Protein Family IF11791

Metagenome Isolate
137 Members
51 Samples
119 Scaffolds
607.6 Avg Length

🧬 Representative Sequence

ID
iso_pr_bacteria|2781125659|2781326728|
Length
700 aa
Sequence
LTKGSILIVPNSEPGQGGGHLTRCIKLARDLRSLGRETWLFITPQTRDLTNLYLSLNFNPAWCITNEELTIRNEKLGKTFDFIIMDRFQTPLDELIRWKNIAPVIGVDEGGKHRDKFNFLIDMLIPENFIHPPANIYSPHWLIDKHIIDNITTTQQNLELSELNNNHGVHGGTRRFLYEGSIFSENLQVLQNKDSKFKILISFGQEDKANLGNKIAKKLSTIKSNYPIEITLLKGSLNTNHSTFHIPHSTLSKHSTLKIIESIPNLALHLNEYNLLITHYGITAYEALFTGTPVILAHPTPYHKKLAKTAGFLDIKHLSSLIKRIKNHGELQPKLLGGTRKFWFENLFSSVNLRVLRVLRGKILTYTNLAETCNNLLLTVNRGCPVCGSGTSKTISRYNDRTYHRCFKCGIIYMDRTNLPPIEYEKEYFFESYKNQYGKTYLEDFDNIKESGKKRINIISKILNRGTETRWTRRENKDIESLKLLDIGCAYGPFLAAAKEANYSPFGIDPAEDAIKYVTETLNIPAIHSFFPLLHSTLNIPHSTLNKHSTLNIPHSTLLKNSTLNNNSYNVITLWFVIEHFTDCVSVLNEVKRLLKPGGLLAFSTPSFSGISGRSSIHRFLSKSPADHWTIWSPKSAKKALVITGFKVKKIVIVGHHPERFPVLGKLAKNKKSPVYWLLLIISKIFYLGDTFEVYAELNK

📊 Sample Types

Isolate 13.1%
Metagenome 86.9%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 38.8%
Termitidae 38.8%
Kalotermitidae 18.4%
Rhinotermitidae 4.1%

