Protein Family IF11737
Metagenome
Isolate
120
Members
38
Samples
116
Scaffolds
134.19
Avg Length
Representative Sequence
- ID
- iso_pr_bacteria|2781125631|2781268236|
- Length
- 154 aa
- Sequence
- LPSICIHLPIINLTVTKQMIMSKIALDSNILIYNHSLDHEKKRLIAIGFFNEMPVVSSQVISEYLNVMRKKFKVEKNELMQICSSWLEKCTVQPVVSSTIKHAQNLVAKYDFQLFDGIVVAAALEANCDILYSEDMHDGLVVEKTLTIINPFKE
Sample Types
Isolate
3.3%
Metagenome
96.7%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
66.7%
Unclassified
16.7%
Kalotermitidae
11.1%
Rhinotermitidae
2.8%
Termopsidae
2.8%
Taxonomy
Archaea
0
Bacteria
95
Eukaryota
0
Viruses
0
Unclassified
25
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 2 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 3 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 4 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 5 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 6 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 7 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 8 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 9 | 3300002507 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 | Metagenome | Termitidae |
| 10 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 11 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 12 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 13 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 14 | 2781125689 | Treponema sp. Mp193P4bin9 | Isolate | Unclassified |
| 15 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 16 | 2781125658 | Treponema sp. Emb289P3bin37 | Isolate | Unclassified |
| 17 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 18 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 19 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 20 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 21 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 22 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 23 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 24 | 2781125631 | Treponema sp. Nt197P3bin89 | Isolate | Unclassified |
| 25 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 26 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 27 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 28 | 2030936001 | Nasutitermes corniger hindgut microbial communities from Florida, USA | Metagenome | Termitidae |
| 29 | 2820746860 | Unclassified Bacteroidetes Th196P3bin126 | Isolate | Unclassified |
| 30 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 31 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 32 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 33 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 34 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 35 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 36 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 37 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 38 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466732_289245 | 3300042656 | Bacteria | 2355 |
| 2 | Ga0466708_310231 | 3300042652 | Bacteria | 5306 |
| 3 | Ga0466707_282677 | 3300042601 | Bacteria | 2807 |
