Protein Family IF11772

Metagenome Isolate
116 Members
47 Samples
108 Scaffolds
128.25 Avg Length

🧬 Representative Sequence

ID
iso_pr_bacteria|2781125648|2781305016|
Length
144 aa
Sequence
MKIIRKKKSGFLETCAASDLAFLLIIYFLVIAGFNINNGFVVNLPAKDSTRLILADDLLRFELNESGELIHSGEVINXSNARRLINTSQISNPNIAVILTIDGKTRWQNVVSFVELAQDLKIESFSFTKKKETDYGQSGLAEAQ

📊 Sample Types

Isolate 6.9%
Metagenome 93.1%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 48.9%
Unclassified 22.2%
Kalotermitidae 15.6%
Termopsidae 6.7%
Rhinotermitidae 4.4%
Hodotermitidae 2.2%

🌳 Taxonomy

Archaea 1
Bacteria 107
Eukaryota 0
Viruses 0
Unclassified 8

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125661 Treponema sp. Emb289P3bin69 Isolate Unclassified
2 2781125685 Treponema sp. Lab288P1bin13 Isolate Unclassified
3 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
4 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
5 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
6 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
7 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
8 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
9 2781125643 Treponema sp. Co191P3bin45 Isolate Unclassified
10 2781125648 Treponema sp. Co191P3bin70 Isolate Unclassified
11 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
12 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
13 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
14 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
15 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
16 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
17 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
18 2781125659 Treponema sp. Emb289P3bin114 Isolate Unclassified
19 2781125692 Treponema sp. Th196P3bin31 Isolate Unclassified
20 2781125645 Treponema sp. Co191P3bin32 Isolate Unclassified
21 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
22 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
23 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
24 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
25 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
26 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
27 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
28 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
29 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
30 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
31 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
32 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
33 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
34 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
35 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
36 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
37 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
38 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
39 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
40 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
41 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
42 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
43 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
44 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
45 2781125662 Treponema sp. Emb289P3bin141 Isolate Unclassified
46 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
47 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 JGI24695J34938_10000525 3300002450 Bacteria 37223
2 JGI24695J34938_10020288 3300002450 Unclassified 3273
3 Ga0072941_1131617 3300005201 Bacteria 651
4 Ga0123356_10580464 3300010049 Bacteria 1284
5 Ga0466726_131506 3300042619 Bacteria 6553
6 Ga0466727_293474 3300042655 Unclassified 1136
7 Ga0466657_000396 3300042582 Bacteria 1146
8 Ga0466699_240564 3300042597 Bacteria 1513
9 JGI24698J34947_10000172 3300002449 Bacteria 25168
10 JGI24695J34938_10071892 3300002450 Bacteria 1444
11 Ga0072941_1000644 3300005201 Bacteria 7484
12 Ga0072941_1005365 3300005201 Bacteria 13860
13 Ga0466720_116674 3300042607 Bacteria 1861
14 Ga0466722_132546 3300042609 Bacteria 27700
15 Ga0466712_227420 3300042614 Bacteria 5650
16 Ga0466708_041172 3300042652 Bacteria 9720
17 Ga0466693_047917 3300042592 Bacteria 41531
18 Ga0466694_115872 3300042594 Bacteria 4950
19 Ga0466694_151362 3300042594 Bacteria 2595