🌳 Taxonomy

Archaea 1
Bacteria 135
Eukaryota 0
Viruses 0
Unclassified 1

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125660 Treponema sp. Emb289P3bin52 Isolate Unclassified
2 2819992462 Unclassified Spirochaetes Nc150P4bin14 Isolate Unclassified
3 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
4 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
5 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
6 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
7 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
8 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
9 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
10 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
11 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
12 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
13 2781125646 Treponema sp. Co191P3bin59 Isolate Unclassified
14 2781125659 Treponema sp. Emb289P3bin114 Isolate Unclassified
15 2781125629 Treponema sp. Nt197P3bin20 Isolate Unclassified
16 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
17 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
18 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
19 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
20 2772190978 Treponema sp. Nt197P3bin57 Isolate Unclassified
21 2781125635 Treponema sp. Co191P1bin60 Isolate Unclassified
22 2781125662 Treponema sp. Emb289P3bin141 Isolate Unclassified
23 2820020240 Unclassified Spirochaetes Nc150P3bin10 Isolate Unclassified
24 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
25 2781125643 Treponema sp. Co191P3bin45 Isolate Unclassified
26 2781125648 Treponema sp. Co191P3bin70 Isolate Unclassified
27 2781125650 Treponema sp. Co191P3bin64 Isolate Unclassified
28 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
29 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
30 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
31 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
32 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
33 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
34 2781125634 Treponema sp. Co191P1bin45 Isolate Unclassified
35 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
36 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
37 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
38 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
39 2781125645 Treponema sp. Co191P3bin32 Isolate Unclassified
40 2781125656 Treponema sp. Emb289P1bin65 Isolate Unclassified
41 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
42 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
43 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
44 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
45 2781125630 Treponema sp. Nt197P3bin60 Isolate Unclassified
46 2781125657 Treponema sp. Emb289P3bin15 Isolate Unclassified
47 2781125693 Treponema sp. Th196P3bin148 Isolate Unclassified
48 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
49 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
50 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
51 3300005200 Nasutitermes gut metagenome Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466732_199856 3300042656 Archaea 15051
2 Ga0466709_184041 3300042648 Bacteria 11210
3 Ga0466708_286706 3300042652 Bacteria 8164
4 Ga0415639_020882 3300038395 Bacteria 3990
5 Ga0466690_293165 3300042590 Bacteria 7074
6 Ga0466695_283924 3300042595 Bacteria 5253
7 Ga0466712_077971 3300042614 Bacteria 32694
8 Ga0466712_141117 3300042614 Bacteria 4403
9 JGI24698J34947_10010086 3300002449 Bacteria 5178
10 JGI24698J34947_10017442 3300002449 Bacteria 3891
11 Ga0072941_1006754 3300005201 Bacteria 15785
12 Ga0072941_1019668 3300005201 Bacteria 6412
13 Ga0466732_104465 3300042656 Bacteria 8406
14 Ga0466708_452394 3300042652 Bacteria 8545
15 Ga0466694_199924 3300042594 Bacteria 13991
16 Ga0466712_046969 3300042614 Bacteria 9843
17 Ga0466712_113211 3300042614 Bacteria 14585
18 Ga0466712_165953 3300042614 Bacteria 35107
19 Ga0466715_065500 3300042616 Bacteria 24099
20 Ga0123356_10000032 3300010049 Bacteria 154381
21 Ga0123356_10097384 3300010049 Bacteria 2815
22 AustNasuHG_c1013109 3300000089 Bacteria 2849
23 JGI24698J34947_10003538 3300002449 Bacteria 8480
24 JGI24698J34947_10007627 3300002449 Bacteria 5946
25 JGI24698J34947_10054756 3300002449 Bacteria 1990
26 JGI24695J34938_10000635 3300002450 Bacteria 33494
27 JGI24695J34938_10013291 3300002450 Bacteria 4330
