Protein Family IF11766

Metagenome Isolate
167 Members
48 Samples
147 Scaffolds
271.19 Avg Length

🧬 Representative Sequence

ID
iso_pr_bacteria|2781125644|2781296962|
Length
311 aa
Sequence
MVPAKGREGFMKIKLPELFSAKTHRRKGIKKDGILIKKRKLLDALLYGVMAFAMSGVILSLLFVLIYIFRSQAGFLNWKFLTDAHTGILPMIVTTLYVVLVSIAAAIPAGLAAAIFLNEYSGNSSFIRILRLAIETLAGIPSIIYGLFGLLLFCRLLNFGQSIIAGSLTLSIMILPVIIRTTEESLKSIPDSFREGSLALGATKFQTIAHVVLPSALPGILTSVILAIGRVIGESAPVLLTVGLAKNMPRSIFESGRTLTIHLFYLTNEAVRPEDFGIAFATASVLVILVVIINTAAKIITANFRKKLGDI

📊 Sample Types

Isolate 12.0%
Metagenome 88.0%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 43.5%
Termitidae 43.5%
Kalotermitidae 10.9%
Rhinotermitidae 2.2%

🌳 Taxonomy

Archaea 0
Bacteria 147
Eukaryota 0
Viruses 0
Unclassified 20

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125637 Treponema sp. Co191P1bin9 Isolate Unclassified
2 2781125641 Treponema sp. Co191P1bin27 Isolate Unclassified
3 2781125642 Treponema sp. Co191P1bin35 Isolate Unclassified
4 2781125647 Treponema sp. Co191P3bin16 Isolate Unclassified
5 2781125634 Treponema sp. Co191P1bin45 Isolate Unclassified
6 2781125658 Treponema sp. Emb289P3bin37 Isolate Unclassified
7 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
8 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
9 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
10 2781125643 Treponema sp. Co191P3bin45 Isolate Unclassified
11 2781125648 Treponema sp. Co191P3bin70 Isolate Unclassified
12 2781125650 Treponema sp. Co191P3bin64 Isolate Unclassified
13 2781125664 Treponema sp. Emb289P3bin139 Isolate Unclassified
14 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
15 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
16 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
17 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
18 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
19 2781125657 Treponema sp. Emb289P3bin15 Isolate Unclassified
20 2781125693 Treponema sp. Th196P3bin148 Isolate Unclassified
21 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
22 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
23 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
24 2819992462 Unclassified Spirochaetes Nc150P4bin14 Isolate Unclassified
25 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
26 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
27 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
28 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
29 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
30 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
31 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
32 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
33 2781125644 Treponema sp. Co191P3bin12 Isolate Unclassified
34 2781125645 Treponema sp. Co191P3bin32 Isolate Unclassified
35 2781125665 Treponema sp. Emb289P3bin117 Isolate Unclassified
36 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
37 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
38 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