20 JGI24698J34947_10015933 3300002449 Bacteria 4088
21 JGI24698J34947_10188397 3300002449 Bacteria 818
22 JGI24695J34938_10004479 3300002450 Bacteria 9139
23 JGI24695J34938_10054824 3300002450 Bacteria 1726
24 JGI24702J35022_10006277 3300002462 Bacteria 6877
25 Ga0123356_13234480 3300010049 Bacteria 567
26 Ga0466706_115934 3300042599 Bacteria 3893
27 Ga0466716_534438 3300042605 Bacteria 1167
28 Ga0466712_133856 3300042614 Unclassified 8851
29 Ga0466712_213975 3300042614 Unclassified 12095
30 Ga0466718_040277 3300042617 Bacteria 2661
31 Ga0466702_046770 3300042635 Bacteria 1608
32 Ga0466696_305007 3300042596 Bacteria 2790
33 Ga0466699_128530 3300042597 Bacteria 2252
34 JGI24698J34947_10297017 3300002449 Bacteria 584
35 JGI24695J34938_10000063 3300002450 Bacteria 87942
36 JGI24695J34938_10011813 3300002450 Bacteria 4678
37 JGI24695J34938_10017731 3300002450 Bacteria 3576
38 Ga0123355_10186646 3300009826 Bacteria 3064
39 Ga0466700_145486 3300042600 Bacteria 1565
40 Ga0466713_035195 3300042602 Bacteria 1597
41 Ga0466720_173499 3300042607 Bacteria 10685
42 Ga0466702_376079 3300042635 Bacteria 1377
43 Ga0466727_296461 3300042655 Bacteria 1159
44 Ga0264413_101847 3300024493 Bacteria 86591
45 Ga0466692_131201 3300042591 Bacteria 5635
46 Ga0466693_321681 3300042592 Bacteria 3081
47 JGI24698J34947_10002236 3300002449 Bacteria 10370
48 JGI24698J34947_10035499 3300002449 Unclassified 2602
49 JGI24702J35022_10065002 3300002462 Bacteria 1957
50 Ga0072941_1024210 3300005201 Bacteria 13759
51 Ga0123356_10000212 3300010049 Bacteria 67664
52 Ga0123356_10008792 3300010049 Bacteria 10004
53 Ga0123356_10020094 3300010049 Bacteria 6326
54 Ga0123356_10068260 3300010049 Bacteria 3330
55 Ga0123356_10525263 3300010049 Bacteria 1342
56 Ga0123356_12320741 3300010049 Bacteria 671
57 Ga0466720_034318 3300042607 Bacteria 32841
58 Ga0466712_123162 3300042614 Bacteria 17754
59 Ga0466712_125699 3300042614 Bacteria 25129
60 Ga0466735_180186 3300042624 Bacteria 2162
61 Ga0466696_316832 3300042596 Bacteria 1493
62 JGI24698J34947_10011624 3300002449 Bacteria 4832
63 JGI24698J34947_10024376 3300002449 Bacteria 3230
64 Ga0072941_1027778 3300005201 Bacteria 16466
65 Ga0072941_1490834 3300005201 Bacteria 831
66 Ga0123356_10155860 3300010049 Bacteria 2274
67 Ga0123353_10691588 3300010167 Bacteria 1434
68 Ga0466707_362666 3300042601 Bacteria 1318
69 Ga0466719_142472 3300042606 Bacteria 1433
70 Ga0466722_250381 3300042609 Bacteria 28643
71 Ga0466712_049964 3300042614 Bacteria 9999
72 Ga0466712_288984 3300042614 Bacteria 5896
73 Ga0466731_055101 3300042622 Bacteria 1047
74 Ga0466704_218857 3300042643 Bacteria 7811
75 Ga0466657_272323 3300042582 Bacteria 1134
76 Ga0466694_063835 3300042594 Bacteria 37589
77 Ga0466699_229142 3300042597 Bacteria 1658
78 AustNasuHG_c1023538 3300000089 Bacteria 1965
79 JGI24698J34947_10036407 3300002449 Bacteria 2563
80 JGI24698J34947_10095604 3300002449 Archaea 1350
81 JGI24698J34947_10134641 3300002449 Bacteria 1051
82 JGI24695J34938_10111543 3300002450 Unclassified 1114
83 Ga0123356_10088054 3300010049 Bacteria 2951
84 Ga0123356_10165157 3300010049 Bacteria 2217
85 Ga0123356_10553062 3300010049 Bacteria 1312
86 Ga0123356_12195884 3300010049 Bacteria 690
87 Ga0123353_10887101 3300010167 Bacteria 1216
88 Ga0123353_12238723 3300010167 Bacteria 660
89 Ga0466717_161169 3300042604 Bacteria 1159
90 Ga0466715_210163 3300042616 Bacteria 48320
91 Ga0466726_494694 3300042619 Bacteria 1759
92 Ga0466731_424366 3300042622 Bacteria 2195
93 Ga0415639_152104 3300038395 Unclassified 3270
94 Ga0466693_436085 3300042592 Bacteria 47244
95 Ga0466695_242276 3300042595 Bacteria 1113
96 Ga0466695_357938 3300042595 Bacteria 1550
97 Ga0466699_063983 3300042597 Bacteria 2957
98 Ga0466699_264362 3300042597 Bacteria 2175
99 JGI24698J34947_10017383 3300002449 Unclassified 3897
100 Ga0123353_10125324 3300010167 Bacteria 4128
101 Ga0123353_10719499 3300010167 Bacteria 1397
102 Ga0466721_213888 3300042608 Bacteria 1747
103 Ga0466698_486454 3300042610 Bacteria 2403
104 Ga0466718_099143 3300042617 Bacteria 25542
105 Ga0466723_338440 3300042618 Bacteria 7204
106 Ga0466731_159129 3300042622 Bacteria 2143
107 Ga0466735_188230 3300042624 Bacteria 1242
108 Ga0466699_059261 3300042597 Bacteria 19120

