Protein Family IF11740

Metagenome Isolate
209 Members
60 Samples
191 Scaffolds
633.17 Avg Length

🧬 Representative Sequence

ID
iso_pr_bacteria|2781125632|2781269343|
Length
771 aa
Sequence
MMAGKAKEAAKPKKGILARAEAVKKAETNSKTTTAKAKTVGGKAAGKAKKPAEKTAGTKAAKTEAKPARPKAAAPAKAAAKPAAKARGVKPAAAKKAPAKQPAAKTAAAKAPAVKAPLAKAAAAKTPPTKAAAAKASPAKAAAAAKAPPAKDSPAKKPPVKTLSAKAPAGAKGVYDESKITTLSSLEHIRLRTGMYIGRLGDGSNPDDGIYILLKEVIDNGIDEFIMGNGKLIDIVVKXGTVKVRDFGRGIPLGKLVDCVSVINTGAKYNDDVFQFSVGLNGVGTKAVNALSSHFRVVAIRDGEFAEAVFQRGDLISERKGRLKDKQKNGTFVEFTPDRDIFGDYEFNPEFIEKRIQNYAYLNMGLTLSYNGKPFVSERGLFDLLTEETGDDGLYSVGYYRGTHIECAFTHTNNYGEGYFSFVNGQYTSDGGTHLSAFKEGFLKGIQTYFKKDYRSEDIREGSIAAVAVKLKNPIFESQTKNKLGNSDIRGWIVQEVKEAVEDWLHKNTDAAKKLELKILANESLRTELNQVKKEAREAAKKIALKIPKLKDCKYHLDDGKEGEFSTIFITEGDSASGSMVSSRDVMTQAIFALRGKVENMYGKKRAAIYKNEELYNMMMALGIENDVSGLRYGRIVIATDADFDGFHIRNLLLTFFLSYFEELVTGGRIYILETPLFRVRTKKETRYCYNANERDAAVSDLGTNSEVTRFKGLGEINPKEFGQFIGEDMRLVPVSVNTLKAVPQVLSFYMGKNTPERREYIMKNLIEDAG

πŸ“Š Sample Types

Isolate 8.6%
Metagenome 91.4%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Unclassified 33.9%
Termitidae 32.2%
Kalotermitidae 23.7%
Rhinotermitidae 3.4%
Termopsidae 3.4%
Hodotermitidae 1.7%
Blaberidae 1.7%