39 2781125635 Treponema sp. Co191P1bin60 Isolate Unclassified
40 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
41 2781125638 Treponema sp. Co191P1bin8 Isolate Unclassified
42 2781125649 Treponema sp. Co191P3bin15 Isolate Unclassified
43 2781125661 Treponema sp. Emb289P3bin69 Isolate Unclassified
44 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
45 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
46 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
47 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
48 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466712_000555 3300042614 Unclassified 6675
2 Ga0466712_009546 3300042614 Bacteria 12932
3 Ga0466718_017520 3300042617 Bacteria 1446
4 Ga0466718_120716 3300042617 Bacteria 5164
5 Ga0123356_10002033 3300010049 Bacteria 21839
6 Ga0123356_10058742 3300010049 Unclassified 3587
7 Ga0123356_10203435 3300010049 Bacteria 2022
8 Ga0123356_10334491 3300010049 Bacteria 1632
9 Ga0123356_10686830 3300010049 Bacteria 1192
10 Ga0466693_028114 3300042592 Bacteria 110002
11 Ga0466699_240040 3300042597 Bacteria 1329
12 Ga0466699_367916 3300042597 Bacteria 2334
13 JGI24698J34947_10007146 3300002449 Bacteria 6135
14 JGI24698J34947_10045949 3300002449 Bacteria 2224
15 JGI24698J34947_10063707 3300002449 Bacteria 1805
16 JGI24695J34938_10003973 3300002450 Bacteria 9969
17 JGI24695J34938_10005716 3300002450 Bacteria 7674
18 JGI24695J34938_10006250 3300002450 Bacteria 7223
19 JGI24695J34938_10039296 3300002450 Bacteria 2139
20 JGI24695J34938_10069664 3300002450 Bacteria 1474
21 Ga0466712_080324 3300042614 Bacteria 1818
22 Ga0466718_033184 3300042617 Bacteria 15825
23 Ga0466723_077145 3300042618 Bacteria 54484
24 Ga0123355_10315669 3300009826 Bacteria 2112
25 Ga0123356_10150554 3300010049 Bacteria 2309
26 Ga0123356_10409842 3300010049 Bacteria 1495
27 Ga0466722_086766 3300042609 Bacteria 2001
28 Ga0264413_112819 3300024493 Unclassified 2382
29 Ga0264413_117454 3300024493 Bacteria 4047
30 Ga0415639_016653 3300038395 Bacteria 5116
31 Ga0466694_024253 3300042594 Bacteria 20540
32 AustNasuHG_c1013232 3300000089 Unclassified 2833
33 AustNasuHG_c1028060 3300000089 Unclassified 1694
34 JGI24698J34947_10020555 3300002449 Unclassified 3554
35 JGI24698J34947_10020757 3300002449 Bacteria 3537
36 JGI24698J34947_10055304 3300002449 Unclassified 1978
37 JGI24695J34938_10000089 3300002450 Bacteria 79818
38 JGI24695J34938_10000272 3300002450 Bacteria 50568
39 JGI24695J34938_10003138 3300002450 Bacteria 11769
40 Ga0072941_1002429 3300005201 Bacteria 39736
41 Ga0072941_1018360 3300005201 Bacteria 13367
42 Ga0466718_096894 3300042617 Unclassified 2559
43 Ga0466723_243688 3300042618 Bacteria 83097
44 Ga0123355_10894141 3300009826 Bacteria 966
45 Ga0123356_10005713 3300010049 Bacteria 12635
46 Ga0123356_10008085 3300010049 Bacteria 10473
47 Ga0123356_10097280 3300010049 Bacteria 2816
48 Ga0466702_123252 3300042635 Bacteria 9310
49 Ga0466702_123296 3300042635 Bacteria 1347
50 Ga0466717_287794 3300042604 Bacteria 2169