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042607 Ga0466720_034318 Ga0466720_034318_17570_17974 115
2 3300042607 Ga0466720_116674 Ga0466720_116674_759_1163 115
3 3300002449 JGI24698J34947_10011624 JGI24698J34947_100116244 116
4 3300005201 Ga0072941_1027778 Ga0072941_10277784 116
5 3300005201 Ga0072941_1131617 Ga0072941_11316172 116
6 3300042592 Ga0466693_436085 Ga0466693_436085_28547_28948 116
7 3300042617 Ga0466718_099143 Ga0466718_099143_22260_22664 116
8 3300042618 Ga0466723_338440 Ga0466723_338440_2963_3361 116
9 3300042619 Ga0466726_131506 Ga0466726_131506_1071_1472 116
10 3300042652 Ga0466708_041172 Ga0466708_041172_4925_5329 116
11 3300002449 JGI24698J34947_10035499 JGI24698J34947_100354993 117
12 3300002450 JGI24695J34938_10111543 JGI24695J34938_101115433 117
13 3300009826 Ga0123355_10186646 Ga0123355_101866464 117
14 3300042596 Ga0466696_305007 Ga0466696_305007_546_950 117
15 3300042596 Ga0466696_316832 Ga0466696_316832_40_444 117
16 3300042614 Ga0466712_049964 Ga0466712_049964_9111_9515 117
17 3300042614 Ga0466712_133856 Ga0466712_133856_2269_2673 117
18 3300002449 JGI24698J34947_10002236 JGI24698J34947_100022366 118
19 3300002449 JGI24698J34947_10095604 JGI24698J34947_100956043 118
20 3300042594 Ga0466694_151362 Ga0466694_151362_1582_1986 118
21 3300002450 JGI24695J34938_10020288 JGI24695J34938_100202882 119
22 3300010049 Ga0123356_10000212 Ga0123356_1000021255 119
23 3300010167 Ga0123353_10719499 Ga0123353_107194991 119
24 3300042594 Ga0466694_115872 Ga0466694_115872_3115_3519 119
25 3300042599 Ga0466706_115934 Ga0466706_115934_3149_3559 119
26 3300002462 JGI24702J35022_10006277 JGI24702J35022_100062773 120
27 3300005201 Ga0072941_1490834 Ga0072941_14908342 120
28 3300010049 Ga0123356_10068260 Ga0123356_100682603 120
29 3300042597 Ga0466699_240564 Ga0466699_240564_16_381 121
30 3300002450 JGI24695J34938_10071892 JGI24695J34938_100718921 122
31 3300042597 Ga0466699_063983 Ga0466699_063983_1250_1657 122
32 3300002450 JGI24695J34938_10004479 JGI24695J34938_100044795 123
33 3300002449 JGI24698J34947_10188397 JGI24698J34947_101883972 124
34 3300002450 JGI24695J34938_10000063 JGI24695J34938_1000006328 124
35 3300042601 Ga0466707_362666 Ga0466707_362666_612_1037 124
36 3300042619 Ga0466726_494694 Ga0466726_494694_1270_1695 124
37 3300042655 Ga0466727_293474 Ga0466727_293474_186_611 124
38 3300042604 Ga0466717_161169 Ga0466717_161169_68_466 125
39 3300042609 Ga0466722_132546 Ga0466722_132546_5492_5896 125
40 3300002450 JGI24695J34938_10000525 JGI24695J34938_1000052511 126
41 3300042595 Ga0466695_357938 Ga0466695_357938_1095_1496 126
42 3300042600 Ga0466700_145486 Ga0466700_145486_1102_1503 126
43 3300042605 Ga0466716_534438 Ga0466716_534438_347_778 126
44 3300042606 Ga0466719_142472 Ga0466719_142472_98_499 126
45 3300042643 Ga0466704_218857 Ga0466704_218857_2331_2735 126
46 3300002449 JGI24698J34947_10024376 JGI24698J34947_100243764 127
47 3300002462 JGI24702J35022_10065002 JGI24702J35022_100650023 127
48 3300010167 Ga0123353_10691588 Ga0123353_106915882 127
49 3300010167 Ga0123353_10887101 Ga0123353_108871012 127
50 3300002449 JGI24698J34947_10036407 JGI24698J34947_100364073 128
51 3300024493 Ga0264413_101847 Ga0264413_10184737 128
52 3300042591 Ga0466692_131201 Ga0466692_131201_921_1325 128
53 3300042614 Ga0466712_213975 Ga0466712_213975_4804_5208 128
54 3300042617 Ga0466718_040277 Ga0466718_040277_991_1395 128
55 3300000089 AustNasuHG_c1023538 AustNasuHG_10235383 129
56 3300002449 JGI24698J34947_10134641 JGI24698J34947_101346411 129
57 3300005201 Ga0072941_1000644 Ga0072941_10006443 129
58 3300042602 Ga0466713_035195 Ga0466713_035195_332_754 131
