Protein Family IF11764
Metagenome
Isolate
115
Members
41
Samples
108
Scaffolds
384.03
Avg Length
Representative Sequence
- ID
- iso_pr_bacteria|2781125643|2781293485|
- Length
- 414 aa
- Sequence
- MEQLKHDGKKKPSARSDQDKQKRVYFDWAASSPDNTYNSFSFLDKEIFRTGFANPSSSMHLEGRSAKKILEESRERCAAVLKVPPETLYFTSGGTESNSIALLSNLTRPGKGRIISSQAEHASVRDAMLTLEKMGKPTGNIPVDSSGKVTPASLSKTLEKYGDVRFISVMSVNNETGVVTDIASLSNEIKKYREYSADSASSLKNPVHFHCDMVQAAGKIKIDIDGWDIDSASISAHKIQGPRGIGLLYAKKPLNVFYSGGGQENGVRGGTENVYGAFALADCLEKYASSAETEYQNAKTRIKKLITSLCAMKRCVLIPKSRLADDDNFSPYILQAAFKDIPGEVMARALDDLGFAVSTGSACSSSSPERPVLIAMGVEENLRIEGIRISQGHTTTDKDIDLLTGAVNEVLKFL
Sample Types
Isolate
6.1%
Metagenome
93.9%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
53.8%
Kalotermitidae
23.1%
Unclassified
17.9%
Termopsidae
2.6%
Rhinotermitidae
2.6%
Taxonomy
Archaea
2
Bacteria
106
Eukaryota
0
Viruses
0
Unclassified
7
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 2 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 3 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 4 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 5 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 6 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 7 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 8 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 9 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 10 | 2781125643 | Treponema sp. Co191P3bin45 | Isolate | Unclassified |
| 11 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 12 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 13 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 14 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 15 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 16 | 2781125662 | Treponema sp. Emb289P3bin141 | Isolate | Unclassified |
| 17 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 18 | 2781125656 | Treponema sp. Emb289P1bin65 | Isolate | Unclassified |
| 19 | 2781125663 | Treponema sp. Emb289P3bin135 | Isolate | Unclassified |
| 20 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 21 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 22 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 23 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 24 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 25 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 26 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 27 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 28 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 29 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 30 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 31 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 32 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 33 | 3300002507 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 | Metagenome | Termitidae |
| 34 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 35 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 36 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 37 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 38 | 2781125637 | Treponema sp. Co191P1bin9 | Isolate | Unclassified |