🌳 Taxonomy

Archaea 0
Bacteria 200
Eukaryota 0
Viruses 0
Unclassified 9

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125632 Treponema sp. Co191P1bin87 Isolate Unclassified
2 2781125635 Treponema sp. Co191P1bin60 Isolate Unclassified
3 2781125662 Treponema sp. Emb289P3bin141 Isolate Unclassified
4 2781125657 Treponema sp. Emb289P3bin15 Isolate Unclassified
5 2781125694 Treponema sp. Th196P3bin120 Isolate Unclassified
6 2781125697 Treponema sp. Th196P4bin17 Isolate Unclassified
7 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
8 3300002508 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 Metagenome Termitidae
9 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
10 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
11 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
12 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
13 2781125665 Treponema sp. Emb289P3bin117 Isolate Unclassified
14 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
15 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
16 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
17 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
18 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
19 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
20 2781125690 Treponema sp. Th196P3bin63 Isolate Unclassified
21 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
22 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
23 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
24 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
25 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
26 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
27 2781125638 Treponema sp. Co191P1bin8 Isolate Unclassified
28 2781125639 Treponema sp. Co191P1bin44 Isolate Unclassified
29 2781125649 Treponema sp. Co191P3bin15 Isolate Unclassified
30 2781125661 Treponema sp. Emb289P3bin69 Isolate Unclassified
31 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
32 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
33 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
34 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
35 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
36 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
37 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
38 2781125660 Treponema sp. Emb289P3bin52 Isolate Unclassified
39 2781125687 Treponema sp. Lab288P4bin29 Isolate Unclassified
40 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
41 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
42 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
43 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
44 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
45 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
46 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
47 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
48 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
49 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
50 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
51 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
52 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
53 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
54 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
55 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
56 2772190975 Treponema sp. RmG30 Isolate Blaberidae
57 2781125641 Treponema sp. Co191P1bin27 Isolate Unclassified
58 2781125642 Treponema sp. Co191P1bin35 Isolate Unclassified
59 2781125692 Treponema sp. Th196P3bin31 Isolate Unclassified
60 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_076692 3300042612 Unclassified 3601
2 Ga0466705_206488 3300042612 Bacteria 22408
3 AustNasuHG_c1001397 3300000089 Bacteria 8649
4 JGI24695J34938_10002719 3300002450 Bacteria 13064
5 JGI24695J34938_10005691 3300002450 Bacteria 7692
6 Ga0466712_055787 3300042614 Bacteria 25522
7 Ga0466712_170040 3300042614 Bacteria 2997
8 Ga0466712_217249 3300042614 Bacteria 27211
9 Ga0466712_276239 3300042614 Unclassified 12034
10 Ga0466711_033203 3300042615 Bacteria 2096
11 Ga0466711_459410 3300042615 Bacteria 3997
12 Ga0466715_073075 3300042616 Bacteria 10469
13 Ga0466715_084745 3300042616 Bacteria 6984