28 Ga0466720_238860 3300042607 Bacteria 102895
29 Ga0466721_239644 3300042608 Bacteria 18017
30 Ga0466722_027937 3300042609 Bacteria 29446
31 Ga0466699_110498 3300042597 Bacteria 24920
32 Ga0466712_005338 3300042614 Bacteria 40115
33 Ga0466712_265690 3300042614 Bacteria 51797
34 Ga0123355_10155228 3300009826 Bacteria 3465
35 Ga0123356_10000504 3300010049 Bacteria 43651
36 AustNasuHG_c1000172 3300000089 Bacteria 20968
37 AustNasuHG_c1003312 3300000089 Bacteria 5811
38 JGI24695J34938_10000229 3300002450 Bacteria 53063
39 JGI24695J34938_10003009 3300002450 Bacteria 12113
40 JGI24702J35022_10029770 3300002462 Bacteria 2930
41 Ga0072941_1011111 3300005201 Bacteria 22501
42 Ga0466732_153424 3300042656 Bacteria 6614
43 Ga0466707_081560 3300042601 Bacteria 4041
44 Ga0466698_117433 3300042610 Bacteria 21128
45 Ga0466712_065994 3300042614 Bacteria 33285
46 Ga0466712_122176 3300042614 Bacteria 31114
47 Ga0466712_173676 3300042614 Bacteria 5713
48 Ga0123355_10013174 3300009826 Bacteria 12853
49 JGI24698J34947_10006608 3300002449 Bacteria 6373
50 JGI24698J34947_10041678 3300002449 Bacteria 2363
51 JGI24695J34938_10000012 3300002450 Bacteria 126955
52 JGI24695J34938_10000282 3300002450 Bacteria 50082
53 JGI24695J34938_10011288 3300002450 Bacteria 4819
54 Ga0072940_1033040 3300005200 Bacteria 7729
55 Ga0466720_043295 3300042607 Bacteria 7532
56 Ga0466720_064659 3300042607 Bacteria 13696
57 Ga0466691_106634 3300042593 Bacteria 18352
58 Ga0466718_008561 3300042617 Bacteria 19760
59 Ga0466718_117275 3300042617 Bacteria 17730
60 Ga0466723_070615 3300042618 Bacteria 9806
61 Ga0123356_10000204 3300010049 Bacteria 68773
62 Ga0123353_10100033 3300010167 Bacteria 4673
63 AustNasuHG_c1006220 3300000089 Bacteria 4268
64 JGI24698J34947_10000022 3300002449 Bacteria 40410
65 JGI24698J34947_10000216 3300002449 Bacteria 23797
66 JGI24698J34947_10009217 3300002449 Bacteria 5416
67 JGI24695J34938_10000016 3300002450 Bacteria 116336
68 JGI24695J34938_10002695 3300002450 Bacteria 13196
69 JGI24695J34938_10003627 3300002450 Bacteria 10606
70 Ga0466719_315195 3300042606 Bacteria 8891
71 Ga0466692_192135 3300042591 Bacteria 14735
72 Ga0466712_070678 3300042614 Bacteria 18159
73 Ga0466712_243445 3300042614 Bacteria 16357
74 Ga0466712_256662 3300042614 Bacteria 11513
75 Ga0466718_048292 3300042617 Bacteria 18116
76 Ga0466718_064604 3300042617 Bacteria 11623
77 Ga0466718_073527 3300042617 Bacteria 14374
78 Ga0466718_076935 3300042617 Bacteria 9274
79 Ga0123356_10125364 3300010049 Bacteria 2506
80 Ga0123353_10258596 3300010167 Bacteria 2691
81 AustNasuHG_c1002194 3300000089 Bacteria 7054
82 JGI24695J34938_10000031 3300002450 Bacteria 105176
83 Ga0072941_1004185 3300005201 Bacteria 50030
84 Ga0072941_1005156 3300005201 Bacteria 21941
85 Ga0072941_1021730 3300005201 Bacteria 3949
86 Ga0466720_138529 3300042607 Bacteria 8511
87 Ga0466708_045919 3300042652 Bacteria 6164
88 Ga0264413_119998 3300024493 Bacteria 6895
89 Ga0466693_157196 3300042592 Bacteria 53244
90 Ga0466693_237474 3300042592 Bacteria 33903
91 Ga0466712_204722 3300042614 Bacteria 2436
92 Ga0466712_310176 3300042614 Bacteria 26726
93 Ga0466718_012794 3300042617 Bacteria 11897
94 Ga0466718_094659 3300042617 Bacteria 3258
95 JGI24698J34947_10001101 3300002449 Bacteria 13934
96 JGI24698J34947_10001134 3300002449 Bacteria 13806
97 JGI24698J34947_10004003 3300002449 Bacteria 8009
98 JGI24698J34947_10005317 3300002449 Bacteria 7064
99 JGI24695J34938_10000590 3300002450 Bacteria 34943
100 JGI24695J34938_10004823 3300002450 Unclassified 8671
101 JGI24695J34938_10025476 3300002450 Bacteria 2827
102 Ga0466705_230051 3300042612 Bacteria 6659
103 Ga0466708_011864 3300042652 Bacteria 3175
104 Ga0466694_051976 3300042594 Bacteria 2580
105 Ga0466696_099839 3300042596 Bacteria 1991
106 Ga0466712_022445 3300042614 Bacteria 9404
107 Ga0466712_130010 3300042614 Bacteria 6904
108 Ga0466715_427231 3300042616 Bacteria 12547
109 Ga0466718_073355 3300042617 Bacteria 21623
110 Ga0123356_10000062 3300010049 Bacteria 112695
111 Ga0123356_10090690 3300010049 Bacteria 2911
112 AustNasuHG_c1000193 3300000089 Bacteria 20133
113 JGI24698J34947_10004890 3300002449 Bacteria 7341
114 JGI24698J34947_10007418 3300002449 Bacteria 6030
115 JGI24695J34938_10002857 3300002450 Bacteria 12586
116 JGI24695J34938_10013399 3300002450 Bacteria 4308
117 JGI24695J34938_10014500 3300002450 Bacteria 4083
118 JGI24695J34938_10017345 3300002450 Bacteria 3631
119 Ga0072941_1019666 3300005201 Bacteria 7092

