga0466706_093260 Ga0466706_093260_6003_7322 439
168 3300042618 Ga0466723_067599 Ga0466723_067599_43943_45262 439
169 3300042643 Ga0466704_424800 Ga0466704_424800_570_1907 439
170 3300042652 Ga0466708_291525 Ga0466708_291525_13382_14701 439
171 3300042601 Ga0466707_296992 Ga0466707_296992_1682_3004 440
172 3300042597 Ga0466699_172193 Ga0466699_172193_10577_11905 442
173 3300042615 Ga0466711_057516 Ga0466711_057516_2892_4220 442
174 3300042652 Ga0466708_009753 Ga0466708_009753_1368_2696 442
175 3300009784 Ga0123357_10002863 Ga0123357_100028635 444
176 3300042652 Ga0466708_111799 Ga0466708_111799_7099_8433 444
177 3300042624 Ga0466735_072806 Ga0466735_072806_8567_9916 449
178 3300042648 Ga0466709_167670 Ga0466709_167670_3752_5110 452
179 3300000089 AustNasuHG_c1006056 AustNasuHG_10060562 453
180 3300042618 Ga0466723_240146 Ga0466723_240146_6272_7657 461
181 3300042636 Ga0466703_213128 Ga0466703_213128_3590_5002 470
182 iso_pr_bacteria 2781125653 2781313414 483
183 iso_pr_bacteria 2781125681 2781407486 485

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01966 HD HD domain 117 193 0.87
PF19276 HD_assoc_2 HD associated region 274 421 0.82

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.85 0.91 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.