14 Ga0466715_181917 3300042616 Bacteria 5321
15 Ga0466726_344886 3300042619 Bacteria 3327
16 Ga0466728_055216 3300042620 Bacteria 6065
17 Ga0466728_083040 3300042620 Bacteria 7752
18 Ga0123356_10015315 3300010049 Bacteria 7352
19 Ga0123353_10032110 3300010167 Bacteria 8149
20 Ga0123353_10137665 3300010167 Bacteria 3915
21 Ga0466690_283714 3300042590 Bacteria 7865
22 Ga0466693_293912 3300042592 Bacteria 55262
23 Ga0466691_053181 3300042593 Bacteria 12742
24 Ga0466691_117175 3300042593 Bacteria 17103
25 Ga0466691_183892 3300042593 Bacteria 6372
26 Ga0466696_355333 3300042596 Bacteria 15766
27 Ga0466700_193849 3300042600 Bacteria 35866
28 Ga0466713_149729 3300042602 Bacteria 4241
29 Ga0466716_036307 3300042605 Bacteria 12337
30 Ga0466722_180903 3300042609 Bacteria 6083
31 Ga0466731_220686 3300042622 Bacteria 3869
32 Ga0466704_162661 3300042643 Bacteria 42824
33 Ga0466709_011335 3300042648 Bacteria 9665
34 JGI24698J34947_10005602 3300002449 Bacteria 6887
35 JGI24695J34938_10000023 3300002450 Bacteria 110103
36 JGI24695J34938_10002809 3300002450 Bacteria 12738
37 JGI24695J34938_10008156 3300002450 Bacteria 6018
38 JGI24702J35022_10013281 3300002462 Bacteria 4562
39 Ga0466711_306002 3300042615 Bacteria 5080
40 Ga0466723_295723 3300042618 Bacteria 6317
41 Ga0466726_422565 3300042619 Bacteria 15199
42 Ga0123356_10044528 3300010049 Bacteria 4131
43 Ga0264413_111878 3300024493 Bacteria 7596
44 Ga0466691_086211 3300042593 Bacteria 36200
45 Ga0466691_120171 3300042593 Bacteria 13523
46 Ga0466694_156129 3300042594 Bacteria 74614
47 Ga0466696_115178 3300042596 Bacteria 23824
48 Ga0466696_213610 3300042596 Bacteria 9793
49 Ga0466699_319853 3300042597 Bacteria 10161
50 Ga0466722_149092 3300042609 Bacteria 2631
51 Ga0466703_020566 3300042636 Bacteria 18585
52 Ga0466703_021411 3300042636 Bacteria 3026
53 Ga0466704_122002 3300042643 Bacteria 30457
54 Ga0466704_460023 3300042643 Bacteria 17910
55 Ga0466704_465796 3300042643 Bacteria 55836
56 Ga0466709_123880 3300042648 Bacteria 9198
57 Ga0466708_141530 3300042652 Bacteria 19881
58 JGI24698J34947_10006188 3300002449 Bacteria 6574
59 JGI24695J34938_10000236 3300002450 Bacteria 52868
60 JGI24702J35022_10003723 3300002462 Bacteria 9166
61 Ga0466712_060898 3300042614 Bacteria 5491
62 Ga0466711_328337 3300042615 Bacteria 19036
63 Ga0466715_169362 3300042616 Bacteria 13308
64 Ga0466715_223087 3300042616 Bacteria 19089
65 Ga0466715_348500 3300042616 Bacteria 6756
66 Ga0466723_006530 3300042618 Bacteria 22703
67 Ga0123356_10000407 3300010049 Bacteria 48938
68 Ga0123356_10000431 3300010049 Bacteria 47938
69 Ga0123356_10039161 3300010049 Unclassified 4416
70 Ga0466691_015000 3300042593 Bacteria 23861
71 Ga0466694_050440 3300042594 Bacteria 148325
72 Ga0466694_083944 3300042594 Bacteria 13067
73 Ga0466731_114944 3300042622 Bacteria 3913
74 Ga0466703_019276 3300042636 Bacteria 5538
75 Ga0466703_274929 3300042636 Bacteria 9941
76 Ga0466704_102062 3300042643 Bacteria 11274
77 Ga0466704_150528 3300042643 Bacteria 40163
78 Ga0466708_167746 3300042652 Bacteria 6730
79 Ga0466708_249234 3300042652 Bacteria 5870
80 Ga0466708_377629 3300042652 Bacteria 3510
81 Ga0466733_100386 3300042659 Bacteria 91702
82 JGI24698J34947_10000457 3300002449 Bacteria 19041
83 JGI24695J34938_10000852 3300002450 Bacteria 28276
84 JGI24695J34938_10001877 3300002450 Bacteria 17078
85 JGI24695J34938_10004046 3300002450 Unclassified 9830
86 JGI24695J34938_10006343 3300002450 Bacteria 7140
87 JGI24695J34938_10016295 3300002450 Bacteria 3784
88 Ga0466712_104225 3300042614 Bacteria 8519
89 Ga0466715_288158 3300042616 Bacteria 15475
90 Ga0466718_074631 3300042617 Bacteria 11598
91 Ga0466723_332765 3300042618 Bacteria 21737
92 Ga0123356_10023191 3300010049 Bacteria 5845
93 Ga0123353_10102701 3300010167 Bacteria 4608
94 Ga0466692_138507 3300042591 Bacteria 28367
95 Ga0466719_288901 3300042606 Bacteria 4098
96 Ga0466719_365900 3300042606 Bacteria 25712
97 Ga0466721_363580 3300042608 Bacteria 32780
98 Ga0466731_021153 3300042622 Bacteria 18900
99 Ga0466703_356192 3300042636 Bacteria 6048
100 Ga0466708_437744 3300042652 Bacteria 51835
101 Ga0466705_217545 3300042612 Bacteria 10546
102 JGI24698J34947_10000636 3300002449 Bacteria 16933