| 4 | Ga0466720_162633 | 3300042607 | Bacteria | 2031 |
| 5 | Ga0466720_168744 | 3300042607 | Bacteria | 21244 |
| 6 | Ga0264413_140351 | 3300024493 | Bacteria | 1629 |
| 7 | Ga0466699_349866 | 3300042597 | Unclassified | 4229 |
| 8 | Ga0123356_11852723 | 3300010049 | Unclassified | 750 |
| 9 | JGI24698J34947_10170475 | 3300002449 | Bacteria | 881 |
| 10 | JGI24695J34938_10008381 | 3300002450 | Bacteria | 5903 |
| 11 | JGI24702J35022_10001092 | 3300002462 | Bacteria | 16861 |
| 12 | Ga0466700_303869 | 3300042600 | Bacteria | 2052 |
| 13 | Ga0466719_155505 | 3300042606 | Bacteria | 1408 |
| 14 | Ga0466699_294521 | 3300042597 | Bacteria | 1475 |
| 15 | Ga0123356_11638371 | 3300010049 | Bacteria | 797 |
| 16 | Ga0123353_11543641 | 3300010167 | Bacteria | 843 |
| 17 | Ga0466712_080480 | 3300042614 | Bacteria | 6785 |
| 18 | Ga0466718_055008 | 3300042617 | Bacteria | 1142 |
| 19 | Ga0466718_072681 | 3300042617 | Unclassified | 1404 |
| 20 | Ga0466718_106421 | 3300042617 | Unclassified | 5536 |
| 21 | Ga0466728_106910 | 3300042620 | Bacteria | 7761 |
| 22 | Ga0466729_129310 | 3300042621 | Bacteria | 3091 |
| 23 | AustNasuHG_c1004999 | 3300000089 | Bacteria | 4744 |
| 24 | JGI24698J34947_10115566 | 3300002449 | Unclassified | 1175 |
| 25 | JGI24695J34938_10080316 | 3300002450 | Bacteria | 1348 |
| 26 | JGI24702J35022_10151041 | 3300002462 | Bacteria | 1303 |
| 27 | Ga0072940_1168432 | 3300005200 | Bacteria | 1207 |
| 28 | Ga0466731_084010 | 3300042622 | Bacteria | 2752 |
| 29 | Ga0466701_052551 | 3300042598 | Bacteria | 1023 |
| 30 | Ga0466721_245155 | 3300042608 | Unclassified | 1376 |
| 31 | Ga0264413_109469 | 3300024493 | Bacteria | 2994 |
| 32 | Ga0264413_118517 | 3300024493 | Unclassified | 1513 |
| 33 | Ga0466694_335211 | 3300042594 | Bacteria | 1037 |
| 34 | Ga0466699_417277 | 3300042597 | Unclassified | 1387 |
| 35 | Ga0123356_10756684 | 3300010049 | Bacteria | 1142 |
| 36 | Ga0466712_241360 | 3300042614 | Unclassified | 4305 |
| 37 | Ga0466718_010548 | 3300042617 | Bacteria | 4539 |
| 38 | Ga0466718_027539 | 3300042617 | Bacteria | 5018 |
| 39 | Ga0466718_044538 | 3300042617 | Bacteria | 1132 |
| 40 | AustNasuHG_c1031130 | 3300000089 | Bacteria | 1516 |
| 41 | JGI24698J34947_10022946 | 3300002449 | Unclassified | 3340 |
| 42 | JGI24698J34947_10038281 | 3300002449 | Bacteria | 2488 |
| 43 | JGI24698J34947_10073994 | 3300002449 | Bacteria | 1624 |
| 44 | Ga0466732_424669 | 3300042656 | Bacteria | 1179 |
| 45 | Ga0466733_001006 | 3300042659 | Bacteria | 4650 |
| 46 | Ga0466731_430657 | 3300042622 | Bacteria | 1052 |
| 47 | Ga0466713_008244 | 3300042602 | Bacteria | 1492 |
| 48 | Ga0466719_260743 | 3300042606 | Bacteria | 1425 |
| 49 | Ga0466720_004714 | 3300042607 | Bacteria | 3819 |
| 50 | Ga0466721_323906 | 3300042608 | Bacteria | 1173 |
| 51 | Ga0264413_111967 | 3300024493 | Bacteria | 2986 |
| 52 | Ga0466694_361464 | 3300042594 | Unclassified | 2770 |
| 53 | Ga0466699_330398 | 3300042597 | Bacteria | 1350 |
| 54 | Ga0466699_403336 | 3300042597 | Bacteria | 1029 |
| 55 | Ga0466712_115856 | 3300042614 | Unclassified | 1514 |
| 56 | Ga0466712_116662 | 3300042614 | Bacteria | 2124 |