| 39 | 2781125646 | Treponema sp. Co191P3bin59 | Isolate | Unclassified |
| 40 | 2781125692 | Treponema sp. Th196P3bin31 | Isolate | Unclassified |
| 41 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0123356_10017101 | 3300010049 | Bacteria | 6903 |
| 2 | Ga0123356_10271110 | 3300010049 | Bacteria | 1787 |
| 3 | Ga0415639_070409 | 3300038395 | Bacteria | 9032 |
| 4 | Ga0466694_027441 | 3300042594 | Bacteria | 4143 |
| 5 | Ga0466712_160235 | 3300042614 | Bacteria | 3843 |
| 6 | Ga0466728_006075 | 3300042620 | Bacteria | 2838 |
| 7 | Ga0466728_139623 | 3300042620 | Bacteria | 4754 |
| 8 | Ga0466731_204697 | 3300042622 | Unclassified | 36475 |
| 9 | Ga0466703_116692 | 3300042636 | Bacteria | 2876 |
| 10 | Ga0466704_446877 | 3300042643 | Unclassified | 5480 |
| 11 | Ga0466704_620223 | 3300042643 | Bacteria | 3527 |
| 12 | Ga0466720_062418 | 3300042607 | Bacteria | 27320 |
| 13 | JGI24698J34947_10001486 | 3300002449 | Bacteria | 12382 |
| 14 | JGI24695J34938_10039980 | 3300002450 | Archaea | 2115 |
| 15 | Ga0072941_1011382 | 3300005201 | Bacteria | 14196 |
| 16 | Ga0123356_10029401 | 3300010049 | Bacteria | 5146 |
| 17 | Ga0264413_115643 | 3300024493 | Bacteria | 8410 |
| 18 | Ga0466690_105837 | 3300042590 | Bacteria | 4443 |
| 19 | Ga0466693_450355 | 3300042592 | Bacteria | 3790 |
| 20 | Ga0466691_027229 | 3300042593 | Bacteria | 11950 |
| 21 | Ga0466712_005921 | 3300042614 | Bacteria | 1413 |
| 22 | Ga0466712_036880 | 3300042614 | Bacteria | 9922 |
| 23 | Ga0466712_041916 | 3300042614 | Bacteria | 16385 |
| 24 | Ga0466718_003255 | 3300042617 | Archaea | 2785 |
| 25 | Ga0466720_109617 | 3300042607 | Bacteria | 5678 |
| 26 | JGI24698J34947_10005049 | 3300002449 | Bacteria | 7232 |
| 27 | Ga0466705_120802 | 3300042612 | Bacteria | 4235 |
| 28 | Ga0415639_015547 | 3300038395 | Bacteria | 22627 |
| 29 | Ga0466699_018113 | 3300042597 | Bacteria | 33087 |
| 30 | Ga0466723_219816 | 3300042618 | Bacteria | 36008 |
| 31 | JGI24698J34947_10004339 | 3300002449 | Bacteria | 7722 |
| 32 | JGI24698J34947_10008053 | 3300002449 | Bacteria | 5785 |
| 33 | Ga0072940_1053141 | 3300005200 | Bacteria | 4015 |
| 34 | Ga0072941_1065288 | 3300005201 | Bacteria | 3301 |
| 35 | Ga0466694_325482 | 3300042594 | Bacteria | 2324 |
| 36 | Ga0466699_101104 | 3300042597 | Bacteria | 3784 |
| 37 | Ga0466712_254560 | 3300042614 | Unclassified | 2835 |
| 38 | Ga0466723_123780 | 3300042618 | Bacteria | 2296 |
| 39 | Ga0466702_463216 | 3300042635 | Bacteria | 1483 |
| 40 | Ga0466727_325429 | 3300042655 | Bacteria | 4165 |
| 41 | Ga0466720_107502 | 3300042607 | Bacteria | 22377 |
| 42 | Ga0074263_108383 | 3300005485 | Bacteria | 4105 |
| 43 | Ga0123355_10127050 | 3300009826 | Bacteria | 3937 |
| 44 | Ga0123356_10000239 | 3300010049 | Bacteria | 63302 |
| 45 | Ga0123356_10051051 | 3300010049 | Bacteria | 3847 |
| 46 | Ga0264413_107507 | 3300024493 | Bacteria | 5249 |
| 47 | Ga0466694_109729 | 3300042594 | Bacteria | 11224 |
