Protein Family IF11806

Metagenome Isolate
164 Members
52 Samples
154 Scaffolds
80.24 Avg Length

🧬 Representative Sequence

ID
iso_pr_bacteria|2781125663|2781338700|
Length
91 aa
Sequence
MLMRLVLELKQVDKKSISPVIAMITPGIIRLLIENRKLSLEEASGILYNSLLYKTLEDEETKVWRFGYPLLYDLLEEELATGKITFPDEQI

📊 Sample Types

Isolate 6.1%
Metagenome 93.9%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 52.9%
Unclassified 21.6%
Kalotermitidae 11.8%
Termopsidae 7.8%
Rhinotermitidae 3.9%
Hodotermitidae 2.0%

🌳 Taxonomy

Archaea 1
Bacteria 153
Eukaryota 0
Viruses 0
Unclassified 10

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125666 Treponema sp. Emb289P4bin7 Isolate Unclassified
2 2820227065 Unclassified Firmicutes Th196P4bin44 Isolate Unclassified
3 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
4 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
5 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
6 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
7 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
8 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
9 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
10 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
11 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
12 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
13 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
14 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
15 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
16 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
17 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
18 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
19 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
20 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
21 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
22 2781125663 Treponema sp. Emb289P3bin135 Isolate Unclassified
23 2820231849 Unclassified Firmicutes Th196P4bin1 Isolate Unclassified
24 2820250282 Unclassified Firmicutes Th196P3bin66 Isolate Unclassified
25 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
26 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
27 2820223845 Unclassified Firmicutes Th196P4bin57 Isolate Unclassified
28 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
29 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
30 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
31 2820580397 Unclassified Firmicutes Emb289P3bin133 Isolate Unclassified
32 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
33 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
34 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
35 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
36 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
37 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
38 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
39 2781125659 Treponema sp. Emb289P3bin114 Isolate Unclassified
40 2820576413 Unclassified Firmicutes Emb289P3bin136 Isolate Unclassified
41 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
42 2820590132 Unclassified Firmicutes Emb289P1bin84 Isolate Unclassified
43 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
44 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
45 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
46 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
47 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
48 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