| 57 | Ga0466718_053855 | 3300042617 | Unclassified | 1327 |
| 58 | JGI24698J34947_10021940 | 3300002449 | Unclassified | 3428 |
| 59 | JGI24698J34947_10096354 | 3300002449 | Bacteria | 1342 |
| 60 | JGI24702J35022_10254221 | 3300002462 | Bacteria | 1023 |
| 61 | JGI24696J40584_12873912 | 3300002834 | Bacteria | 1056 |
| 62 | Ga0072941_1028497 | 3300005201 | Bacteria | 7956 |
| 63 | Ga0466707_227676 | 3300042601 | Bacteria | 1346 |
| 64 | Ga0466720_040873 | 3300042607 | Bacteria | 4370 |
| 65 | Ga0466720_185331 | 3300042607 | Bacteria | 80374 |
| 66 | Ga0123356_10083532 | 3300010049 | Bacteria | 3025 |
| 67 | Ga0123356_11630224 | 3300010049 | Bacteria | 799 |
| 68 | Ga0123353_11894081 | 3300010167 | Bacteria | 736 |
| 69 | Ga0466712_052009 | 3300042614 | Bacteria | 1501 |
| 70 | Ga0466712_124056 | 3300042614 | Bacteria | 3539 |
| 71 | Ga0466718_016375 | 3300042617 | Bacteria | 3534 |
| 72 | JGI24698J34947_10070050 | 3300002449 | Bacteria | 1690 |
| 73 | JGI24697J35500_11195195 | 3300002507 | Unclassified | 1621 |
| 74 | Ga0466705_026147 | 3300042612 | Bacteria | 1730 |
| 75 | Ga0466732_290650 | 3300042656 | Bacteria | 1380 |
| 76 | Ga0466731_113188 | 3300042622 | Bacteria | 1106 |
| 77 | Ga0466727_301929 | 3300042655 | Bacteria | 5854 |
| 78 | Ga0466719_519694 | 3300042606 | Bacteria | 1366 |
| 79 | Ga0466720_088577 | 3300042607 | Unclassified | 5624 |
| 80 | Ga0466720_115436 | 3300042607 | Bacteria | 52557 |
| 81 | Ga0466694_000959 | 3300042594 | Bacteria | 4895 |
| 82 | Ga0466694_390876 | 3300042594 | Bacteria | 6650 |
| 83 | Ga0123356_10003785 | 3300010049 | Bacteria | 15752 |
| 84 | Ga0123356_10472071 | 3300010049 | Bacteria | 1406 |
| 85 | Ga0123353_11342645 | 3300010167 | Bacteria | 924 |
| 86 | Ga0466712_163763 | 3300042614 | Unclassified | 1184 |
| 87 | Ga0466712_319406 | 3300042614 | Bacteria | 7507 |
| 88 | JGI24698J34947_10000880 | 3300002449 | Unclassified | 15186 |
| 89 | JGI24698J34947_10084957 | 3300002449 | Unclassified | 1472 |
| 90 | JGI24702J35022_10021018 | 3300002462 | Unclassified | 3542 |
| 91 | Ga0466732_387290 | 3300042656 | Bacteria | 1077 |
| 92 | Ga0466729_313094 | 3300042621 | Bacteria | 6886 |
| 93 | Ga0466731_134358 | 3300042622 | Unclassified | 1555 |
| 94 | Ga0466700_367816 | 3300042600 | Bacteria | 1025 |
| 95 | Ga0466720_005379 | 3300042607 | Bacteria | 1108 |
| 96 | Ga0264413_126612 | 3300024493 | Unclassified | 1261 |
| 97 | Ga0466699_127646 | 3300042597 | Bacteria | 2198 |
| 98 | Ga0123356_10014703 | 3300010049 | Bacteria | 7520 |
| 99 | Ga0123356_10101700 | 3300010049 | Bacteria | 2758 |
| 100 | Ga0466718_003738 | 3300042617 | Bacteria | 2807 |
| 101 | Ga0466718_113973 | 3300042617 | Unclassified | 1172 |
| 102 | Nasutiter_Contig03945 | 2030936001 | Bacteria | 870 |
| 103 | Ga0072941_1024367 | 3300005201 | Bacteria | 4886 |
| 104 | Ga0072941_1072800 | 3300005201 | Bacteria | 864 |
| 105 | Ga0466720_058042 | 3300042607 | Bacteria | 13560 |
| 106 | Ga0466720_238307 | 3300042607 | Unclassified | 1752 |
| 107 | Ga0466698_251926 | 3300042610 | Bacteria | 1339 |
| 108 | Ga0466699_176329 | 3300042597 | Unclassified | 3505 |
| 109 | Ga0123356_10770777 | 3300010049 | Bacteria | 1132 |