103 JGI24695J34938_10000333 3300002450 Bacteria 46505
104 JGI24695J34938_10003067 3300002450 Bacteria 11959
105 JGI24695J34938_10004010 3300002450 Bacteria 9906
106 JGI24700J35501_10928378 3300002508 Bacteria 7619
107 Ga0068305_10010468 3300005083 Bacteria 17327
108 Ga0466715_057218 3300042616 Bacteria 18099
109 Ga0466723_140722 3300042618 Bacteria 5328
110 Ga0466723_253618 3300042618 Bacteria 11361
111 Ga0466726_274906 3300042619 Bacteria 13849
112 Ga0466728_057850 3300042620 Bacteria 12334
113 Ga0466728_446144 3300042620 Bacteria 2926
114 Ga0466690_129314 3300042590 Bacteria 2081
115 Ga0466691_022408 3300042593 Bacteria 7241
116 Ga0466691_058158 3300042593 Bacteria 11018
117 Ga0466696_249661 3300042596 Bacteria 7303
118 Ga0466696_350007 3300042596 Bacteria 15628
119 Ga0466699_076644 3300042597 Bacteria 9216
120 Ga0466699_221331 3300042597 Bacteria 8319
121 Ga0466699_314935 3300042597 Bacteria 35477
122 Ga0466706_282825 3300042599 Bacteria 3533
123 Ga0466719_211142 3300042606 Bacteria 3962
124 Ga0466720_237359 3300042607 Bacteria 10851
125 Ga0466703_056379 3300042636 Bacteria 4492
126 Ga0466703_155675 3300042636 Bacteria 11749
127 Ga0466703_273540 3300042636 Bacteria 18168
128 Ga0466704_050836 3300042643 Bacteria 3849
129 Ga0466708_064367 3300042652 Bacteria 7957
130 Ga0466705_091697 3300042612 Bacteria 9285
131 JGI24698J34947_10000005 3300002449 Bacteria 60180
132 JGI24698J34947_10005576 3300002449 Bacteria 6907
133 JGI24695J34938_10009337 3300002450 Unclassified 5462
134 Ga0123357_10000428 3300009784 Bacteria 40312
135 Ga0466711_012004 3300042615 Bacteria 25076
136 Ga0466711_181000 3300042615 Bacteria 4224
137 Ga0466715_021532 3300042616 Bacteria 26806
138 Ga0466726_018474 3300042619 Bacteria 4718
139 Ga0466726_146029 3300042619 Bacteria 2201
140 Ga0123356_10001382 3300010049 Bacteria 26896
141 Ga0123354_10029597 3300010882 Bacteria 8609
142 Ga0466690_022919 3300042590 Bacteria 16488
143 Ga0466696_278448 3300042596 Bacteria 8016
144 Ga0466719_265799 3300042606 Bacteria 13261
145 Ga0466719_297647 3300042606 Bacteria 41658
146 Ga0466722_107644 3300042609 Bacteria 17605
147 Ga0466731_188578 3300042622 Bacteria 6932
148 Ga0466703_102891 3300042636 Bacteria 28156
149 Ga0466704_515711 3300042643 Bacteria 17863
150 Ga0466709_420056 3300042648 Unclassified 3922
151 Ga0466708_189995 3300042652 Bacteria 3891
152 Ga0466727_064818 3300042655 Bacteria 17843
153 JGI24698J34947_10013628 3300002449 Unclassified 4434
154 JGI24702J35022_10000918 3300002462 Bacteria 18353
155 Ga0466715_099077 3300042616 Bacteria 30278
156 Ga0466715_513480 3300042616 Bacteria 13111
157 Ga0466718_018672 3300042617 Bacteria 6383
158 Ga0466718_023428 3300042617 Bacteria 58531
159 Ga0466718_033214 3300042617 Bacteria 15252
160 Ga0466723_020994 3300042618 Bacteria 11359
161 Ga0466723_046495 3300042618 Bacteria 25534
162 Ga0466728_030019 3300042620 Bacteria 50626
163 Ga0123356_10001906 3300010049 Bacteria 22621
164 Ga0123353_10133986 3300010167 Bacteria 3975
165 Ga0466690_205943 3300042590 Unclassified 2980
166 Ga0466691_123277 3300042593 Bacteria 16326
167 Ga0466694_248957 3300042594 Bacteria 11620
168 Ga0466699_018112 3300042597 Bacteria 30293
169 Ga0466707_075499 3300042601 Bacteria 5533
170 Ga0466719_403247 3300042606 Bacteria 20432
171 Ga0466722_023990 3300042609 Bacteria 14966
172 Ga0466722_086541 3300042609 Bacteria 17160
173 Ga0466704_116228 3300042643 Bacteria 20763
174 JGI24695J34938_10000187 3300002450 Bacteria 58138
175 Ga0466711_038496 3300042615 Bacteria 33651
176 Ga0466711_200090 3300042615 Bacteria 10192
177 Ga0466723_107314 3300042618 Bacteria 7786
178 Ga0123356_10000067 3300010049 Bacteria 109410
179 Ga0466691_086793 3300042593 Bacteria 17578
180 Ga0466691_134352 3300042593 Unclassified 6849
181 Ga0466694_034901 3300042594 Bacteria 2402
182 Ga0466699_425188 3300042597 Bacteria 97421
183 Ga0466706_048280 3300042599 Bacteria 2038
184 Ga0466716_072069 3300042605 Bacteria 16699
185 Ga0466716_085910 3300042605 Bacteria 8625
186 Ga0466719_169635 3300042606 Bacteria 10571
187 Ga0466720_072888 3300042607 Bacteria 21485
188 Ga0466722_171179 3300042609 Bacteria 13531
189 Ga0466703_251690 3300042636 Bacteria 21578
190 Ga0466708_005306 3300042652 Bacteria 20730
191 Ga0466708_315444 3300042652 Bacteria 7468