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042614 Ga0466712_065994 Ga0466712_065994_12858_14546 555
2 3300042617 Ga0466718_012794 Ga0466718_012794_3936_5663 562
3 3300042617 Ga0466718_064604 Ga0466718_064604_6504_8231 562
4 3300042656 Ga0466732_104465 Ga0466732_104465_3254_5005 567
5 3300042617 Ga0466718_073355 Ga0466718_073355_13632_15344 570
6 3300042617 Ga0466718_076935 Ga0466718_076935_4110_5867 570
7 3300042614 Ga0466712_141117 Ga0466712_141117_315_2174 573
8 3300002450 JGI24695J34938_10013291 JGI24695J34938_100132913 574
9 3300010049 Ga0123356_10000504 Ga0123356_1000050420 574
10 3300042614 Ga0466712_046969 Ga0466712_046969_5440_7275 574
11 3300042614 Ga0466712_165953 Ga0466712_165953_3638_5404 574
12 3300002449 JGI24698J34947_10007627 JGI24698J34947_100076273 575
13 3300042614 Ga0466712_256662 Ga0466712_256662_7904_9718 576
14 3300042614 Ga0466712_077971 Ga0466712_077971_4763_6532 577
15 3300010049 Ga0123356_10125364 Ga0123356_101253642 579
16 3300005201 Ga0072941_1006754 Ga0072941_100675410 580
17 3300002449 JGI24698J34947_10003538 JGI24698J34947_100035385 583
18 3300042614 Ga0466712_022445 Ga0466712_022445_6032_7822 583
19 3300005201 Ga0072941_1019668 Ga0072941_10196682 584
20 3300005201 Ga0072941_1011111 Ga0072941_101111120 585
21 3300042590 Ga0466690_293165 Ga0466690_293165_3384_5141 585
22 3300042608 Ga0466721_239644 Ga0466721_239644_7165_8961 585
23 3300042614 Ga0466712_122176 Ga0466712_122176_10079_11893 585
24 3300000089 AustNasuHG_c1013109 AustNasuHG_10131092 586
25 3300005201 Ga0072941_1005156 Ga0072941_100515616 586
26 3300042610 Ga0466698_117433 Ga0466698_117433_8335_10134 586
27 3300002449 JGI24698J34947_10001134 JGI24698J34947_100011345 587
28 3300002449 JGI24698J34947_10007418 JGI24698J34947_100074184 587
29 3300002450 JGI24695J34938_10011288 JGI24695J34938_100112882 587
30 3300042594 Ga0466694_051976 Ga0466694_051976_364_2178 587
31 3300042617 Ga0466718_048292 Ga0466718_048292_7957_9900 587
32 3300002449 JGI24698J34947_10054756 JGI24698J34947_100547562 589
33 3300042594 Ga0466694_199924 Ga0466694_199924_2155_3924 589
34 3300038395 Ga0415639_020882 Ga0415639_020882_414_2186 590
35 3300042614 Ga0466712_070678 Ga0466712_070678_3962_5788 590
36 3300002449 JGI24698J34947_10001101 JGI24698J34947_100011018 591
37 3300002450 JGI24695J34938_10013399 JGI24695J34938_100133992 591
38 3300042656 Ga0466732_153424 Ga0466732_153424_878_2653 591
39 iso_pr_bacteria 2781125660 2781330288 591
40 3300010049 Ga0123356_10000062 Ga0123356_1000006281 592
41 iso_pr_bacteria 2781125646 2781300292 592
42 3300002449 JGI24698J34947_10006608 JGI24698J34947_100066083 593
43 3300002450 JGI24695J34938_10000016 JGI24695J34938_1000001699 593
44 3300002450 JGI24695J34938_10003627 JGI24695J34938_100036274 593
45 3300042617 Ga0466718_094659 Ga0466718_094659_1156_2937 593
46 iso_pr_bacteria 2819992462 2819993540 593
47 iso_pr_bacteria 2820020240 2820021815 593
48 3300005200 Ga0072940_1033040 Ga0072940_10330404 594
49 3300042607 Ga0466720_064659 Ga0466720_064659_5534_7318 594
50 3300042614 Ga0466712_113211 Ga0466712_113211_10429_12321 594
51 3300000089 AustNasuHG_c1000193 AustNasuHG_10001938 595
52 3300000089 AustNasuHG_c1002194 AustNasuHG_10021942 596
53 3300002450 JGI24695J34938_10025476 JGI24695J34938_100254762 596
54 3300042607 Ga0466720_238860 Ga0466720_238860_47892_49685 597
55 3300042617 Ga0466718_008561 Ga0466718_008561_11709_13541 597
56 3300042591 Ga0466692_192135 Ga0466692_192135_2809_4605 598
57 3300002449 JGI24698J34947_10005317 JGI24698J34947_100053175 599
58 iso_pr_bacteria 2781125656 2781320257 599
59 3300002449 JGI24698J34947_10004890 JGI24698J34947_100048905 600
60 3300009826 Ga0123355_10013174 Ga0123355_100131746 600
61 3300042614 Ga0466712_173676 Ga0466712_173676_3602_5494 600
62 3300010049 Ga0123356_10090690 Ga0123356_100906902 601
63 3300042618 Ga0466723_070615 Ga0466723_070615_3465_5273 602
64 3300002450 JGI24695J34938_10004823 JGI24695J34938_100048234 603
65 3300042614 Ga0466712_243445 Ga0466712_243445_9284_11095 603
66 3300042652 Ga0466708_452394 Ga0466708_452394_2905_4716 603
67 3300002449 JGI24698J34947_10041678 JGI24698J34947_100416782 604