| 110 | Ga0123356_12296867 | 3300010049 | Bacteria | 674 |
| 111 | Ga0123354_10599330 | 3300010882 | Bacteria | 808 |
| 112 | Ga0466712_126139 | 3300042614 | Bacteria | 3102 |
| 113 | Ga0466712_237996 | 3300042614 | Bacteria | 1776 |
| 114 | AustNasuHG_c1046644 | 3300000089 | Bacteria | 975 |
| 115 | JGI24695J34938_10024593 | 3300002450 | Bacteria | 2890 |
| 116 | JGI24699J35502_10487303 | 3300002509 | Bacteria | 609 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042606 | Ga0466719_260743 | Ga0466719_260743_206_613 | 122 |
| 2 | 3300005200 | Ga0072940_1168432 | Ga0072940_11684322 | 124 |
| 3 | 3300042606 | Ga0466719_519694 | Ga0466719_519694_352_768 | 125 |
| 4 | 3300042601 | Ga0466707_227676 | Ga0466707_227676_347_742 | 131 |
| 5 | 3300042601 | Ga0466707_282677 | Ga0466707_282677_242_637 | 131 |
| 6 | 3300042652 | Ga0466708_310231 | Ga0466708_310231_505_900 | 131 |
| 7 | 2030936001 | Nasutiter_Contig03945 | Nasutiterm_1759970 | 133 |
| 8 | 3300010049 | Ga0123356_10472071 | Ga0123356_104720712 | 133 |
| 9 | 3300024493 | Ga0264413_109469 | Ga0264413_1094693 | 133 |
| 10 | 3300024493 | Ga0264413_111967 | Ga0264413_1119676 | 133 |
| 11 | 3300024493 | Ga0264413_118517 | Ga0264413_1185171 | 133 |
| 12 | 3300024493 | Ga0264413_140351 | Ga0264413_1403514 | 133 |
| 13 | 3300042594 | Ga0466694_000959 | Ga0466694_000959_1549_1950 | 133 |
| 14 | 3300042594 | Ga0466694_390876 | Ga0466694_390876_6136_6537 | 133 |
| 15 | 3300042597 | Ga0466699_330398 | Ga0466699_330398_816_1217 | 133 |
| 16 | 3300042597 | Ga0466699_417277 | Ga0466699_417277_367_768 | 133 |
| 17 | 3300042598 | Ga0466701_052551 | Ga0466701_052551_303_704 | 133 |
| 18 | 3300042602 | Ga0466713_008244 | Ga0466713_008244_681_1082 | 133 |
| 19 | 3300042606 | Ga0466719_155505 | Ga0466719_155505_436_837 | 133 |
| 20 | 3300042607 | Ga0466720_004714 | Ga0466720_004714_2851_3252 | 133 |
| 21 | 3300042607 | Ga0466720_040873 | Ga0466720_040873_1645_2046 | 133 |
| 22 | 3300042607 | Ga0466720_058042 | Ga0466720_058042_961_1362 | 133 |
| 23 | 3300042607 | Ga0466720_115436 | Ga0466720_115436_45585_45986 | 133 |
| 24 | 3300042607 | Ga0466720_162633 | Ga0466720_162633_652_1053 | 133 |
| 25 | 3300042607 | Ga0466720_168744 | Ga0466720_168744_19232_19633 | 133 |
| 26 | 3300042608 | Ga0466721_245155 | Ga0466721_245155_284_685 | 133 |
| 27 | 3300042608 | Ga0466721_323906 | Ga0466721_323906_51_452 | 133 |
| 28 | 3300042614 | Ga0466712_052009 | Ga0466712_052009_307_708 | 133 |
| 29 | 3300042614 | Ga0466712_080480 | Ga0466712_080480_6143_6544 | 133 |
| 30 | 3300042614 | Ga0466712_116662 | Ga0466712_116662_250_651 | 133 |
| 31 | 3300042614 | Ga0466712_124056 | Ga0466712_124056_2152_2553 | 133 |
| 32 | 3300042614 | Ga0466712_126139 | Ga0466712_126139_931_1332 | 133 |
| 33 | 3300042614 | Ga0466712_163763 | Ga0466712_163763_404_805 | 133 |
| 34 | 3300042614 | Ga0466712_237996 | Ga0466712_237996_241_642 | 133 |
| 35 | 3300042614 | Ga0466712_241360 | Ga0466712_241360_928_1329 | 133 |
| 36 | 3300042614 | Ga0466712_319406 | Ga0466712_319406_6266_6667 | 133 |
| 37 | 3300042617 | Ga0466718_003738 | Ga0466718_003738_1673_2074 | 133 |