51 Ga0466720_017016 3300042607 Unclassified 8594
52 Ga0264413_115370 3300024493 Bacteria 7040
53 Ga0415639_016678 3300038395 Bacteria 1979
54 Ga0466694_005840 3300042594 Bacteria 106514
55 Ga0466694_156129 3300042594 Bacteria 74614
56 Ga0466699_228025 3300042597 Bacteria 6350
57 JGI24698J34947_10055832 3300002449 Bacteria 1966
58 JGI24695J34938_10004974 3300002450 Bacteria 8482
59 JGI24695J34938_10011385 3300002450 Bacteria 4794
60 JGI24695J34938_10055654 3300002450 Bacteria 1709
61 JGI24695J34938_10057203 3300002450 Bacteria 1677
62 JGI24695J34938_10076748 3300002450 Bacteria 1387
63 Ga0466712_015925 3300042614 Bacteria 11922
64 Ga0466712_030703 3300042614 Bacteria 18975
65 Ga0466712_121516 3300042614 Bacteria 3369
66 Ga0466712_183286 3300042614 Bacteria 15136
67 Ga0466718_037580 3300042617 Bacteria 5402
68 Ga0466731_164817 3300042622 Bacteria 2019
69 Ga0466704_233633 3300042643 Bacteria 14067
70 Ga0466720_052911 3300042607 Bacteria 5009
71 Ga0466720_080343 3300042607 Bacteria 15819
72 Ga0466720_115567 3300042607 Bacteria 8267
73 Ga0264413_102956 3300024493 Bacteria 4454
74 Ga0415639_005305 3300038395 Bacteria 16909
75 Ga0466690_070451 3300042590 Bacteria 8081
76 JGI24695J34938_10004375 3300002450 Bacteria 9306
77 JGI24695J34938_10024576 3300002450 Bacteria 2892
78 Ga0466732_303487 3300042656 Bacteria 11255
79 Ga0466712_319512 3300042614 Bacteria 9452
80 Ga0466718_052515 3300042617 Bacteria 9284
81 Ga0123356_10000349 3300010049 Bacteria 53319
82 Ga0466702_414369 3300042635 Bacteria 5752
83 Ga0466694_084177 3300042594 Bacteria 1362
84 Ga0466699_213584 3300042597 Unclassified 1336
85 AustNasuHG_c1000303 3300000089 Bacteria 17120
86 AustNasuHG_c1002050 3300000089 Bacteria 7271
87 JGI24695J34938_10000368 3300002450 Bacteria 44588
88 JGI24695J34938_10001867 3300002450 Bacteria 17119
89 JGI24695J34938_10004340 3300002450 Bacteria 9341
90 JGI24695J34938_10041781 3300002450 Bacteria 2057
91 Ga0072940_1027797 3300005200 Bacteria 5524
92 Ga0072941_1002428 3300005201 Bacteria 2853
93 Ga0072941_1006603 3300005201 Bacteria 3068
94 Ga0072941_1009285 3300005201 Bacteria 25402
95 Ga0466712_006852 3300042614 Unclassified 1334
96 Ga0466715_072755 3300042616 Bacteria 13115
97 Ga0123353_10291152 3300010167 Bacteria 2500
98 Ga0466719_370453 3300042606 Bacteria 7514
99 Ga0466720_142060 3300042607 Bacteria 3573
100 Ga0466721_162213 3300042608 Bacteria 3519
101 Ga0466722_132267 3300042609 Bacteria 39034
102 Ga0466693_104074 3300042592 Bacteria 2139
103 Ga0466694_069492 3300042594 Bacteria 12714
104 Ga0466694_089443 3300042594 Bacteria 8323
105 AustNasuHG_c1002869 3300000089 Bacteria 6225
106 AustNasuHG_c1002957 3300000089 Bacteria 6121
107 AustNasuHG_c1022164 3300000089 Unclassified 2045
108 JGI24698J34947_10040976 3300002449 Unclassified 2388
109 JGI24695J34938_10001279 3300002450 Bacteria 22067
110 JGI24695J34938_10004337 3300002450 Bacteria 9345
111 JGI24695J34938_10010487 3300002450 Bacteria 5066
112 Ga0072941_1006601 3300005201 Bacteria 4621
113 Ga0466712_298591 3300042614 Bacteria 10678