49 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
50 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
51 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
52 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466697_074929 3300042611 Bacteria 6066
2 Ga0466656_008300 3300042550 Bacteria 1091
3 Ga0466656_162290 3300042550 Bacteria 1243
4 Ga0466714_012716 3300042603 Bacteria 1355
5 Ga0466717_281167 3300042604 Bacteria 1773
6 Ga0466722_106840 3300042609 Bacteria 2167
7 JGI24702J35022_10426859 3300002462 Bacteria 804
8 Ga0072941_1172024 3300005201 Bacteria 856
9 Ga0123357_10154699 3300009784 Bacteria 2770
10 Ga0123357_10691152 3300009784 Bacteria 735
11 Ga0123356_10021285 3300010049 Unclassified 6123
12 Ga0123356_10118205 3300010049 Bacteria 2573
13 Ga0123356_10282852 3300010049 Bacteria 1755
14 Ga0123356_10432595 3300010049 Bacteria 1460
15 Ga0123356_12696451 3300010049 Bacteria 622
16 Ga0123353_10781438 3300010167 Bacteria 1322
17 Ga0123354_10009622 3300010882 Bacteria 14827
18 Ga0466734_118672 3300042623 Archaea 9505
19 Ga0466702_001123 3300042635 Bacteria 1907
20 Ga0466702_038299 3300042635 Bacteria 1515
21 Ga0466702_183166 3300042635 Bacteria 1065
22 Ga0466715_214675 3300042616 Bacteria 5325
23 Ga0466718_009450 3300042617 Bacteria 2464
24 Ga0466726_009517 3300042619 Bacteria 1084
25 Ga0415639_112908 3300038395 Bacteria 1596
26 Ga0466696_240550 3300042596 Bacteria 1121
27 Ga0466721_126097 3300042608 Bacteria 24100
28 JGI24702J35022_10392495 3300002462 Bacteria 837
29 Ga0068302_10399227 3300005071 Bacteria 786
30 Ga0123355_10005123 3300009826 Bacteria 19117
31 Ga0123356_12010074 3300010049 Bacteria 721
32 Ga0123356_13609915 3300010049 Bacteria 536
33 Ga0123353_10040312 3300010167 Bacteria 7367
34 Ga0123353_11251775 3300010167 Bacteria 968
35 Ga0123353_11902375 3300010167 Bacteria 734
36 Ga0123354_10426304 3300010882 Bacteria 1097
37 Ga0466704_355553 3300042643 Bacteria 8548
38 Ga0466727_132024 3300042655 Unclassified 1021
39 Ga0466712_312949 3300042614 Bacteria 2069
40 Ga0466697_130246 3300042611 Bacteria 1068
41 Ga0466705_044372 3300042612 Bacteria 14386
42 Ga0415639_016161 3300038395 Unclassified 1206
43 Ga0415639_112907 3300038395 Bacteria 1139
44 Ga0466693_417972 3300042592 Bacteria 3195
45 Ga0466699_033071 3300042597 Bacteria 2226
46 Ga0466699_371266 3300042597 Bacteria 2230
47 Ga0466713_103494 3300042602 Bacteria 1281
48 Ga0466717_044861 3300042604 Bacteria 1449
49 Ga0466721_259809 3300042608 Bacteria 3468
50 JGI24698J34947_10103780 3300002449 Bacteria 1271
51 JGI24702J35022_10187812 3300002462 Bacteria 1177
52 JGI24702J35022_10275342 3300002462 Bacteria 986
53 JGI24702J35022_10312213 3300002462 Bacteria 930
54 Ga0123355_10213768 3300009826 Bacteria 2788
55 Ga0123356_10525424 3300010049 Bacteria 1342
56 Ga0123356_11584804 3300010049 Bacteria 810
57 Ga0123356_12577231 3300010049 Bacteria 637
58 Ga0123356_13394870 3300010049 Bacteria 553
59 Ga0123353_10549489 3300010167 Bacteria 1666
60 Ga0123353_11436059 3300010167 Bacteria 884
61 Ga0466735_012573 3300042624 Unclassified 2267
62 Ga0466702_463735 3300042635 Bacteria 1002
63 Ga0466692_052983 3300042591 Bacteria 19621
64 Ga0466699_170883 3300042597 Bacteria 11701
65 AustNasuHG_c1000205 3300000089 Bacteria 19487
66 JGI24698J34947_10000596 3300002449 Bacteria 17257
67 JGI24702J35022_10000116 3300002462 Bacteria 38330
68 JGI24702J35022_10084670 3300002462 Bacteria 1721
69 JGI24702J35022_10133435 3300002462 Bacteria 1380