| 48 | Ga0466699_258762 | 3300042597 | Bacteria | 52150 |
| 49 | Ga0466699_289173 | 3300042597 | Unclassified | 6963 |
| 50 | Ga0466712_073702 | 3300042614 | Bacteria | 60864 |
| 51 | Ga0466712_118083 | 3300042614 | Bacteria | 55745 |
| 52 | Ga0466718_039098 | 3300042617 | Bacteria | 4982 |
| 53 | Ga0466708_400826 | 3300042652 | Bacteria | 19843 |
| 54 | Ga0466722_006553 | 3300042609 | Bacteria | 3499 |
| 55 | Ga0466722_055492 | 3300042609 | Bacteria | 15765 |
| 56 | Ga0466698_284999 | 3300042610 | Bacteria | 1728 |
| 57 | JGI24698J34947_10000867 | 3300002449 | Bacteria | 15257 |
| 58 | JGI24698J34947_10004588 | 3300002449 | Bacteria | 7529 |
| 59 | JGI24698J34947_10017237 | 3300002449 | Bacteria | 3917 |
| 60 | JGI24698J34947_10097167 | 3300002449 | Bacteria | 1334 |
| 61 | JGI24697J35500_11273503 | 3300002507 | Bacteria | 5707 |
| 62 | Ga0074263_114274 | 3300005485 | Bacteria | 1810 |
| 63 | Ga0123356_10179359 | 3300010049 | Bacteria | 2138 |
| 64 | Ga0466694_192118 | 3300042594 | Unclassified | 9990 |
| 65 | Ga0466699_020088 | 3300042597 | Bacteria | 7667 |
| 66 | Ga0466699_126357 | 3300042597 | Bacteria | 3464 |
| 67 | Ga0466712_019313 | 3300042614 | Bacteria | 3430 |
| 68 | Ga0466712_226564 | 3300042614 | Bacteria | 10213 |
| 69 | Ga0466718_076149 | 3300042617 | Bacteria | 15780 |
| 70 | Ga0466702_305208 | 3300042635 | Bacteria | 1927 |
| 71 | Ga0466704_498447 | 3300042643 | Bacteria | 1940 |
| 72 | Ga0466720_081062 | 3300042607 | Bacteria | 39537 |
| 73 | Ga0466722_085739 | 3300042609 | Bacteria | 4699 |
| 74 | JGI24698J34947_10075945 | 3300002449 | Bacteria | 1595 |
| 75 | JGI24695J34938_10000301 | 3300002450 | Bacteria | 48723 |
| 76 | JGI24695J34938_10000319 | 3300002450 | Bacteria | 47237 |
| 77 | Ga0072941_1010736 | 3300005201 | Bacteria | 42532 |
| 78 | Ga0466705_160199 | 3300042612 | Bacteria | 1997 |
| 79 | Ga0123356_10154766 | 3300010049 | Bacteria | 2281 |
| 80 | Ga0264413_124950 | 3300024493 | Bacteria | 4008 |
| 81 | Ga0466694_040166 | 3300042594 | Bacteria | 11040 |
| 82 | Ga0466694_107812 | 3300042594 | Bacteria | 14039 |
| 83 | Ga0466712_045629 | 3300042614 | Bacteria | 41120 |
| 84 | Ga0466728_075686 | 3300042620 | Bacteria | 7337 |
| 85 | Ga0466702_350760 | 3300042635 | Bacteria | 11855 |
| 86 | AustNasuHG_c1036012 | 3300000089 | Unclassified | 1292 |
| 87 | JGI24695J34938_10000016 | 3300002450 | Bacteria | 116336 |
| 88 | JGI24695J34938_10004202 | 3300002450 | Bacteria | 9575 |
| 89 | Ga0072940_1000509 | 3300005200 | Bacteria | 4198 |
| 90 | Ga0466732_409124 | 3300042656 | Bacteria | 27790 |
| 91 | Ga0123356_10001635 | 3300010049 | Bacteria | 24595 |
| 92 | Ga0123356_10199246 | 3300010049 | Bacteria | 2040 |
| 93 | Ga0123353_10033009 | 3300010167 | Bacteria | 8049 |
| 94 | Ga0264413_100925 | 3300024493 | Bacteria | 14246 |
| 95 | Ga0466690_270749 | 3300042590 | Bacteria | 3865 |
| 96 | Ga0466691_219039 | 3300042593 | Bacteria | 5841 |
| 97 | Ga0466699_305732 | 3300042597 | Bacteria | 1782 |
| 98 | Ga0466712_091980 | 3300042614 | Bacteria | 13610 |
| 99 | Ga0466723_210196 | 3300042618 | Bacteria | 26496 |
