Protein Family IF11734

Metagenome Isolate
124 Members
46 Samples
115 Scaffolds
234.72 Avg Length

🧬 Representative Sequence

ID
iso_pr_bacteria|2781125629|2781263867|
Length
283 aa
Sequence
MNIIAFDTASDVFSIGLSIEGHKYSISVDSGQKHSELIMDAADTLLRLADIEKSSLNAVACMEGPGSFTGLRIGFSAAKGLALALDIPIIPVPTLDCMAYPLSFWPGMVLPVMDAKKNAFFTALYSQGSRISDYFDIESKQLINTIEATWSGYNQQPRPKGSGYVGSDRYGLYAGLTPLKQNLEFSQTAQRGGVLNPLANKNTSVPLLLVTGPAASMVQNALVEAFPGTVSCGIFHQGYVEGLLNLAIQNSIINKELLDFSVGPLYLRKSDAELTENMDIGNV

📊 Sample Types

Isolate 7.3%
Metagenome 92.7%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 31.8%
Kalotermitidae 31.8%
Unclassified 20.5%
Rhinotermitidae 9.1%
Termopsidae 6.8%

🌳 Taxonomy

Archaea 0
Bacteria 116
Eukaryota 0
Viruses 0
Unclassified 8

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
2 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
3 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
4 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
5 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
6 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
7 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
8 2781125688 Treponema sp. Lab288P4bin13 Isolate Unclassified
9 2781125690 Treponema sp. Th196P3bin63 Isolate Unclassified
10 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
11 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
12 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
13 2781125692 Treponema sp. Th196P3bin31 Isolate Unclassified
14 3300005485 Termite gut microbial communities from Costa Rica - P3 luminal contents Metagenome Termitidae
15 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
16 2781125666 Treponema sp. Emb289P4bin7 Isolate Unclassified
17 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
18 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
19 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
20 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
21 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
22 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
23 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
24 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
25 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
26 2772190978 Treponema sp. Nt197P3bin57 Isolate Unclassified
27 2781125632 Treponema sp. Co191P1bin87 Isolate Unclassified
28 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
29 2781125629 Treponema sp. Nt197P3bin20 Isolate Unclassified
30 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
31 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
32 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
33 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
34 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
35 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
36 2781125630 Treponema sp. Nt197P3bin60 Isolate Unclassified
37 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
38 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
39 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
40 2781125663 Treponema sp. Emb289P3bin135 Isolate Unclassified
41 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
42 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
43 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
44 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
45 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
46 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_384978 3300042612 Bacteria 2318
2 Ga0466708_170404 3300042652 Bacteria 4071
3 Ga0466708_203914 3300042652 Bacteria 12623
4 Ga0466708_368278 3300042652 Bacteria 10878
5 Ga0466705_414422 3300042612 Bacteria 10435
6 Ga0466711_176289 3300042615 Bacteria 15324
7 Ga0466715_202083 3300042616 Unclassified 2349
8 Ga0466726_213819 3300042619 Unclassified 1064
9 Ga0466728_026590 3300042620 Bacteria 1499
10 Ga0466696_472175 3300042596 Bacteria 6488
11 Ga0466719_002643 3300042606 Bacteria 4440
12 Ga0466719_500423 3300042606 Bacteria 1570
13 Ga0466722_060288 3300042609 Bacteria 6715
14 Ga0072940_1368848 3300005200 Unclassified 839
15 Ga0072941_1007276 3300005201 Bacteria 15345
16 Ga0466735_028151 3300042624 Bacteria 4776
17 Ga0466703_103003 3300042636 Bacteria 3965
18 Ga0466704_309770 3300042643 Bacteria 2311
19 Ga0466704_385519 3300042643 Bacteria 14620
20 Ga0466708_134603 3300042652 Bacteria 10617