68 3300002450 JGI24695J34938_10000229 JGI24695J34938_100002291 604
69 3300005201 Ga0072941_1004185 Ga0072941_100418544 604
70 3300024493 Ga0264413_119998 Ga0264413_1199983 605
71 3300002449 JGI24698J34947_10010086 JGI24698J34947_100100864 606
72 3300002450 JGI24695J34938_10000012 JGI24695J34938_10000012114 606
73 3300002450 JGI24695J34938_10003009 JGI24695J34938_100030098 606
74 3300042617 Ga0466718_073527 Ga0466718_073527_37_1893 606
75 3300005201 Ga0072941_1019666 Ga0072941_10196664 607
76 3300000089 AustNasuHG_c1003312 AustNasuHG_10033123 608
77 3300002449 JGI24698J34947_10009217 JGI24698J34947_100092173 608
78 3300005201 Ga0072941_1021730 Ga0072941_10217304 608
79 3300009826 Ga0123355_10155228 Ga0123355_101552283 608
80 iso_pr_bacteria 2781125662 2781336363 608
81 3300002450 JGI24695J34938_10002695 JGI24695J34938_1000269513 610
82 iso_pr_bacteria 2781125693 2781434865 610
83 3300000089 AustNasuHG_c1006220 AustNasuHG_10062203 612
84 3300002450 JGI24695J34938_10002857 JGI24695J34938_100028578 613
85 3300002450 JGI24695J34938_10017345 JGI24695J34938_100173451 613
86 3300042612 Ga0466705_230051 Ga0466705_230051_835_2679 614
87 iso_pr_bacteria 2781125650 2781309242 614
88 3300042597 Ga0466699_110498 Ga0466699_110498_12353_14200 615
89 3300042614 Ga0466712_310176 Ga0466712_310176_24139_25986 615
90 3300042652 Ga0466708_045919 Ga0466708_045919_3993_5882 615
91 3300010049 Ga0123356_10097384 Ga0123356_100973842 616
92 3300042609 Ga0466722_027937 Ga0466722_027937_17613_19463 616
93 3300042614 Ga0466712_130010 Ga0466712_130010_3112_5004 616
94 3300042656 Ga0466732_199856 Ga0466732_199856_6585_8435 616
95 3300002450 JGI24695J34938_10000031 JGI24695J34938_1000003135 617
96 3300042596 Ga0466696_099839 Ga0466696_099839_128_1981 617
97 3300042616 Ga0466715_065500 Ga0466715_065500_18563_20416 617
98 3300042592 Ga0466693_157196 Ga0466693_157196_6173_8074 618
99 3300042592 Ga0466693_237474 Ga0466693_237474_10816_12678 620
100 iso_pr_bacteria 2781125635 2781276900 621
101 iso_pr_bacteria 2781125645 2781298475 621
102 3300002449 JGI24698J34947_10004003 JGI24698J34947_100040032 622
103 3300000089 AustNasuHG_c1000172 AustNasuHG_100017213 623
104 3300002449 JGI24698J34947_10000022 JGI24698J34947_1000002224 623
105 3300002450 JGI24695J34938_10000590 JGI24695J34938_1000059011 625
106 3300042595 Ga0466695_283924 Ga0466695_283924_1808_3685 625
107 3300002449 JGI24698J34947_10017442 JGI24698J34947_100174422 627
108 3300002462 JGI24702J35022_10029770 JGI24702J35022_100297702 627
109 3300042617 Ga0466718_117275 Ga0466718_117275_8123_10057 628
110 3300042652 Ga0466708_286706 Ga0466708_286706_5337_7283 628
111 iso_pr_bacteria 2772190978 2773730161 628
112 3300042601 Ga0466707_081560 Ga0466707_081560_1144_3033 629
113 iso_pr_bacteria 2781125657 2781322293 631
114 3300010049 Ga0123356_10000032 Ga0123356_1000003263 632
115 3300042614 Ga0466712_265690 Ga0466712_265690_32034_33932 632
116 iso_pr_bacteria 2781125648 2781305084 632
117 3300002449 JGI24698J34947_10000216 JGI24698J34947_1000021616 633
118 3300002450 JGI24695J34938_10000635 JGI24695J34938_1000063518 633
119 3300042606 Ga0466719_315195 Ga0466719_315195_3502_5415 637
120 3300042593 Ga0466691_106634 Ga0466691_106634_5479_7395 638
121 3300042614 Ga0466712_005338 Ga0466712_005338_34193_36205 638
122 iso_pr_bacteria 2781125634 2781274103 638
123 iso_pr_bacteria 2781125643 2781294288 638
124 3300002450 JGI24695J34938_10000282 JGI24695J34938_100002821 639
125 3300002450 JGI24695J34938_10014500 JGI24695J34938_100145002 639
126 3300042614 Ga0466712_204722 Ga0466712_204722_183_2192 639
127 3300042648 Ga0466709_184041 Ga0466709_184041_5468_7468 639
128 3300042607 Ga0466720_043295 Ga0466720_043295_1735_3666 643
129 3300042607 Ga0466720_138529 Ga0466720_138529_1013_2947 644
130 3300010167 Ga0123353_10100033 Ga0123353_101000333 645
131 iso_pr_bacteria 2781125629 2781264168 651
132 3300042616 Ga0466715_427231 Ga0466715_427231_6263_8239 658
133 3300042652 Ga0466708_011864 Ga0466708_011864_956_2944 662
134 3300010049 Ga0123356_10000204 Ga0123356_1000020450 667
135 3300010167 Ga0123353_10258596 Ga0123353_102585962 681
136 iso_pr_bacteria 2781125630 2781266990 693
137 iso_pr_bacteria 2781125659 2781326728 700