70 Ga0123357_10818328 3300009784 Bacteria 625
71 Ga0123355_10420345 3300009826 Bacteria 1709
72 Ga0123356_10680244 3300010049 Bacteria 1197
73 Ga0123356_10773395 3300010049 Bacteria 1131
74 Ga0123356_12827334 3300010049 Bacteria 607
75 Ga0123353_10002686 3300010167 Bacteria 22159
76 Ga0123353_10759174 3300010167 Bacteria 1348
77 Ga0123353_12788479 3300010167 Bacteria 573
78 Ga0123354_10953973 3300010882 Bacteria 556
79 Ga0466704_607703 3300042643 Bacteria 1486
80 Ga0466727_209091 3300042655 Bacteria 1595
81 Ga0466727_335029 3300042655 Bacteria 1856
82 Ga0466697_180904 3300042611 Bacteria 2928
83 Ga0466697_252036 3300042611 Bacteria 8291
84 Ga0466694_105399 3300042594 Bacteria 1355
85 Ga0466701_095543 3300042598 Bacteria 3887
86 Ga0466706_010769 3300042599 Bacteria 8787
87 Ga0123355_10403274 3300009826 Bacteria 1762
88 Ga0123356_10030205 3300010049 Bacteria 5072
89 Ga0123356_10293586 3300010049 Bacteria 1727
90 Ga0466705_511132 3300042612 Bacteria 1072
91 Ga0466712_024961 3300042614 Unclassified 3133
92 Ga0466726_394515 3300042619 Unclassified 1075
93 Ga0466705_137281 3300042612 Bacteria 4423
94 Ga0466733_087064 3300042659 Bacteria 1453
95 Ga0466657_184217 3300042582 Bacteria 1436
96 Ga0466694_341449 3300042594 Unclassified 1665
97 Ga0466706_225584 3300042599 Bacteria 2354
98 JGI24698J34947_10058157 3300002449 Bacteria 1916
99 JGI24698J34947_10290990 3300002449 Bacteria 593
100 Ga0123357_10003104 3300009784 Bacteria 18855
101 Ga0123357_10166973 3300009784 Bacteria 2617
102 Ga0123355_12159591 3300009826 Bacteria 510
103 Ga0123356_10008056 3300010049 Bacteria 10484
104 Ga0123356_10020406 3300010049 Bacteria 6269
105 Ga0123356_10318947 3300010049 Bacteria 1666
106 Ga0123356_10442655 3300010049 Bacteria 1446
107 Ga0123356_10481473 3300010049 Bacteria 1394
108 Ga0123356_12187035 3300010049 Bacteria 691
109 Ga0123356_12298779 3300010049 Bacteria 674
110 Ga0466734_033444 3300042623 Bacteria 1644
111 Ga0466727_239688 3300042655 Bacteria 1026
112 Ga0466705_501841 3300042612 Bacteria 5644
113 Ga0466711_015996 3300042615 Bacteria 17923
114 Ga0466711_034152 3300042615 Bacteria 1157
115 Ga0466711_216454 3300042615 Unclassified 2057
116 Ga0466718_161813 3300042617 Bacteria 1435
117 Ga0466697_216792 3300042611 Bacteria 9381
118 Ga0415639_007339 3300038395 Bacteria 15829
119 Ga0466692_153228 3300042591 Bacteria 29967
120 Ga0466694_083268 3300042594 Bacteria 2018
121 Ga0466700_128919 3300042600 Bacteria 1212
122 Ga0466721_273193 3300042608 Bacteria 9674
123 JGI24698J34947_10073578 3300002449 Unclassified 1630
124 JGI24702J35022_10049883 3300002462 Unclassified 2230
125 Ga0123355_10282513 3300009826 Bacteria 2289
126 Ga0123355_10992137 3300009826 Bacteria 893
127 Ga0123356_10349800 3300010049 Bacteria 1601
128 Ga0123356_10398113 3300010049 Bacteria 1514
129 Ga0123356_11371948 3300010049 Bacteria 868
130 Ga0123353_10912547 3300010167 Bacteria 1194
131 Ga0123354_10708354 3300010882 Bacteria 701
132 Ga0466704_521718 3300042643 Bacteria 1478
133 Ga0466708_111544 3300042652 Bacteria 1238
134 Ga0466725_013893 3300042654 Bacteria 3070
135 Ga0466699_182944 3300042597 Bacteria 3725
136 Ga0466721_187392 3300042608 Bacteria 20917
137 Ga0466697_052900 3300042611 Bacteria 1698
138 JGI24695J34938_10001368 3300002450 Bacteria 20999
139 JGI24702J35022_10020619 3300002462 Bacteria 3577
140 JGI24702J35022_10828930 3300002462 Bacteria 576
141 JGI24702J35022_10924357 3300002462 Bacteria 543