114 Ga0466718_045669 3300042617 Bacteria 6335
115 Ga0466718_057716 3300042617 Bacteria 8922
116 Ga0466718_137107 3300042617 Unclassified 1912
117 Ga0466718_142257 3300042617 Bacteria 1234
118 Ga0123356_10033779 3300010049 Bacteria 4784
119 Ga0123356_10040637 3300010049 Bacteria 4333
120 Ga0466720_027749 3300042607 Bacteria 6026
121 Ga0466720_096417 3300042607 Unclassified 1074
122 Ga0466720_160428 3300042607 Unclassified 1144
123 Ga0264413_101415 3300024493 Bacteria 18677
124 Ga0466694_326988 3300042594 Bacteria 2042
125 AustNasuHG_c1006968 3300000089 Bacteria 4028
126 JGI24698J34947_10027941 3300002449 Bacteria 2991
127 JGI24698J34947_10036932 3300002449 Unclassified 2541
128 JGI24695J34938_10000035 3300002450 Bacteria 102136
129 JGI24695J34938_10002750 3300002450 Bacteria 12940
130 JGI24695J34938_10012382 3300002450 Bacteria 4522
131 JGI24695J34938_10023809 3300002450 Bacteria 2947
132 JGI24695J34938_10034589 3300002450 Bacteria 2318
133 JGI24702J35022_10017526 3300002462 Bacteria 3912
134 Ga0072941_1002394 3300005201 Bacteria 13768
135 Ga0466712_108456 3300042614 Unclassified 1451
136 Ga0123356_10002571 3300010049 Bacteria 19353
137 Ga0123353_10382865 3300010167 Bacteria 2103
138 Ga0466702_051437 3300042635 Bacteria 3231
139 Ga0466702_218285 3300042635 Bacteria 19292
140 Ga0466720_122506 3300042607 Bacteria 2936
141 Ga0466720_129874 3300042607 Bacteria 9649
142 Ga0466693_238451 3300042592 Bacteria 2288
143 Ga0466699_268122 3300042597 Bacteria 3584
144 AustNasuHG_c1047673 3300000089 Unclassified 952
145 JGI24698J34947_10029092 3300002449 Unclassified 2921
146 JGI24695J34938_10000098 3300002450 Bacteria 76790
147 JGI24695J34938_10000369 3300002450 Bacteria 44536

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300002450 JGI24695J34938_10006250 JGI24695J34938_100062508 223
2 iso_pr_bacteria 2781125643 2781293760 240
3 3300002449 JGI24698J34947_10029092 JGI24698J34947_100290922 249
4 3300002449 JGI24698J34947_10036932 JGI24698J34947_100369322 249
5 3300002450 JGI24695J34938_10003138 JGI24695J34938_100031388 249
6 3300042607 Ga0466720_052911 Ga0466720_052911_2082_2954 249
7 3300042635 Ga0466702_123296 Ga0466702_123296_231_1034 249
8 3300002449 JGI24698J34947_10040976 JGI24698J34947_100409762 250
9 3300005201 Ga0072941_1002429 Ga0072941_100242931 250
10 3300009826 Ga0123355_10894141 Ga0123355_108941412 250
11 3300042656 Ga0466732_303487 Ga0466732_303487_5620_6492 250
12 3300002450 JGI24695J34938_10011385 JGI24695J34938_100113854 251
13 3300042604 Ga0466717_287794 Ga0466717_287794_952_1803 251
14 3300042607 Ga0466720_027749 Ga0466720_027749_2056_2928 251
15 3300000089 AustNasuHG_c1002869 AustNasuHG_10028695 252
16 3300005201 Ga0072941_1002394 Ga0072941_10023943 252
17 3300005201 Ga0072941_1018360 Ga0072941_101836012 252
18 3300042607 Ga0466720_080343 Ga0466720_080343_2446_3288 253
19 3300005200 Ga0072940_1027797 Ga0072940_10277975 254
20 3300042614 Ga0466712_009546 Ga0466712_009546_5249_6049 254
21 3300042594 Ga0466694_156129 Ga0466694_156129_42499_43350 255