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF08242 Methyltransf_12 Methyltransferase domain 485 601 0.95
PF13847 Methyltransf_31 Methyltransferase domain 559 607 0.84
PF13489 Methyltransf_23 Methyltransferase domain 477 648 0.83
PF08241 Methyltransf_11 Methyltransferase domain 485 603 0.83

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF08241 GO:0008757 S-adenosylmethionine-dependent methyltransferase activity MF

🏗️ Structural Annotation – Top 5 Hits

IDDescriptionScoreStartEnd
2zbq-assembly1.cif.gz_A Crystal structure of ribosomal protein L11 methyltransferase from Thermus thermophilus in complex with S-adenosyl-L-homocysteine 0.813 481 697
3cjq-assembly2.cif.gz_D Ribosomal protein L11 methyltransferase (PrmA) in complex with dimethylated ribosomal protein L11 in space group P212121 0.801 481 697
2nxe-assembly2.cif.gz_B T. thermophilus ribosomal protein L11 methyltransferase (PrmA) in complex with S-Adenosyl-L-Methionine 0.8 481 697
2nxc-assembly1.cif.gz_A Apo-form of T. thermophilus ribosomal protein L11 methyltransferase (PrmA) 0.789 481 697
2zbp-assembly1.cif.gz_A Crystal structure of ribosomal protein L11 methyltransferase from Thermus thermophilus in complex with S-adenosyl-L-methionine 0.784 481 697
IDDescriptionScoreStartEndSuperfamily
af_I1N7H2_105_241_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9447 564 603 3.40.50.150
af_Q4D3E1_216_398_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9321 481 515 3.40.50.150
af_Q9P3E7_8_144_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8228 482 610 3.40.50.150
2frdB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8126 482 527 3.40.50.720
af_Q9SZ14_73_204_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8043 561 700 3.40.50.150
IDDescriptionScoreStartEndGO Terms
AF-A0A2P2DYC0-F1-model_v4 Uncharacterized/unreviewed 0.8779 403 700 GO:0008168
GO:0032259

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.81 0.87 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.