πŸ“‹ Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042590 Ga0466690_022919 Ga0466690_022919_1732_3774 617
2 3300042590 Ga0466690_129314 Ga0466690_129314_82_1935 617
3 3300042590 Ga0466690_205943 Ga0466690_205943_376_2373 617
4 3300042593 Ga0466691_015000 Ga0466691_015000_311_2164 617
5 3300042597 Ga0466699_425188 Ga0466699_425188_10040_12031 617
6 3300042606 Ga0466719_211142 Ga0466719_211142_1461_3314 617
7 3300042615 Ga0466711_033203 Ga0466711_033203_214_2067 617
8 3300042616 Ga0466715_084745 Ga0466715_084745_3681_5534 617
9 3300042618 Ga0466723_140722 Ga0466723_140722_1501_3354 617
10 3300042619 Ga0466726_146029 Ga0466726_146029_223_2148 617
11 3300042622 Ga0466731_021153 Ga0466731_021153_2161_4074 617
12 3300042643 Ga0466704_150528 Ga0466704_150528_23624_25477 617
13 3300002450 JGI24695J34938_10001877 JGI24695J34938_100018778 618
14 3300002462 JGI24702J35022_10000918 JGI24702J35022_1000091811 618
15 3300042593 Ga0466691_053181 Ga0466691_053181_7208_9136 618
16 3300042597 Ga0466699_314935 Ga0466699_314935_25010_26947 618
17 3300042601 Ga0466707_075499 Ga0466707_075499_504_2423 618
18 3300042602 Ga0466713_149729 Ga0466713_149729_1739_3685 618
19 3300042617 Ga0466718_074631 Ga0466718_074631_445_2439 618
20 3300042618 Ga0466723_046495 Ga0466723_046495_3188_5170 618
21 3300042620 Ga0466728_446144 Ga0466728_446144_975_2831 618
22 3300002450 JGI24695J34938_10000333 JGI24695J34938_1000033316 619
23 3300009784 Ga0123357_10000428 Ga0123357_1000042818 619
24 3300010049 Ga0123356_10000431 Ga0123356_1000043155 619
25 3300010049 Ga0123356_10001382 Ga0123356_100013824 619
26 3300042616 Ga0466715_348500 Ga0466715_348500_3919_5778 619
27 3300042618 Ga0466723_020994 Ga0466723_020994_2442_4301 619
28 3300002450 JGI24695J34938_10002719 JGI24695J34938_1000271914 620
29 3300002450 JGI24695J34938_10003067 JGI24695J34938_100030675 620
30 3300002450 JGI24695J34938_10004010 JGI24695J34938_100040103 620
31 3300010049 Ga0123356_10015315 Ga0123356_100153153 620
32 3300010167 Ga0123353_10102701 Ga0123353_101027012 620
33 3300042593 Ga0466691_117175 Ga0466691_117175_2707_4722 620
34 3300042596 Ga0466696_278448 Ga0466696_278448_4968_6830 620
35 3300042597 Ga0466699_319853 Ga0466699_319853_4401_6347 620
36 3300042614 Ga0466712_276239 Ga0466712_276239_7622_9607 620
37 3300002450 JGI24695J34938_10000236 JGI24695J34938_1000023626 621
38 3300002450 JGI24695J34938_10008156 JGI24695J34938_100081562 621
39 3300010049 Ga0123356_10039161 Ga0123356_100391612 621
40 3300024493 Ga0264413_111878 Ga0264413_1118786 621
41 3300042593 Ga0466691_086211 Ga0466691_086211_24459_26324 621
42 3300042605 Ga0466716_085910 Ga0466716_085910_1337_3202 621
43 3300042616 Ga0466715_057218 Ga0466715_057218_11791_13833 621
44 3300042620 Ga0466728_055216 Ga0466728_055216_238_2265 621
45 3300042652 Ga0466708_437744 Ga0466708_437744_36155_38020 621
46 3300000089 AustNasuHG_c1001397 AustNasuHG_10013973 622
47 3300002450 JGI24695J34938_10004046 JGI24695J34938_100040462 622
48 3300002450 JGI24695J34938_10005691 JGI24695J34938_100056913 622
49 3300042592 Ga0466693_293912 Ga0466693_293912_34262_36265 622
50 3300042614 Ga0466712_104225 Ga0466712_104225_4337_6334 622
51 3300042616 Ga0466715_169362 Ga0466715_169362_9203_11155 622
52 3300042619 Ga0466726_018474 Ga0466726_018474_792_2660 622
53 3300042622 Ga0466731_114944 Ga0466731_114944_1198_3249 622