22 3300042617 Ga0466718_142257 Ga0466718_142257_337_1188 255
23 3300002462 JGI24702J35022_10017526 JGI24702J35022_100175262 256
24 3300042607 Ga0466720_122506 Ga0466720_122506_2027_2869 256
25 3300010167 Ga0123353_10382865 Ga0123353_103828652 257
26 3300042607 Ga0466720_096417 Ga0466720_096417_165_1007 257
27 3300042617 Ga0466718_120716 Ga0466718_120716_18_860 257
28 3300005201 Ga0072941_1006603 Ga0072941_10066033 258
29 3300042594 Ga0466694_326988 Ga0466694_326988_1027_1908 258
30 3300042617 Ga0466718_037580 Ga0466718_037580_4106_4978 258
31 3300042607 Ga0466720_017016 Ga0466720_017016_35_907 259
32 3300042614 Ga0466712_015925 Ga0466712_015925_5106_5948 259
33 3300042635 Ga0466702_218285 Ga0466702_218285_8582_9436 259
34 3300005201 Ga0072941_1002428 Ga0072941_10024281 260
35 3300010167 Ga0123353_10291152 Ga0123353_102911521 260
36 3300042590 Ga0466690_070451 Ga0466690_070451_3867_4721 260
37 3300042609 Ga0466722_132267 Ga0466722_132267_13033_13869 260
38 3300042614 Ga0466712_183286 Ga0466712_183286_1795_2703 260
39 3300042616 Ga0466715_072755 Ga0466715_072755_6569_7423 260
40 3300042617 Ga0466718_052515 Ga0466718_052515_7033_7905 260
41 3300042617 Ga0466718_137107 Ga0466718_137107_15_857 260
42 3300042618 Ga0466723_077145 Ga0466723_077145_39734_40588 260
43 3300042622 Ga0466731_164817 Ga0466731_164817_485_1327 260
44 3300002449 JGI24698J34947_10045949 JGI24698J34947_100459493 261
45 3300042607 Ga0466720_142060 Ga0466720_142060_1802_2644 261
46 3300042614 Ga0466712_030703 Ga0466712_030703_12760_13563 261
47 3300042618 Ga0466723_243688 Ga0466723_243688_33984_34826 261
48 3300042614 Ga0466712_000555 Ga0466712_000555_814_1656 262
49 3300042614 Ga0466712_006852 Ga0466712_006852_115_957 262
50 3300042635 Ga0466702_051437 Ga0466702_051437_703_1551 262
51 3300002449 JGI24698J34947_10055304 JGI24698J34947_100553042 263
52 3300002449 JGI24698J34947_10063707 JGI24698J34947_100637072 263
53 3300002450 JGI24695J34938_10034589 JGI24695J34938_100345892 263
54 3300042614 Ga0466712_319512 Ga0466712_319512_4791_5636 263
55 3300002450 JGI24695J34938_10023809 JGI24695J34938_100238092 264
56 3300002450 JGI24695J34938_10055654 JGI24695J34938_100556542 264
57 3300002450 JGI24695J34938_10069664 JGI24695J34938_100696642 264
58 3300002450 JGI24695J34938_10000098 JGI24695J34938_1000009847 265
59 3300024493 Ga0264413_102956 Ga0264413_1029565 265
60 3300042607 Ga0466720_129874 Ga0466720_129874_2395_3267 265
61 3300042609 Ga0466722_086766 Ga0466722_086766_93_944 265
62 3300042617 Ga0466718_096894 Ga0466718_096894_163_1035 265
63 3300002450 JGI24695J34938_10000089 JGI24695J34938_1000008917 266
64 3300002450 JGI24695J34938_10000369 JGI24695J34938_1000036917 266
65 3300042607 Ga0466720_160428 Ga0466720_160428_105_977 266
66 3300042594 Ga0466694_069492 Ga0466694_069492_4979_5845 267
67 3300042614 Ga0466712_108456 Ga0466712_108456_568_1407 267
68 3300002449 JGI24698J34947_10007146 JGI24698J34947_100071466 268
69 3300002449 JGI24698J34947_10020757 JGI24698J34947_100207574 268