| 100 | Ga0466731_125925 | 3300042622 | Bacteria | 2494 |
| 101 | Ga0466702_126037 | 3300042635 | Bacteria | 1499 |
| 102 | Ga0466702_170759 | 3300042635 | Bacteria | 13024 |
| 103 | Ga0466708_291823 | 3300042652 | Unclassified | 2746 |
| 104 | Ga0466719_029315 | 3300042606 | Bacteria | 3328 |
| 105 | JGI24698J34947_10003025 | 3300002449 | Bacteria | 9107 |
| 106 | JGI24698J34947_10006050 | 3300002449 | Bacteria | 6645 |
| 107 | JGI24699J35502_11075036 | 3300002509 | Bacteria | 1894 |
| 108 | Ga0072941_1011381 | 3300005201 | Bacteria | 1820 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042597 | Ga0466699_305732 | Ga0466699_305732_760_1719 | 319 |
| 2 | 3300042618 | Ga0466723_219816 | Ga0466723_219816_23941_24933 | 330 |
| 3 | 3300042593 | Ga0466691_027229 | Ga0466691_027229_4286_5302 | 338 |
| 4 | 3300042618 | Ga0466723_123780 | Ga0466723_123780_15_1031 | 338 |
| 5 | 3300042635 | Ga0466702_126037 | Ga0466702_126037_386_1411 | 341 |
| 6 | 3300042635 | Ga0466702_463216 | Ga0466702_463216_267_1394 | 341 |
| 7 | 3300042620 | Ga0466728_075686 | Ga0466728_075686_2497_3576 | 359 |
| 8 | 3300042620 | Ga0466728_139623 | Ga0466728_139623_3320_4420 | 360 |
| 9 | 3300042590 | Ga0466690_270749 | Ga0466690_270749_993_2078 | 361 |
| 10 | 3300042618 | Ga0466723_210196 | Ga0466723_210196_4560_5648 | 362 |
| 11 | 3300042593 | Ga0466691_219039 | Ga0466691_219039_3903_5000 | 365 |
| 12 | 3300002450 | JGI24695J34938_10000319 | JGI24695J34938_1000031917 | 369 |
| 13 | 3300042609 | Ga0466722_055492 | Ga0466722_055492_13217_14371 | 370 |
| 14 | 3300042617 | Ga0466718_003255 | Ga0466718_003255_1201_2340 | 370 |
| 15 | 3300010049 | Ga0123356_10000239 | Ga0123356_1000023940 | 373 |
| 16 | 3300010049 | Ga0123356_10051051 | Ga0123356_100510512 | 375 |
| 17 | 3300038395 | Ga0415639_015547 | Ga0415639_015547_2805_3935 | 376 |
| 18 | 3300042622 | Ga0466731_125925 | Ga0466731_125925_58_1188 | 376 |
| 19 | iso_pr_bacteria | 2781125637 | 2781281404 | 376 |
| 20 | 3300002450 | JGI24695J34938_10004202 | JGI24695J34938_100042027 | 377 |
| 21 | iso_pr_bacteria | 2781125692 | 2781431760 | 377 |
| 22 | 3300010049 | Ga0123356_10154766 | Ga0123356_101547664 | 379 |
| 23 | 3300010049 | Ga0123356_10271110 | Ga0123356_102711102 | 380 |
| 24 | 3300038395 | Ga0415639_070409 | Ga0415639_070409_6499_7641 | 380 |
| 25 | 3300042622 | Ga0466731_204697 | Ga0466731_204697_10280_11422 | 380 |
| 26 | 3300005201 | Ga0072941_1065288 | Ga0072941_10652883 | 381 |
| 27 | 3300010167 | Ga0123353_10033009 | Ga0123353_100330096 | 381 |
| 28 | 3300042597 | Ga0466699_018113 | Ga0466699_018113_19500_20645 | 381 |
| 29 | 3300042597 | Ga0466699_020088 | Ga0466699_020088_476_1621 | 381 |
| 30 | 3300042597 | Ga0466699_126357 | Ga0466699_126357_1350_2495 | 381 |
| 31 | 3300042609 | Ga0466722_085739 | Ga0466722_085739_1498_2643 | 381 |
| 32 | 3300042635 | Ga0466702_350760 | Ga0466702_350760_9675_10820 | 381 |
| 33 | iso_pr_bacteria | 2781125646 | 2781300243 | 381 |
| 34 | 3300002450 | JGI24695J34938_10000016 | JGI24695J34938_1000001650 | 382 |