142 Ga0123357_10147999 3300009784 Bacteria 2861
143 Ga0123356_10082531 3300010049 Bacteria 3043
144 Ga0123356_10150835 3300010049 Bacteria 2307
145 Ga0123356_10155455 3300010049 Bacteria 2277
146 Ga0123356_10780924 3300010049 Bacteria 1126
147 Ga0123353_10119856 3300010167 Bacteria 4231
148 Ga0123353_10208266 3300010167 Bacteria 3069
149 Ga0123353_11055521 3300010167 Bacteria 1085
150 Ga0123353_11302705 3300010167 Bacteria 943
151 Ga0123353_12140343 3300010167 Bacteria 679
152 Ga0466704_525031 3300042643 Bacteria 2431
153 Ga0466718_013533 3300042617 Bacteria 1039
154 Ga0466718_108929 3300042617 Bacteria 2279

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300009784 Ga0123357_10003104 Ga0123357_1000310420 73
2 3300038395 Ga0415639_007339 Ga0415639_007339_15520_15756 78
3 3300038395 Ga0415639_016161 Ga0415639_016161_575_811 78
4 3300042604 Ga0466717_044861 Ga0466717_044861_43_279 78
5 3300042608 Ga0466721_126097 Ga0466721_126097_21154_21390 78
6 3300042623 Ga0466734_118672 Ga0466734_118672_7223_7459 78
7 iso_pr_bacteria 2820250282 2820250608 78
8 3300009826 Ga0123355_12159591 Ga0123355_121595911 79
9 3300010167 Ga0123353_10781438 Ga0123353_107814383 79
10 3300010167 Ga0123353_11902375 Ga0123353_119023752 79
11 3300010167 Ga0123353_12140343 Ga0123353_121403432 79
12 3300010882 Ga0123354_10708354 Ga0123354_107083542 79
13 3300010882 Ga0123354_10953973 Ga0123354_109539732 79
14 3300042550 Ga0466656_008300 Ga0466656_008300_662_901 79
15 3300042550 Ga0466656_162290 Ga0466656_162290_533_772 79
16 3300042582 Ga0466657_184217 Ga0466657_184217_823_1062 79
17 3300042594 Ga0466694_083268 Ga0466694_083268_1115_1354 79
18 3300042594 Ga0466694_105399 Ga0466694_105399_455_694 79
19 3300042596 Ga0466696_240550 Ga0466696_240550_717_956 79
20 3300042597 Ga0466699_033071 Ga0466699_033071_889_1128 79
21 3300042597 Ga0466699_170883 Ga0466699_170883_634_873 79
22 3300042597 Ga0466699_371266 Ga0466699_371266_1625_1864 79
23 3300042598 Ga0466701_095543 Ga0466701_095543_1401_1640 79
24 3300042599 Ga0466706_010769 Ga0466706_010769_5991_6230 79
25 3300042599 Ga0466706_225584 Ga0466706_225584_826_1065 79
26 3300042600 Ga0466700_128919 Ga0466700_128919_320_559 79
27 3300042603 Ga0466714_012716 Ga0466714_012716_782_1021 79
28 3300042611 Ga0466697_052900 Ga0466697_052900_202_441 79
29 3300042611 Ga0466697_074929 Ga0466697_074929_4947_5186 79
30 3300042611 Ga0466697_130246 Ga0466697_130246_772_1011 79
31 3300042611 Ga0466697_180904 Ga0466697_180904_193_432 79
32 3300042611 Ga0466697_216792 Ga0466697_216792_3580_3819 79
33 3300042611 Ga0466697_252036 Ga0466697_252036_7229_7468 79
34 3300042612 Ga0466705_044372 Ga0466705_044372_8897_9136 79
35 3300042612 Ga0466705_137281 Ga0466705_137281_367_606 79
36 3300042612 Ga0466705_501841 Ga0466705_501841_1049_1288 79
37 3300042612 Ga0466705_511132 Ga0466705_511132_814_1053 79
38 3300042614 Ga0466712_024961 Ga0466712_024961_1073_1312 79
39 3300042614 Ga0466712_312949 Ga0466712_312949_367_606 79
40 3300042615 Ga0466711_034152 Ga0466711_034152_513_752 79
41 3300042615 Ga0466711_216454 Ga0466711_216454_589_828 79
42 3300042616 Ga0466715_214675 Ga0466715_214675_248_487 79
43 3300042617 Ga0466718_009450 Ga0466718_009450_1535_1774 79
44 3300042617 Ga0466718_013533 Ga0466718_013533_166_405 79
45 3300042617 Ga0466718_108929 Ga0466718_108929_284_523 79
46 3300042617 Ga0466718_161813 Ga0466718_161813_442_681 79
47 3300042619 Ga0466726_009517 Ga0466726_009517_108_347 79
48 3300042619 Ga0466726_394515 Ga0466726_394515_565_804 79