54 3300042652 Ga0466708_249234 Ga0466708_249234_2391_4259 622
55 3300002450 JGI24695J34938_10000023 JGI24695J34938_1000002334 623
56 3300002450 JGI24695J34938_10002809 JGI24695J34938_100028096 623
57 3300042593 Ga0466691_120171 Ga0466691_120171_6570_8609 623
58 3300042594 Ga0466694_248957 Ga0466694_248957_4257_6128 623
59 3300042655 Ga0466727_064818 Ga0466727_064818_1320_3191 623
60 3300002449 JGI24698J34947_10000636 JGI24698J34947_1000063617 624
61 3300002450 JGI24695J34938_10000187 JGI24695J34938_1000018746 624
62 3300002450 JGI24695J34938_10009337 JGI24695J34938_100093371 624
63 3300042609 Ga0466722_171179 Ga0466722_171179_1677_3734 624
64 3300042617 Ga0466718_018672 Ga0466718_018672_2991_4967 624
65 3300042643 Ga0466704_162661 Ga0466704_162661_24655_26670 624
66 3300042652 Ga0466708_167746 Ga0466708_167746_135_2147 624
67 iso_pr_bacteria 2781125694 2781434982 624
68 3300002449 JGI24698J34947_10006188 JGI24698J34947_100061884 625
69 3300042593 Ga0466691_123277 Ga0466691_123277_6567_8546 625
70 3300042599 Ga0466706_282825 Ga0466706_282825_1113_2990 625
71 3300042612 Ga0466705_091697 Ga0466705_091697_4002_5930 625
72 3300042652 Ga0466708_005306 Ga0466708_005306_9148_11025 625
73 3300002449 JGI24698J34947_10013628 JGI24698J34947_100136281 626
74 3300010167 Ga0123353_10137665 Ga0123353_101376652 626
75 3300042607 Ga0466720_237359 Ga0466720_237359_2236_4203 626
76 3300042609 Ga0466722_086541 Ga0466722_086541_152_2182 626
77 3300042616 Ga0466715_513480 Ga0466715_513480_5735_7615 626
78 3300042619 Ga0466726_274906 Ga0466726_274906_6194_8074 626
79 3300042619 Ga0466726_422565 Ga0466726_422565_1230_3110 626
80 3300042648 Ga0466709_420056 Ga0466709_420056_521_2479 626
81 iso_pr_bacteria 2781125692 2781432135 626
82 3300002449 JGI24698J34947_10005602 JGI24698J34947_100056025 627
83 3300002462 JGI24702J35022_10003723 JGI24702J35022_100037234 627
84 3300002508 JGI24700J35501_10928378 JGI24700J35501_109283782 627
85 3300010049 Ga0123356_10023191 Ga0123356_100231913 627
86 3300042599 Ga0466706_048280 Ga0466706_048280_69_1952 627
87 3300042606 Ga0466719_403247 Ga0466719_403247_6824_8878 627
88 3300042590 Ga0466690_283714 Ga0466690_283714_2463_4418 628
89 3300042614 Ga0466712_170040 Ga0466712_170040_178_2172 628
90 3300042616 Ga0466715_099077 Ga0466715_099077_7778_9778 628
91 3300042643 Ga0466704_116228 Ga0466704_116228_11733_13745 628
92 3300042648 Ga0466709_123880 Ga0466709_123880_4191_6335 628
93 3300002449 JGI24698J34947_10000005 JGI24698J34947_100000054 629
94 3300042593 Ga0466691_086793 Ga0466691_086793_14458_16362 629
95 3300042605 Ga0466716_072069 Ga0466716_072069_4305_6215 629
96 3300042614 Ga0466712_217249 Ga0466712_217249_2967_5003 629
97 3300042616 Ga0466715_223087 Ga0466715_223087_374_2464 629
98 3300042636 Ga0466703_021411 Ga0466703_021411_525_2414 629
99 3300042643 Ga0466704_102062 Ga0466704_102062_5577_7616 629
100 3300042643 Ga0466704_122002 Ga0466704_122002_25257_27161 629
101 3300042643 Ga0466704_465796 Ga0466704_465796_20134_22023 629
102 3300042659 Ga0466733_100386 Ga0466733_100386_24171_26339 629
103 3300042597 Ga0466699_221331 Ga0466699_221331_6208_8211 630
104 3300042612 Ga0466705_076692 Ga0466705_076692_1273_3165 630
105 3300042618 Ga0466723_107314 Ga0466723_107314_5300_7288 630
106 3300042643 Ga0466704_460023 Ga0466704_460023_9836_11728 630