21 Ga0466708_284234 3300042652 Bacteria 1324
22 Ga0466715_018604 3300042616 Bacteria 5859
23 Ga0466718_020021 3300042617 Bacteria 4635
24 Ga0466718_029019 3300042617 Bacteria 14475
25 Ga0466718_167744 3300042617 Bacteria 22582
26 Ga0466723_371734 3300042618 Bacteria 3825
27 Ga0123356_11295118 3300010049 Unclassified 892
28 Ga0466691_144386 3300042593 Bacteria 3648
29 Ga0466716_233156 3300042605 Bacteria 8465
30 Ga0466720_172233 3300042607 Bacteria 1624
31 Ga0466705_254772 3300042612 Bacteria 5637
32 Ga0466705_323295 3300042612 Bacteria 3123
33 Ga0466703_335018 3300042636 Bacteria 1420
34 Ga0466709_210797 3300042648 Bacteria 29542
35 Ga0466715_044002 3300042616 Bacteria 7442
36 Ga0466726_035423 3300042619 Bacteria 2219
37 Ga0466692_013015 3300042591 Bacteria 22521
38 Ga0466720_014516 3300042607 Bacteria 1480
39 Ga0466722_184391 3300042609 Bacteria 2154
40 JGI24702J35022_10194527 3300002462 Bacteria 1158
41 Ga0466735_005997 3300042624 Bacteria 1650
42 Ga0466735_100953 3300042624 Bacteria 12211
43 Ga0466704_075068 3300042643 Bacteria 5890
44 Ga0466704_151403 3300042643 Bacteria 8410
45 Ga0466704_319704 3300042643 Unclassified 1145
46 Ga0466704_507762 3300042643 Bacteria 3186
47 Ga0466708_126911 3300042652 Bacteria 11037
48 Ga0466711_493444 3300042615 Bacteria 12498
49 Ga0466715_303816 3300042616 Bacteria 14455
50 Ga0466718_094808 3300042617 Bacteria 1666
51 Ga0466729_173628 3300042621 Bacteria 1444
52 Ga0123357_10010866 3300009784 Bacteria 11618
53 Ga0123353_10033662 3300010167 Bacteria 7983
54 Ga0456237_0000442 3300041968 Bacteria 6272
55 Ga0466694_098847 3300042594 Bacteria 2101
56 Ga0466717_255221 3300042604 Bacteria 1162
57 Ga0466720_071777 3300042607 Bacteria 1923
58 Ga0466705_303719 3300042612 Bacteria 2112
59 Ga0466703_037720 3300042636 Bacteria 12133
60 Ga0466703_146267 3300042636 Bacteria 24001
61 Ga0466704_200188 3300042643 Bacteria 9248
62 Ga0466709_102555 3300042648 Bacteria 1553
63 Ga0466712_304386 3300042614 Bacteria 1856
64 Ga0466711_044091 3300042615 Bacteria 1374
65 Ga0466718_032117 3300042617 Bacteria 1128
66 Ga0466718_111890 3300042617 Bacteria 1005
67 Ga0123356_10008342 3300010049 Bacteria 10306
68 Ga0123356_10609100 3300010049 Unclassified 1257
69 Ga0466692_151134 3300042591 Bacteria 11495
70 Ga0466691_155341 3300042593 Bacteria 8143
71 Ga0466716_022043 3300042605 Bacteria 17765
72 Ga0466722_245636 3300042609 Bacteria 10743
73 Ga0466698_363704 3300042610 Bacteria 4711
74 Ga0072941_1007278 3300005201 Bacteria 12191
75 Ga0074263_110625 3300005485 Bacteria 1444
76 Ga0466705_081526 3300042612 Bacteria 18370
77 Ga0466704_436359 3300042643 Bacteria 15554
78 Ga0466727_233815 3300042655 Bacteria 1141
79 Ga0466727_296319 3300042655 Bacteria 5673
80 Ga0466715_316631 3300042616 Bacteria 13080
81 Ga0466723_098518 3300042618 Bacteria 16220
82 Ga0466726_072713 3300042619 Bacteria 32187
83 Ga0466726_369480 3300042619 Bacteria 1802
84 Ga0123357_10010824 3300009784 Bacteria 11640
85 Ga0123353_10610536 3300010167 Bacteria 1556
86 Ga0264413_113909 3300024493 Bacteria 5574
87 Ga0456237_0015470 3300041968 Bacteria 1082
88 Ga0466690_094882 3300042590 Bacteria 3781
89 Ga0466693_303364 3300042592 Bacteria 5038
90 Ga0466691_036248 3300042593 Bacteria 5971
91 Ga0466716_258827 3300042605 Bacteria 6892
92 Ga0466708_118785 3300042652 Bacteria 9449
93 Ga0466715_033365 3300042616 Bacteria 10315
94 Ga0466723_039951 3300042618 Unclassified 5224
95 Ga0466723_272933 3300042618 Bacteria 2079
96 Ga0466692_018590 3300042591 Bacteria 6788
97 Ga0466691_064781 3300042593 Bacteria 7911
98 Ga0466694_043554 3300042594 Bacteria 14346
99 Ga0466719_222229 3300042606 Bacteria 10737
100 Ga0466720_048677 3300042607 Bacteria 2462
101 Ga0072941_1001996 3300005201 Bacteria 50262
102 Ga0466735_235353 3300042624 Bacteria 1693
103 Ga0466703_216231 3300042636 Bacteria 14124
104 Ga0466704_044703 3300042643 Bacteria 12056
105 Ga0466704_108316 3300042643 Bacteria 5905
106 Ga0466708_089882 3300042652 Bacteria 12910
107 Ga0466715_200891 3300042616 Bacteria 1338
108 Ga0123354_10130368 3300010882 Unclassified 3180
109 Ga0456237_0015181 3300041968 Bacteria 1093
110 Ga0466691_025034 3300042593 Bacteria 2820
111 Ga0466691_064907 3300042593 Bacteria 9360
112 Ga0466719_096590 3300042606 Bacteria 13723
113 Ga0466719_263457 3300042606 Bacteria 8892
114 JGI24702J35022_10133421 3300002462 Bacteria 1380
115 Ga0072941_1015195 3300005201 Bacteria 11371