49 3300042623 Ga0466734_033444 Ga0466734_033444_1141_1380 79
50 3300042624 Ga0466735_012573 Ga0466735_012573_1340_1579 79
51 3300042635 Ga0466702_001123 Ga0466702_001123_535_774 79
52 3300042635 Ga0466702_038299 Ga0466702_038299_413_652 79
53 3300042635 Ga0466702_463735 Ga0466702_463735_397_636 79
54 3300042643 Ga0466704_355553 Ga0466704_355553_7190_7429 79
55 3300042643 Ga0466704_521718 Ga0466704_521718_676_915 79
56 3300042643 Ga0466704_525031 Ga0466704_525031_1964_2203 79
57 3300042643 Ga0466704_607703 Ga0466704_607703_1019_1258 79
58 3300042652 Ga0466708_111544 Ga0466708_111544_158_397 79
59 3300042654 Ga0466725_013893 Ga0466725_013893_1221_1460 79
60 3300042655 Ga0466727_132024 Ga0466727_132024_626_865 79
61 3300042655 Ga0466727_209091 Ga0466727_209091_1217_1456 79
62 3300042655 Ga0466727_239688 Ga0466727_239688_741_980 79
63 3300042655 Ga0466727_335029 Ga0466727_335029_417_656 79
64 3300042659 Ga0466733_087064 Ga0466733_087064_998_1237 79
65 iso_pr_bacteria 2820223845 2820224140 79
66 iso_pr_bacteria 2820227065 2820228676 79
67 iso_pr_bacteria 2820231849 2820231942 79
68 iso_pr_bacteria 2820576413 2820579314 79
69 iso_pr_bacteria 2820590132 2820590297 79
70 3300002449 JGI24698J34947_10000596 JGI24698J34947_1000059614 80
71 3300002449 JGI24698J34947_10058157 JGI24698J34947_100581573 80
72 3300002449 JGI24698J34947_10073578 JGI24698J34947_100735782 80
73 3300002449 JGI24698J34947_10103780 JGI24698J34947_101037803 80
74 3300002449 JGI24698J34947_10290990 JGI24698J34947_102909902 80
75 3300002462 JGI24702J35022_10000116 JGI24702J35022_1000011624 80
76 3300002462 JGI24702J35022_10020619 JGI24702J35022_100206194 80
77 3300002462 JGI24702J35022_10049883 JGI24702J35022_100498833 80
78 3300002462 JGI24702J35022_10133435 JGI24702J35022_101334351 80
79 3300002462 JGI24702J35022_10275342 JGI24702J35022_102753422 80
80 3300002462 JGI24702J35022_10312213 JGI24702J35022_103122131 80
81 3300002462 JGI24702J35022_10392495 JGI24702J35022_103924951 80
82 3300002462 JGI24702J35022_10426859 JGI24702J35022_104268592 80
83 3300002462 JGI24702J35022_10828930 JGI24702J35022_108289302 80
84 3300002462 JGI24702J35022_10924357 JGI24702J35022_109243571 80
85 3300005071 Ga0068302_10399227 Ga0068302_103992272 80
86 3300005201 Ga0072941_1172024 Ga0072941_11720242 80
87 3300009784 Ga0123357_10147999 Ga0123357_101479993 80
88 3300009784 Ga0123357_10166973 Ga0123357_101669732 80
89 3300009784 Ga0123357_10818328 Ga0123357_108183282 80
90 3300009826 Ga0123355_10005123 Ga0123355_1000512315 80
91 3300009826 Ga0123355_10213768 Ga0123355_102137685 80
92 3300009826 Ga0123355_10282513 Ga0123355_102825132 80
93 3300009826 Ga0123355_10420345 Ga0123355_104203453 80
94 3300009826 Ga0123355_10992137 Ga0123355_109921372 80
95 3300010049 Ga0123356_10030205 Ga0123356_100302055 80
96 3300010049 Ga0123356_10155455 Ga0123356_101554552 80
97 3300010049 Ga0123356_10282852 Ga0123356_102828524 80
98 3300010049 Ga0123356_10293586 Ga0123356_102935864 80
99 3300010049 Ga0123356_10318947 Ga0123356_103189471 80
100 3300010049 Ga0123356_10398113 Ga0123356_103981132 80
101 3300010049 Ga0123356_10442655 Ga0123356_104426553 80
102 3300010049 Ga0123356_10680244 Ga0123356_106802442 80
103 3300010049 Ga0123356_11584804 Ga0123356_115848042 80
104 3300010049 Ga0123356_12187035 Ga0123356_121870352 80
105 3300010049 Ga0123356_12827334 Ga0123356_128273342 80
106 3300010049 Ga0123356_13609915 Ga0123356_136099152 80