| 35 | 3300042597 | Ga0466699_289173 | Ga0466699_289173_4627_5775 | 382 |
| 36 | 3300010049 | Ga0123356_10179359 | Ga0123356_101793592 | 383 |
| 37 | 3300010049 | Ga0123356_10199246 | Ga0123356_101992462 | 383 |
| 38 | 3300024493 | Ga0264413_107507 | Ga0264413_1075076 | 384 |
| 39 | 3300024493 | Ga0264413_124950 | Ga0264413_1249502 | 384 |
| 40 | 3300042597 | Ga0466699_101104 | Ga0466699_101104_547_1701 | 384 |
| 41 | 3300042609 | Ga0466722_006553 | Ga0466722_006553_2329_3483 | 384 |
| 42 | 3300042614 | Ga0466712_073702 | Ga0466712_073702_34751_35905 | 384 |
| 43 | 3300042636 | Ga0466703_116692 | Ga0466703_116692_448_1602 | 384 |
| 44 | 3300002450 | JGI24695J34938_10000301 | JGI24695J34938_1000030117 | 385 |
| 45 | 3300005201 | Ga0072941_1011381 | Ga0072941_10113812 | 385 |
| 46 | 3300005201 | Ga0072941_1011382 | Ga0072941_10113829 | 385 |
| 47 | 3300005485 | Ga0074263_108383 | Ga0074263_1083833 | 385 |
| 48 | 3300005485 | Ga0074263_114274 | Ga0074263_1142742 | 385 |
| 49 | iso_pr_bacteria | 2781125663 | 2781338799 | 385 |
| 50 | 3300010049 | Ga0123356_10029401 | Ga0123356_100294011 | 386 |
| 51 | 3300042590 | Ga0466690_105837 | Ga0466690_105837_2585_3745 | 386 |
| 52 | 3300042597 | Ga0466699_258762 | Ga0466699_258762_22178_23338 | 386 |
| 53 | 3300042606 | Ga0466719_029315 | Ga0466719_029315_700_1860 | 386 |
| 54 | 3300042614 | Ga0466712_041916 | Ga0466712_041916_7430_8590 | 386 |
| 55 | 3300042620 | Ga0466728_006075 | Ga0466728_006075_904_2064 | 386 |
| 56 | 3300042643 | Ga0466704_498447 | Ga0466704_498447_131_1291 | 386 |
| 57 | 3300009826 | Ga0123355_10127050 | Ga0123355_101270502 | 387 |
| 58 | 3300042614 | Ga0466712_160235 | Ga0466712_160235_772_1935 | 387 |
| 59 | 3300042635 | Ga0466702_170759 | Ga0466702_170759_1685_2848 | 387 |
| 60 | 3300042652 | Ga0466708_400826 | Ga0466708_400826_5385_6548 | 387 |
| 61 | 3300042655 | Ga0466727_325429 | Ga0466727_325429_537_1700 | 387 |
| 62 | 3300002449 | JGI24698J34947_10004339 | JGI24698J34947_100043395 | 388 |
| 63 | 3300002449 | JGI24698J34947_10006050 | JGI24698J34947_100060502 | 388 |
| 64 | 3300002449 | JGI24698J34947_10008053 | JGI24698J34947_100080535 | 388 |
| 65 | 3300002449 | JGI24698J34947_10017237 | JGI24698J34947_100172373 | 388 |
| 66 | 3300002449 | JGI24698J34947_10097167 | JGI24698J34947_100971671 | 388 |
| 67 | 3300002507 | JGI24697J35500_11273503 | JGI24697J35500_112735034 | 388 |
| 68 | 3300042614 | Ga0466712_226564 | Ga0466712_226564_8155_9321 | 388 |
| 69 | 3300042614 | Ga0466712_254560 | Ga0466712_254560_710_1876 | 388 |
| 70 | 3300042635 | Ga0466702_305208 | Ga0466702_305208_294_1460 | 388 |
| 71 | 3300042652 | Ga0466708_291823 | Ga0466708_291823_914_2080 | 388 |
| 72 | 3300042656 | Ga0466732_409124 | Ga0466732_409124_16290_17456 | 388 |
| 73 | 3300002449 | JGI24698J34947_10000867 | JGI24698J34947_100008675 | 389 |
| 74 | 3300002449 | JGI24698J34947_10001486 | JGI24698J34947_100014866 | 389 |
| 75 | 3300002449 | JGI24698J34947_10003025 | JGI24698J34947_100030256 | 389 |
| 76 | 3300042612 | Ga0466705_120802 | Ga0466705_120802_350_1519 | 389 |