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042593 Ga0466691_144386 Ga0466691_144386_3015_3581 188
2 3300042643 Ga0466704_151403 Ga0466704_151403_2888_3472 194
3 3300042617 Ga0466718_111890 Ga0466718_111890_28_618 196
4 3300042590 Ga0466690_094882 Ga0466690_094882_3037_3636 199
5 3300042643 Ga0466704_309770 Ga0466704_309770_1381_2082 223
6 3300042605 Ga0466716_258827 Ga0466716_258827_5859_6539 226
7 3300002462 JGI24702J35022_10133421 JGI24702J35022_101334212 227
8 3300009784 Ga0123357_10010824 Ga0123357_100108246 227
9 3300042591 Ga0466692_013015 Ga0466692_013015_14267_14950 227
10 3300042591 Ga0466692_018590 Ga0466692_018590_714_1397 227
11 3300042618 Ga0466723_371734 Ga0466723_371734_1264_1965 227
12 iso_pr_bacteria 2781125690 2781428559 227
13 3300042614 Ga0466712_304386 Ga0466712_304386_696_1382 228
14 3300042616 Ga0466715_303816 Ga0466715_303816_7702_8388 228
15 3300042643 Ga0466704_108316 Ga0466704_108316_1527_2213 228
16 iso_pr_bacteria 2781125663 2781338428 228
17 3300005200 Ga0072940_1368848 Ga0072940_13688481 229
18 3300010049 Ga0123356_10008342 Ga0123356_100083424 229
19 3300042596 Ga0466696_472175 Ga0466696_472175_3268_3957 229
20 3300042616 Ga0466715_044002 Ga0466715_044002_1311_2000 229
21 3300042652 Ga0466708_134603 Ga0466708_134603_157_846 229
22 3300005201 Ga0072941_1007278 Ga0072941_10072788 230
23 3300042593 Ga0466691_155341 Ga0466691_155341_6355_7047 230
24 3300042616 Ga0466715_200891 Ga0466715_200891_22_714 230
25 3300042616 Ga0466715_202083 Ga0466715_202083_1030_1722 230
26 3300042636 Ga0466703_103003 Ga0466703_103003_312_1004 230
27 3300042652 Ga0466708_203914 Ga0466708_203914_9666_10358 230
28 3300042655 Ga0466727_233815 Ga0466727_233815_238_930 230
29 3300042609 Ga0466722_184391 Ga0466722_184391_125_820 231
30 3300042616 Ga0466715_033365 Ga0466715_033365_1645_2340 231
31 3300042624 Ga0466735_100953 Ga0466735_100953_8600_9295 231
32 3300010167 Ga0123353_10033662 Ga0123353_100336622 232
33 3300010882 Ga0123354_10130368 Ga0123354_101303682 232
34 3300042610 Ga0466698_363704 Ga0466698_363704_3503_4201 232
35 3300042617 Ga0466718_094808 Ga0466718_094808_354_1052 232
36 3300042619 Ga0466726_035423 Ga0466726_035423_1153_1851 232
37 3300042619 Ga0466726_213819 Ga0466726_213819_324_1022 232
38 3300042643 Ga0466704_507762 Ga0466704_507762_507_1205 232
39 3300042655 Ga0466727_296319 Ga0466727_296319_168_866 232
40 iso_pr_bacteria 2772190978 2773730552 232
41 3300010167 Ga0123353_10610536 Ga0123353_106105362 233
42 3300042606 Ga0466719_222229 Ga0466719_222229_8612_9313 233