59 3300042597 Ga0466699_128530 Ga0466699_128530_729_1127 132
60 3300042607 Ga0466720_173499 Ga0466720_173499_8173_8574 133
61 3300010049 Ga0123356_12320741 Ga0123356_123207412 134
62 3300010167 Ga0123353_10125324 Ga0123353_101253244 134
63 3300038395 Ga0415639_152104 Ga0415639_152104_1034_1438 134
64 3300042592 Ga0466693_047917 Ga0466693_047917_18262_18666 134
65 3300042592 Ga0466693_321681 Ga0466693_321681_2280_2684 134
66 3300042594 Ga0466694_063835 Ga0466694_063835_23070_23474 134
67 3300042595 Ga0466695_242276 Ga0466695_242276_424_828 134
68 3300042597 Ga0466699_229142 Ga0466699_229142_371_775 134
69 3300042597 Ga0466699_264362 Ga0466699_264362_697_1101 134
70 3300042608 Ga0466721_213888 Ga0466721_213888_771_1175 134
71 3300042609 Ga0466722_250381 Ga0466722_250381_9066_9470 134
72 3300042610 Ga0466698_486454 Ga0466698_486454_1389_1793 134
73 3300042614 Ga0466712_123162 Ga0466712_123162_13207_13611 134
74 3300042614 Ga0466712_125699 Ga0466712_125699_17389_17793 134
75 3300042614 Ga0466712_227420 Ga0466712_227420_3674_4078 134
76 3300042614 Ga0466712_288984 Ga0466712_288984_2784_3188 134
77 3300042616 Ga0466715_210163 Ga0466715_210163_31082_31486 134
78 3300042622 Ga0466731_055101 Ga0466731_055101_559_963 134
79 3300042622 Ga0466731_159129 Ga0466731_159129_959_1363 134
80 3300042622 Ga0466731_424366 Ga0466731_424366_678_1082 134
81 3300042635 Ga0466702_046770 Ga0466702_046770_94_498 134
82 3300042635 Ga0466702_376079 Ga0466702_376079_322_726 134
83 3300042655 Ga0466727_296461 Ga0466727_296461_318_722 134
84 iso_pr_bacteria 2781125643 2781294518 134
85 iso_pr_bacteria 2781125645 2781299787 134
86 iso_pr_bacteria 2781125659 2781329397 134
87 iso_pr_bacteria 2781125661 2781332502 134
88 iso_pr_bacteria 2781125662 2781336568 134
89 iso_pr_bacteria 2781125692 2781430949 134
90 3300002449 JGI24698J34947_10000172 JGI24698J34947_1000017213 135
91 3300002449 JGI24698J34947_10015933 JGI24698J34947_100159337 135
92 3300002449 JGI24698J34947_10017383 JGI24698J34947_100173834 135
93 3300002449 JGI24698J34947_10297017 JGI24698J34947_102970171 135
94 3300002450 JGI24695J34938_10017731 JGI24695J34938_100177315 135
95 3300002450 JGI24695J34938_10054824 JGI24695J34938_100548242 135
96 3300005201 Ga0072941_1005365 Ga0072941_10053655 135
97 3300005201 Ga0072941_1024210 Ga0072941_10242105 135
98 3300010049 Ga0123356_10008792 Ga0123356_100087923 135
99 3300010049 Ga0123356_10020094 Ga0123356_100200945 135
100 3300010049 Ga0123356_10088054 Ga0123356_100880542 135
101 3300010049 Ga0123356_10155860 Ga0123356_101558602 135
102 3300010049 Ga0123356_10165157 Ga0123356_101651574 135
103 3300010049 Ga0123356_10525263 Ga0123356_105252632 135
104 3300010049 Ga0123356_10553062 Ga0123356_105530622 135
105 3300010049 Ga0123356_10580464 Ga0123356_105804642 135
106 3300010049 Ga0123356_12195884 Ga0123356_121958842 135
107 3300010049 Ga0123356_13234480 Ga0123356_132344802 135
108 3300010167 Ga0123353_12238723 Ga0123353_122387232 135
109 3300042597 Ga0466699_059261 Ga0466699_059261_6710_7117 135
110 3300042624 Ga0466735_180186 Ga0466735_180186_119_526 135
111 3300042624 Ga0466735_188230 Ga0466735_188230_436_843 135
112 iso_pr_bacteria 2781125685 2781417377 135
113 3300002450 JGI24695J34938_10011813 JGI24695J34938_100118135 136
114 3300042582 Ga0466657_272323 Ga0466657_272323_698_1108 136
115 3300042582 Ga0466657_000396 Ga0466657_000396_232_651 139
116 iso_pr_bacteria 2781125648 2781305016 144

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF02472 ExbD Biopolymer transport protein ExbD/TolR 12 130 0.95

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.54 0.79 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.