70 3300005201 Ga0072941_1006601 Ga0072941_10066013 268
71 3300002449 JGI24698J34947_10020555 JGI24698J34947_100205553 269
72 3300002450 JGI24695J34938_10004375 JGI24695J34938_100043759 269
73 3300000089 AustNasuHG_c1002050 AustNasuHG_10020502 270
74 3300000089 AustNasuHG_c1006968 AustNasuHG_10069683 270
75 3300010049 Ga0123356_10002571 Ga0123356_100025718 270
76 3300024493 Ga0264413_115370 Ga0264413_1153702 270
77 3300042607 Ga0466720_115567 Ga0466720_115567_2322_3194 270
78 3300042614 Ga0466712_121516 Ga0466712_121516_240_1082 271
79 3300000089 AustNasuHG_c1000303 AustNasuHG_100030315 272
80 3300000089 AustNasuHG_c1002957 AustNasuHG_10029572 272
81 3300002449 JGI24698J34947_10055832 JGI24698J34947_100558322 272
82 3300002450 JGI24695J34938_10004974 JGI24695J34938_100049743 272
83 3300002450 JGI24695J34938_10024576 JGI24695J34938_100245763 272
84 3300002450 JGI24695J34938_10057203 JGI24695J34938_100572032 272
85 iso_pr_bacteria 2781125641 2781290841 272
86 3300000089 AustNasuHG_c1013232 AustNasuHG_10132323 273
87 3300000089 AustNasuHG_c1047673 AustNasuHG_10476731 273
88 3300002450 JGI24695J34938_10001279 JGI24695J34938_100012799 273
89 3300042594 Ga0466694_005840 Ga0466694_005840_38319_39227 273
90 3300042617 Ga0466718_045669 Ga0466718_045669_3955_4827 273
91 3300042643 Ga0466704_233633 Ga0466704_233633_7850_8692 273
92 3300000089 AustNasuHG_c1028060 AustNasuHG_10280601 274
93 3300002449 JGI24698J34947_10027941 JGI24698J34947_100279412 274
94 3300042594 Ga0466694_084177 Ga0466694_084177_197_1057 274
95 3300042617 Ga0466718_057716 Ga0466718_057716_6485_7327 274
96 3300042592 Ga0466693_104074 Ga0466693_104074_937_1812 275
97 3300042597 Ga0466699_228025 Ga0466699_228025_5255_6100 275
98 3300042635 Ga0466702_123252 Ga0466702_123252_7222_8130 275
99 iso_pr_bacteria 2781125658 2781325699 275
100 3300002450 JGI24695J34938_10010487 JGI24695J34938_100104872 276
101 3300002450 JGI24695J34938_10012382 JGI24695J34938_100123823 276
102 3300024493 Ga0264413_112819 Ga0264413_1128192 276
103 3300042614 Ga0466712_080324 Ga0466712_080324_309_1166 276
104 3300038395 Ga0415639_005305 Ga0415639_005305_15642_16499 277
105 3300042614 Ga0466712_298591 Ga0466712_298591_284_1174 277
106 iso_pr_bacteria 2781125638 2781283339 277
107 3300042594 Ga0466694_089443 Ga0466694_089443_5841_6713 278
108 iso_pr_bacteria 2781125634 2781274203 278
109 3300002450 JGI24695J34938_10004340 JGI24695J34938_100043406 279
110 3300002450 JGI24695J34938_10041781 JGI24695J34938_100417812 279
111 3300002450 JGI24695J34938_10076748 JGI24695J34938_100767482 279
112 3300010049 Ga0123356_10002033 Ga0123356_1000203310 279
113 3300010049 Ga0123356_10686830 Ga0123356_106868302 279
114 3300038395 Ga0415639_016653 Ga0415639_016653_1616_2536 279
115 3300042606 Ga0466719_370453 Ga0466719_370453_2572_3411 279
116 3300002450 JGI24695J34938_10000272 JGI24695J34938_1000027238 280
117 3300002450 JGI24695J34938_10003973 JGI24695J34938_100039733 280
118 3300010049 Ga0123356_10040637 Ga0123356_100406374 280
119 3300010049 Ga0123356_10334491 Ga0123356_103344912 280