107 3300042648 Ga0466709_011335 Ga0466709_011335_5115_7175 630
108 iso_pr_bacteria 2781125657 2781324265 630
109 3300002449 JGI24698J34947_10005576 JGI24698J34947_100055765 631
110 3300002462 JGI24702J35022_10013281 JGI24702J35022_100132813 631
111 3300010049 Ga0123356_10000067 Ga0123356_1000006789 631
112 3300010049 Ga0123356_10044528 Ga0123356_100445283 631
113 3300042596 Ga0466696_350007 Ga0466696_350007_156_2051 631
114 3300042607 Ga0466720_072888 Ga0466720_072888_9012_11141 631
115 3300042608 Ga0466721_363580 Ga0466721_363580_9696_11591 631
116 3300042615 Ga0466711_181000 Ga0466711_181000_2267_4204 631
117 3300042618 Ga0466723_006530 Ga0466723_006530_18695_20737 631
118 iso_pr_bacteria 2781125662 2781336132 631
119 3300010049 Ga0123356_10000407 Ga0123356_1000040730 632
120 3300010049 Ga0123356_10001906 Ga0123356_1000190616 632
121 3300042606 Ga0466719_288901 Ga0466719_288901_175_2148 632
122 3300042618 Ga0466723_295723 Ga0466723_295723_1435_3333 632
123 3300042619 Ga0466726_344886 Ga0466726_344886_668_2566 632
124 3300002449 JGI24698J34947_10000457 JGI24698J34947_100004571 633
125 3300042594 Ga0466694_050440 Ga0466694_050440_93027_95009 633
126 3300042597 Ga0466699_018112 Ga0466699_018112_12912_14909 633
127 3300042620 Ga0466728_057850 Ga0466728_057850_8471_10372 633
128 3300042652 Ga0466708_064367 Ga0466708_064367_5768_7726 633
129 3300042593 Ga0466691_022408 Ga0466691_022408_1668_3632 634
130 3300042594 Ga0466694_034901 Ga0466694_034901_359_2314 634
131 3300042596 Ga0466696_249661 Ga0466696_249661_2436_4454 634
132 3300042609 Ga0466722_023990 Ga0466722_023990_10387_12336 634
133 3300042615 Ga0466711_328337 Ga0466711_328337_11024_13012 634
134 3300042617 Ga0466718_033214 Ga0466718_033214_10927_12831 634
135 3300010167 Ga0123353_10032110 Ga0123353_100321102 635
136 3300042596 Ga0466696_115178 Ga0466696_115178_4566_6473 635
137 3300042597 Ga0466699_076644 Ga0466699_076644_6266_8215 635
138 3300042606 Ga0466719_365900 Ga0466719_365900_412_2319 635
139 3300042616 Ga0466715_288158 Ga0466715_288158_7240_9351 635
140 3300042594 Ga0466694_083944 Ga0466694_083944_2107_4017 636
141 3300042600 Ga0466700_193849 Ga0466700_193849_186_2195 636
142 3300042614 Ga0466712_055787 Ga0466712_055787_20490_22493 636
143 3300042615 Ga0466711_200090 Ga0466711_200090_313_2223 636
144 3300042617 Ga0466718_023428 Ga0466718_023428_21801_23750 636
145 3300042605 Ga0466716_036307 Ga0466716_036307_9477_11504 637
146 3300042616 Ga0466715_181917 Ga0466715_181917_707_2770 637
147 3300042636 Ga0466703_056379 Ga0466703_056379_2237_4276 637
148 iso_pr_bacteria 2781125649 2781307256 637
149 3300042615 Ga0466711_012004 Ga0466711_012004_11584_13566 638
150 3300042618 Ga0466723_253618 Ga0466723_253618_7685_9667 638
151 3300042620 Ga0466728_083040 Ga0466728_083040_3338_5329 638
152 3300042609 Ga0466722_107644 Ga0466722_107644_3895_5814 639
153 3300042636 Ga0466703_019276 Ga0466703_019276_3452_5467 639
154 3300042606 Ga0466719_265799 Ga0466719_265799_6558_8585 640
155 3300042614 Ga0466712_060898 Ga0466712_060898_3173_5287 640
156 3300042636 Ga0466703_020566 Ga0466703_020566_15102_17051 640
157 3300042636 Ga0466703_356192 Ga0466703_356192_1088_3010 640
158 iso_pr_bacteria 2781125641 2781291398 640
159 3300002450 JGI24695J34938_10006343 JGI24695J34938_100063432 641
160 3300002450 JGI24695J34938_10016295 JGI24695J34938_100162952 641