107 3300010167 Ga0123353_10002686 Ga0123353_1000268611 80
108 3300010167 Ga0123353_10040312 Ga0123353_100403125 80
109 3300010167 Ga0123353_10208266 Ga0123353_102082663 80
110 3300010167 Ga0123353_10912547 Ga0123353_109125473 80
111 3300010167 Ga0123353_11055521 Ga0123353_110555213 80
112 3300010167 Ga0123353_11251775 Ga0123353_112517751 80
113 3300010167 Ga0123353_11302705 Ga0123353_113027052 80
114 3300010882 Ga0123354_10009622 Ga0123354_1000962210 80
115 3300010882 Ga0123354_10426304 Ga0123354_104263042 80
116 3300038395 Ga0415639_112907 Ga0415639_112907_666_908 80
117 3300038395 Ga0415639_112908 Ga0415639_112908_1182_1424 80
118 3300042592 Ga0466693_417972 Ga0466693_417972_206_448 80
119 3300042604 Ga0466717_281167 Ga0466717_281167_179_421 80
120 3300042608 Ga0466721_259809 Ga0466721_259809_1461_1703 80
121 3300042615 Ga0466711_015996 Ga0466711_015996_5345_5587 80
122 iso_pr_bacteria 2781125659 2781328674 80
123 iso_pr_bacteria 2781125666 2781345295 80
124 3300002450 JGI24695J34938_10001368 JGI24695J34938_1000136817 81
125 3300009784 Ga0123357_10154699 Ga0123357_101546994 81
126 3300009784 Ga0123357_10691152 Ga0123357_106911522 81
127 3300010049 Ga0123356_10008056 Ga0123356_100080568 81
128 3300010049 Ga0123356_10020406 Ga0123356_100204064 81
129 3300010049 Ga0123356_10021285 Ga0123356_100212853 81
130 3300010049 Ga0123356_10082531 Ga0123356_100825315 81
131 3300010049 Ga0123356_10150835 Ga0123356_101508354 81
132 3300010049 Ga0123356_10349800 Ga0123356_103498003 81
133 3300010049 Ga0123356_10432595 Ga0123356_104325953 81
134 3300010049 Ga0123356_10525424 Ga0123356_105254243 81
135 3300010049 Ga0123356_10773395 Ga0123356_107733953 81
136 3300010049 Ga0123356_12010074 Ga0123356_120100742 81
137 3300010049 Ga0123356_12298779 Ga0123356_122987792 81
138 3300010049 Ga0123356_12577231 Ga0123356_125772312 81
139 3300010049 Ga0123356_12696451 Ga0123356_126964512 81
140 3300010167 Ga0123353_10119856 Ga0123353_101198564 81
141 3300010167 Ga0123353_10549489 Ga0123353_105494893 81
142 3300010167 Ga0123353_10759174 Ga0123353_107591744 81
143 3300042608 Ga0466721_273193 Ga0466721_273193_2441_2686 81
144 3300000089 AustNasuHG_c1000205 AustNasuHG_100020525 82
145 3300002462 JGI24702J35022_10084670 JGI24702J35022_100846701 82
146 3300002462 JGI24702J35022_10187812 JGI24702J35022_101878123 82
147 3300010049 Ga0123356_10481473 Ga0123356_104814732 82
148 3300010167 Ga0123353_12788479 Ga0123353_127884791 82
149 3300042597 Ga0466699_182944 Ga0466699_182944_41_289 82
150 3300042609 Ga0466722_106840 Ga0466722_106840_542_790 82
151 3300010049 Ga0123356_11371948 Ga0123356_113719482 83
152 3300010167 Ga0123353_11436059 Ga0123353_114360593 83
153 3300042602 Ga0466713_103494 Ga0466713_103494_695_946 83
154 3300042635 Ga0466702_183166 Ga0466702_183166_173_424 83
155 3300042608 Ga0466721_187392 Ga0466721_187392_2231_2491 86
156 iso_pr_bacteria 2820580397 2820581511 86
157 3300010049 Ga0123356_10118205 Ga0123356_101182053 87
158 3300042591 Ga0466692_052983 Ga0466692_052983_1838_2101 87
159 3300042591 Ga0466692_153228 Ga0466692_153228_20718_20981 87
160 3300042594 Ga0466694_341449 Ga0466694_341449_712_975 87
161 3300009826 Ga0123355_10403274 Ga0123355_104032743 88
162 3300010049 Ga0123356_10780924 Ga0123356_107809242 88
163 3300010049 Ga0123356_13394870 Ga0123356_133948701 88
164 iso_pr_bacteria 2781125663 2781338700 91

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.67 0.75 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.