43 3300042612 Ga0466705_081526 Ga0466705_081526_7465_8166 233
44 3300042612 Ga0466705_254772 Ga0466705_254772_1319_2020 233
45 3300042612 Ga0466705_323295 Ga0466705_323295_2274_2975 233
46 3300042612 Ga0466705_384978 Ga0466705_384978_1033_1734 233
47 3300042615 Ga0466711_493444 Ga0466711_493444_9111_9812 233
48 3300042616 Ga0466715_018604 Ga0466715_018604_40_741 233
49 3300042616 Ga0466715_316631 Ga0466715_316631_9409_10110 233
50 3300042636 Ga0466703_216231 Ga0466703_216231_5631_6332 233
51 3300042643 Ga0466704_075068 Ga0466704_075068_2873_3574 233
52 3300042643 Ga0466704_436359 Ga0466704_436359_5138_5839 233
53 3300042648 Ga0466709_210797 Ga0466709_210797_8957_9658 233
54 3300042652 Ga0466708_368278 Ga0466708_368278_8241_8942 233
55 iso_pr_bacteria 2781125632 2781272068 233
56 3300024493 Ga0264413_113909 Ga0264413_1139092 234
57 3300041968 Ga0456237_0015181 Ga0456237_0015181_307_1011 234
58 3300042606 Ga0466719_263457 Ga0466719_263457_3366_4070 234
59 3300042606 Ga0466719_500423 Ga0466719_500423_125_829 234
60 3300042607 Ga0466720_071777 Ga0466720_071777_535_1239 234
61 3300042617 Ga0466718_020021 Ga0466718_020021_199_903 234
62 3300042652 Ga0466708_170404 Ga0466708_170404_819_1523 234
63 iso_pr_bacteria 2781125666 2781345831 234
64 iso_pr_bacteria 2781125688 2781424403 234
65 3300005485 Ga0074263_110625 Ga0074263_1106252 235
66 3300009784 Ga0123357_10010866 Ga0123357_100108667 235
67 3300041968 Ga0456237_0015470 Ga0456237_0015470_363_1070 235
68 3300042591 Ga0466692_151134 Ga0466692_151134_7016_7723 235
69 3300042612 Ga0466705_414422 Ga0466705_414422_8865_9572 235
70 3300042619 Ga0466726_072713 Ga0466726_072713_17888_18595 235
71 3300042621 Ga0466729_173628 Ga0466729_173628_351_1058 235
72 3300042624 Ga0466735_235353 Ga0466735_235353_158_898 235
73 3300042593 Ga0466691_036248 Ga0466691_036248_997_1707 236
74 3300042594 Ga0466694_043554 Ga0466694_043554_269_979 236
75 3300042594 Ga0466694_098847 Ga0466694_098847_418_1128 236
76 3300042604 Ga0466717_255221 Ga0466717_255221_40_750 236
77 3300042607 Ga0466720_014516 Ga0466720_014516_225_935 236
78 3300042615 Ga0466711_176289 Ga0466711_176289_5755_6465 236
79 3300042643 Ga0466704_200188 Ga0466704_200188_443_1153 236
80 iso_pr_bacteria 2781125630 2781266740 236
81 3300041968 Ga0456237_0000442 Ga0456237_0000442_3405_4118 237
82 3300042592 Ga0466693_303364 Ga0466693_303364_4178_4891 237
83 3300042612 Ga0466705_303719 Ga0466705_303719_653_1366 237
84 3300042636 Ga0466703_037720 Ga0466703_037720_2214_2927 237
85 3300042643 Ga0466704_319704 Ga0466704_319704_375_1088 237
86 3300042643 Ga0466704_385519 Ga0466704_385519_8753_9466 237