| 77 | 3300042617 | Ga0466718_076149 | Ga0466718_076149_5284_6453 | 389 |
| 78 | iso_pr_bacteria | 2781125662 | 2781337139 | 389 |
| 79 | 3300005200 | Ga0072940_1000509 | Ga0072940_10005092 | 390 |
| 80 | 3300010049 | Ga0123356_10001635 | Ga0123356_1000163517 | 390 |
| 81 | 3300024493 | Ga0264413_115643 | Ga0264413_1156436 | 390 |
| 82 | 3300042617 | Ga0466718_039098 | Ga0466718_039098_1832_3004 | 390 |
| 83 | 3300002509 | JGI24699J35502_11075036 | JGI24699J35502_110750362 | 391 |
| 84 | 3300042594 | Ga0466694_027441 | Ga0466694_027441_2796_3971 | 391 |
| 85 | 3300042594 | Ga0466694_325482 | Ga0466694_325482_593_1768 | 391 |
| 86 | 3300042607 | Ga0466720_107502 | Ga0466720_107502_6625_7800 | 391 |
| 87 | 3300042610 | Ga0466698_284999 | Ga0466698_284999_57_1232 | 391 |
| 88 | 3300042614 | Ga0466712_091980 | Ga0466712_091980_4286_5461 | 391 |
| 89 | 3300042614 | Ga0466712_118083 | Ga0466712_118083_50246_51421 | 391 |
| 90 | 3300042607 | Ga0466720_062418 | Ga0466720_062418_13963_15141 | 392 |
| 91 | 3300042607 | Ga0466720_081062 | Ga0466720_081062_15371_16549 | 392 |
| 92 | 3300002449 | JGI24698J34947_10004588 | JGI24698J34947_100045884 | 393 |
| 93 | 3300002449 | JGI24698J34947_10005049 | JGI24698J34947_100050496 | 393 |
| 94 | 3300024493 | Ga0264413_100925 | Ga0264413_1009259 | 393 |
| 95 | 3300042612 | Ga0466705_160199 | Ga0466705_160199_574_1779 | 393 |
| 96 | 3300042614 | Ga0466712_045629 | Ga0466712_045629_30843_32024 | 393 |
| 97 | 3300000089 | AustNasuHG_c1036012 | AustNasuHG_10360121 | 394 |
| 98 | 3300005200 | Ga0072940_1053141 | Ga0072940_10531413 | 394 |
| 99 | 3300042614 | Ga0466712_036880 | Ga0466712_036880_4294_5481 | 395 |
| 100 | 3300042592 | Ga0466693_450355 | Ga0466693_450355_1423_2613 | 396 |
| 101 | 3300042643 | Ga0466704_446877 | Ga0466704_446877_3375_4565 | 396 |
| 102 | 3300042643 | Ga0466704_620223 | Ga0466704_620223_509_1702 | 397 |
| 103 | 3300005201 | Ga0072941_1010736 | Ga0072941_101073635 | 399 |
| 104 | iso_pr_bacteria | 2781125656 | 2781321800 | 399 |
| 105 | 3300042594 | Ga0466694_107812 | Ga0466694_107812_5487_6692 | 401 |
| 106 | 3300042594 | Ga0466694_192118 | Ga0466694_192118_54_1259 | 401 |
| 107 | 3300042607 | Ga0466720_109617 | Ga0466720_109617_3154_4359 | 401 |
| 108 | 3300042614 | Ga0466712_005921 | Ga0466712_005921_22_1227 | 401 |
| 109 | 3300042614 | Ga0466712_019313 | Ga0466712_019313_22_1227 | 401 |
| 110 | 3300002449 | JGI24698J34947_10075945 | JGI24698J34947_100759452 | 404 |
| 111 | 3300042594 | Ga0466694_040166 | Ga0466694_040166_54_1268 | 404 |
| 112 | 3300042594 | Ga0466694_109729 | Ga0466694_109729_8309_9526 | 405 |
| 113 | 3300002450 | JGI24695J34938_10039980 | JGI24695J34938_100399802 | 406 |
| 114 | 3300010049 | Ga0123356_10017101 | Ga0123356_100171012 | 407 |
| 115 | iso_pr_bacteria | 2781125643 | 2781293485 | 414 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00266 | Aminotran_5 | Aminotransferase class-V | 25 | 403 | 0.83 |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.87 | 0.9 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.