| 38 | 3300042617 | Ga0466718_010548 | Ga0466718_010548_2764_3165 | 133 |
| 39 | 3300042617 | Ga0466718_016375 | Ga0466718_016375_2808_3209 | 133 |
| 40 | 3300042617 | Ga0466718_027539 | Ga0466718_027539_3985_4386 | 133 |
| 41 | 3300042617 | Ga0466718_044538 | Ga0466718_044538_493_894 | 133 |
| 42 | 3300042617 | Ga0466718_053855 | Ga0466718_053855_612_1013 | 133 |
| 43 | 3300042617 | Ga0466718_072681 | Ga0466718_072681_732_1133 | 133 |
| 44 | 3300042617 | Ga0466718_113973 | Ga0466718_113973_343_744 | 133 |
| 45 | 3300042621 | Ga0466729_313094 | Ga0466729_313094_740_1141 | 133 |
| 46 | 3300042622 | Ga0466731_084010 | Ga0466731_084010_446_847 | 133 |
| 47 | 3300042622 | Ga0466731_113188 | Ga0466731_113188_328_729 | 133 |
| 48 | 3300042622 | Ga0466731_134358 | Ga0466731_134358_991_1392 | 133 |
| 49 | 3300042622 | Ga0466731_430657 | Ga0466731_430657_266_667 | 133 |
| 50 | 3300042655 | Ga0466727_301929 | Ga0466727_301929_2263_2664 | 133 |
| 51 | 3300042656 | Ga0466732_289245 | Ga0466732_289245_1081_1482 | 133 |
| 52 | 3300042656 | Ga0466732_290650 | Ga0466732_290650_402_803 | 133 |
| 53 | 3300042656 | Ga0466732_424669 | Ga0466732_424669_547_948 | 133 |
| 54 | 3300042659 | Ga0466733_001006 | Ga0466733_001006_428_829 | 133 |
| 55 | iso_pr_bacteria | 2781125658 | 2781325897 | 133 |
| 56 | 3300000089 | AustNasuHG_c1004999 | AustNasuHG_10049994 | 134 |
| 57 | 3300002449 | JGI24698J34947_10000880 | JGI24698J34947_100008804 | 134 |
| 58 | 3300002449 | JGI24698J34947_10021940 | JGI24698J34947_100219403 | 134 |
| 59 | 3300002449 | JGI24698J34947_10022946 | JGI24698J34947_100229461 | 134 |
| 60 | 3300002449 | JGI24698J34947_10038281 | JGI24698J34947_100382812 | 134 |
| 61 | 3300002449 | JGI24698J34947_10070050 | JGI24698J34947_100700502 | 134 |
| 62 | 3300002449 | JGI24698J34947_10073994 | JGI24698J34947_100739942 | 134 |
| 63 | 3300002449 | JGI24698J34947_10084957 | JGI24698J34947_100849573 | 134 |
| 64 | 3300002449 | JGI24698J34947_10096354 | JGI24698J34947_100963543 | 134 |
| 65 | 3300002449 | JGI24698J34947_10115566 | JGI24698J34947_101155662 | 134 |
| 66 | 3300002449 | JGI24698J34947_10170475 | JGI24698J34947_101704752 | 134 |
| 67 | 3300002450 | JGI24695J34938_10008381 | JGI24695J34938_100083818 | 134 |
| 68 | 3300002450 | JGI24695J34938_10024593 | JGI24695J34938_100245933 | 134 |
| 69 | 3300002450 | JGI24695J34938_10080316 | JGI24695J34938_100803163 | 134 |
| 70 | 3300002462 | JGI24702J35022_10001092 | JGI24702J35022_1000109212 | 134 |
| 71 | 3300002462 | JGI24702J35022_10021018 | JGI24702J35022_100210186 | 134 |
| 72 | 3300002462 | JGI24702J35022_10254221 | JGI24702J35022_102542213 | 134 |
| 73 | 3300002509 | JGI24699J35502_10487303 | JGI24699J35502_104873031 | 134 |
| 74 | 3300005201 | Ga0072941_1024367 | Ga0072941_10243675 | 134 |
| 75 | 3300005201 | Ga0072941_1028497 | Ga0072941_10284975 | 134 |
| 76 | 3300005201 | Ga0072941_1072800 | Ga0072941_10728002 | 134 |
| 77 | 3300010049 | Ga0123356_10003785 | Ga0123356_100037855 | 134 |
| 78 | 3300010049 | Ga0123356_10014703 | Ga0123356_100147036 | 134 |
| 79 | 3300010049 | Ga0123356_10101700 | Ga0123356_101017005 | 134 |