120 3300024493 Ga0264413_101415 Ga0264413_1014158 280
121 3300024493 Ga0264413_117454 Ga0264413_1174544 280
122 iso_pr_bacteria 2781125637 2781282043 280
123 iso_pr_bacteria 2781125649 2781307058 280
124 iso_pr_bacteria 2781125650 2781309009 280
125 iso_pr_bacteria 2781125661 2781333272 280
126 iso_pr_bacteria 2781125693 2781434234 280
127 iso_pr_bacteria 2819992462 2819993901 280
128 3300000089 AustNasuHG_c1022164 AustNasuHG_10221642 281
129 3300002450 JGI24695J34938_10004337 JGI24695J34938_100043372 281
130 3300005201 Ga0072941_1009285 Ga0072941_100928518 281
131 3300010049 Ga0123356_10005713 Ga0123356_100057139 281
132 3300010049 Ga0123356_10058742 Ga0123356_100587423 281
133 3300042635 Ga0466702_414369 Ga0466702_414369_4383_5300 281
134 3300042617 Ga0466718_033184 Ga0466718_033184_5291_6163 282
135 iso_pr_bacteria 2781125647 2781302605 282
136 3300010049 Ga0123356_10150554 Ga0123356_101505542 283
137 3300042597 Ga0466699_213584 Ga0466699_213584_81_956 283
138 3300042597 Ga0466699_268122 Ga0466699_268122_1245_2120 283
139 3300042608 Ga0466721_162213 Ga0466721_162213_1009_1878 283
140 iso_pr_bacteria 2781125642 2781292903 283
141 3300002450 JGI24695J34938_10000368 JGI24695J34938_1000036822 284
142 3300002450 JGI24695J34938_10039296 JGI24695J34938_100392962 284
143 3300010049 Ga0123356_10097280 Ga0123356_100972802 284
144 3300038395 Ga0415639_016678 Ga0415639_016678_497_1351 284
145 3300042597 Ga0466699_367916 Ga0466699_367916_702_1577 285
146 iso_pr_bacteria 2781125648 2781304908 285
147 3300002450 JGI24695J34938_10005716 JGI24695J34938_100057165 286
148 3300010049 Ga0123356_10008085 Ga0123356_100080855 287
149 3300010049 Ga0123356_10409842 Ga0123356_104098422 287
150 3300042592 Ga0466693_238451 Ga0466693_238451_340_1260 287
151 3300002450 JGI24695J34938_10002750 JGI24695J34938_100027509 288
152 3300042592 Ga0466693_028114 Ga0466693_028114_57779_58663 288
153 iso_pr_bacteria 2781125635 2781276957 288
154 iso_pr_bacteria 2781125645 2781297691 288
155 3300002450 JGI24695J34938_10000035 JGI24695J34938_100000356 289
156 3300009826 Ga0123355_10315669 Ga0123355_103156693 289
157 3300042594 Ga0466694_024253 Ga0466694_024253_10140_11012 290
158 3300042617 Ga0466718_017520 Ga0466718_017520_456_1328 290
159 3300042597 Ga0466699_240040 Ga0466699_240040_314_1228 291
160 iso_pr_bacteria 2781125657 2781324159 292
161 3300010049 Ga0123356_10203435 Ga0123356_102034352 296
162 iso_pr_bacteria 2781125664 2781340100 297
163 3300010049 Ga0123356_10033779 Ga0123356_100337793 298
164 3300002450 JGI24695J34938_10001867 JGI24695J34938_1000186715 302
165 iso_pr_bacteria 2781125665 2781341497 307
166 3300010049 Ga0123356_10000349 Ga0123356_1000034936 308
167 iso_pr_bacteria 2781125644 2781296962 311

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00528 BPD_transp_1 Binding-protein-dependent transport system inner membrane component 107 304 0.86

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.73 0.83 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.