87 3300010049 Ga0123356_11295118 Ga0123356_112951182 238
88 3300042607 Ga0466720_172233 Ga0466720_172233_125_841 238
89 3300042652 Ga0466708_284234 Ga0466708_284234_129_845 238
90 3300010049 Ga0123356_10609100 Ga0123356_106091002 239
91 3300042648 Ga0466709_102555 Ga0466709_102555_573_1292 239
92 3300002462 JGI24702J35022_10194527 JGI24702J35022_101945272 240
93 3300042606 Ga0466719_096590 Ga0466719_096590_9529_10251 240
94 3300042618 Ga0466723_039951 Ga0466723_039951_1444_2166 240
95 3300042618 Ga0466723_098518 Ga0466723_098518_10965_11687 240
96 3300042618 Ga0466723_272933 Ga0466723_272933_674_1396 240
97 3300042636 Ga0466703_146267 Ga0466703_146267_3670_4392 240
98 iso_pr_bacteria 2781125692 2781432481 240
99 3300005201 Ga0072941_1007276 Ga0072941_100727614 241
100 3300042593 Ga0466691_025034 Ga0466691_025034_583_1308 241
101 3300042609 Ga0466722_060288 Ga0466722_060288_3415_4140 241
102 3300042609 Ga0466722_245636 Ga0466722_245636_7344_8069 241
103 3300042615 Ga0466711_044091 Ga0466711_044091_242_967 241
104 3300042624 Ga0466735_005997 Ga0466735_005997_397_1125 242
105 3300042643 Ga0466704_044703 Ga0466704_044703_2658_3386 242
106 3300005201 Ga0072941_1015195 Ga0072941_10151959 243
107 3300042593 Ga0466691_064907 Ga0466691_064907_2376_3107 243
108 3300042605 Ga0466716_022043 Ga0466716_022043_6389_7120 243
109 3300042607 Ga0466720_048677 Ga0466720_048677_948_1679 243
110 3300042624 Ga0466735_028151 Ga0466735_028151_1391_2122 243
111 3300042636 Ga0466703_335018 Ga0466703_335018_523_1254 243
112 3300042593 Ga0466691_064781 Ga0466691_064781_2185_2919 244
113 3300042605 Ga0466716_233156 Ga0466716_233156_1620_2354 244
114 3300005201 Ga0072941_1001996 Ga0072941_10019968 245
115 3300042619 Ga0466726_369480 Ga0466726_369480_365_1102 245
116 3300042617 Ga0466718_032117 Ga0466718_032117_290_1030 246
117 3300042620 Ga0466728_026590 Ga0466728_026590_286_1026 246
118 3300042652 Ga0466708_118785 Ga0466708_118785_115_861 248
119 3300042652 Ga0466708_126911 Ga0466708_126911_3923_4669 248
120 3300042606 Ga0466719_002643 Ga0466719_002643_482_1231 249
121 3300042617 Ga0466718_029019 Ga0466718_029019_6270_7031 253
122 3300042617 Ga0466718_167744 Ga0466718_167744_7423_8187 254
123 3300042652 Ga0466708_089882 Ga0466708_089882_1798_2562 254
124 iso_pr_bacteria 2781125629 2781263867 283

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00814 TsaD tRNA N6-adenosine threonylcarbamoyltransferase 32 131 0.87

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.75 0.86 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.