| 80 | 3300010049 | Ga0123356_10756684 | Ga0123356_107566842 | 134 |
| 81 | 3300010167 | Ga0123353_11894081 | Ga0123353_118940812 | 134 |
| 82 | 3300024493 | Ga0264413_126612 | Ga0264413_1266123 | 134 |
| 83 | 3300042607 | Ga0466720_088577 | Ga0466720_088577_3993_4397 | 134 |
| 84 | 3300042607 | Ga0466720_185331 | Ga0466720_185331_9415_9819 | 134 |
| 85 | 3300042617 | Ga0466718_106421 | Ga0466718_106421_4525_4929 | 134 |
| 86 | 3300042621 | Ga0466729_129310 | Ga0466729_129310_2628_3032 | 134 |
| 87 | iso_pr_bacteria | 2820746860 | 2820747349 | 134 |
| 88 | 3300000089 | AustNasuHG_c1046644 | AustNasuHG_10466442 | 135 |
| 89 | 3300002462 | JGI24702J35022_10151041 | JGI24702J35022_101510411 | 135 |
| 90 | 3300010049 | Ga0123356_12296867 | Ga0123356_122968672 | 135 |
| 91 | 3300042597 | Ga0466699_127646 | Ga0466699_127646_243_650 | 135 |
| 92 | 3300042597 | Ga0466699_176329 | Ga0466699_176329_1672_2079 | 135 |
| 93 | 3300042597 | Ga0466699_294521 | Ga0466699_294521_386_793 | 135 |
| 94 | 3300042597 | Ga0466699_349866 | Ga0466699_349866_359_766 | 135 |
| 95 | 3300042607 | Ga0466720_005379 | Ga0466720_005379_207_614 | 135 |
| 96 | 3300042607 | Ga0466720_238307 | Ga0466720_238307_449_856 | 135 |
| 97 | 3300042610 | Ga0466698_251926 | Ga0466698_251926_362_769 | 135 |
| 98 | 3300042612 | Ga0466705_026147 | Ga0466705_026147_1037_1444 | 135 |
| 99 | 3300042620 | Ga0466728_106910 | Ga0466728_106910_404_811 | 135 |
| 100 | iso_pr_bacteria | 2781125689 | 2781426235 | 135 |
| 101 | 3300002507 | JGI24697J35500_11195195 | JGI24697J35500_111951953 | 136 |
| 102 | 3300002834 | JGI24696J40584_12873912 | JGI24696J40584_128739122 | 136 |
| 103 | 3300010049 | Ga0123356_10083532 | Ga0123356_100835323 | 136 |
| 104 | 3300010049 | Ga0123356_11630224 | Ga0123356_116302241 | 136 |
| 105 | 3300010049 | Ga0123356_11638371 | Ga0123356_116383712 | 136 |
| 106 | 3300042600 | Ga0466700_303869 | Ga0466700_303869_578_988 | 136 |
| 107 | 3300042600 | Ga0466700_367816 | Ga0466700_367816_217_627 | 136 |
| 108 | 3300042656 | Ga0466732_387290 | Ga0466732_387290_143_556 | 137 |
| 109 | 3300000089 | AustNasuHG_c1031130 | AustNasuHG_10311303 | 138 |
| 110 | 3300010049 | Ga0123356_11852723 | Ga0123356_118527231 | 138 |
| 111 | 3300010167 | Ga0123353_11342645 | Ga0123353_113426451 | 138 |
| 112 | 3300010882 | Ga0123354_10599330 | Ga0123354_105993302 | 138 |
| 113 | 3300042594 | Ga0466694_335211 | Ga0466694_335211_495_911 | 138 |
| 114 | 3300042594 | Ga0466694_361464 | Ga0466694_361464_1633_2049 | 138 |
| 115 | 3300042614 | Ga0466712_115856 | Ga0466712_115856_413_829 | 138 |
| 116 | 3300010049 | Ga0123356_10770777 | Ga0123356_107707771 | 139 |
| 117 | 3300010167 | Ga0123353_11543641 | Ga0123353_115436412 | 142 |
| 118 | 3300042597 | Ga0466699_403336 | Ga0466699_403336_84_512 | 142 |
| 119 | 3300042617 | Ga0466718_055008 | Ga0466718_055008_53_496 | 147 |
| 120 | iso_pr_bacteria | 2781125631 | 2781268236 | 154 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01850 | PIN | PIN domain | 24 | 135 | 0.88 |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.81 | 0.87 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.