161 3300042594 Ga0466694_156129 Ga0466694_156129_63441_65441 641
162 3300042615 Ga0466711_038496 Ga0466711_038496_1568_3493 641
163 3300042615 Ga0466711_306002 Ga0466711_306002_2689_4668 641
164 3300042618 Ga0466723_332765 Ga0466723_332765_12774_14699 641
165 3300042622 Ga0466731_188578 Ga0466731_188578_4920_6905 641
166 3300042636 Ga0466703_251690 Ga0466703_251690_9460_11385 641
167 iso_pr_bacteria 2781125660 2781330504 641
168 3300005083 Ga0068305_10010468 Ga0068305_100104681 642
169 3300042622 Ga0466731_220686 Ga0466731_220686_1009_3042 642
170 iso_pr_bacteria 2781125697 2781442518 642
171 3300002450 JGI24695J34938_10000852 JGI24695J34938_100008524 643
172 3300042593 Ga0466691_058158 Ga0466691_058158_3440_5371 643
173 3300042636 Ga0466703_273540 Ga0466703_273540_63_2147 643
174 3300042616 Ga0466715_073075 Ga0466715_073075_3259_5481 644
175 3300042652 Ga0466708_377629 Ga0466708_377629_974_2983 644
176 3300042636 Ga0466703_274929 Ga0466703_274929_4493_6568 645
177 3300042643 Ga0466704_050836 Ga0466704_050836_71_2173 645
178 3300042643 Ga0466704_515711 Ga0466704_515711_6055_8052 646
179 3300042652 Ga0466708_315444 Ga0466708_315444_3571_5511 646
180 iso_pr_bacteria 2781125661 2781333702 646
181 3300010882 Ga0123354_10029597 Ga0123354_100295972 647
182 3300042593 Ga0466691_134352 Ga0466691_134352_27_1970 647
183 3300042616 Ga0466715_021532 Ga0466715_021532_8607_10640 648
184 3300042636 Ga0466703_102891 Ga0466703_102891_6511_8490 648
185 iso_pr_bacteria 2781125642 2781292432 648
186 3300010167 Ga0123353_10133986 Ga0123353_101339863 650
187 3300042591 Ga0466692_138507 Ga0466692_138507_16909_18915 650
188 3300042606 Ga0466719_169635 Ga0466719_169635_8124_10103 650
189 3300042606 Ga0466719_297647 Ga0466719_297647_12779_14770 651
190 3300042612 Ga0466705_206488 Ga0466705_206488_4556_6601 651
191 3300042615 Ga0466711_459410 Ga0466711_459410_1512_3542 651
192 iso_pr_bacteria 2781125638 2781284388 651
193 3300042620 Ga0466728_030019 Ga0466728_030019_5619_7598 653
194 iso_pr_bacteria 2772190975 2773722738 653
195 3300042596 Ga0466696_355333 Ga0466696_355333_4202_6184 654
196 3300042652 Ga0466708_189995 Ga0466708_189995_1255_3219 654
197 iso_pr_bacteria 2781125665 2781341738 654
198 iso_pr_bacteria 2781125687 2781420075 657
199 3300042609 Ga0466722_180903 Ga0466722_180903_3077_5203 659
200 iso_pr_bacteria 2781125635 2781277907 660
201 3300042609 Ga0466722_149092 Ga0466722_149092_419_2413 664
202 3300042636 Ga0466703_155675 Ga0466703_155675_5445_7490 665
203 3300042652 Ga0466708_141530 Ga0466708_141530_13767_15800 666
204 iso_pr_bacteria 2781125639 2781286950 667
205 3300042612 Ga0466705_217545 Ga0466705_217545_3589_5607 672
206 iso_pr_bacteria 2781125690 2781428219 675
207 3300042596 Ga0466696_213610 Ga0466696_213610_4413_6470 676
208 3300042593 Ga0466691_183892 Ga0466691_183892_1928_3976 682
209 iso_pr_bacteria 2781125632 2781269343 771

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00986 DNA_gyraseB_C DNA gyrase B subunit, carboxyl terminus 705 763 0.91
PF00204 DNA_gyraseB DNA gyrase B 394 533 0.89
PF01751 Toprim Toprim domain 567 674 0.83
PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase 208 338 0.78

βš›οΈ Structure & Feature Viewer

pLDDTpTMQuality
0.48 0.6 Medium

Powered by Feature Viewer

Powered by PDBe Molstar

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.