Protein Family IF11696

Metagenome Isolate
148 Members
48 Samples
140 Scaffolds
263.14 Avg Length

🧬 Representative Sequence

ID
iso_pr_bacteria|2772190889|2773431649|
Length
310 aa
Sequence
MLPVIVVLVFFAVIFVASSIVIIRQYEKGLIETLGKYSGTRSSGPNIIVPIFQRIIRVDMRERVIDVPPQSVITKDNVSVVVDAIIYFQVTDPVKVVYNIENFALAALKLAQTNLRNVIGDMELDSTLTARGKINAQLREVMDEATDKWGVKVTRVEIQKIDPPRDITDSMSKQMKAEREKRANILEAEGLRQAAILKAEGAKQAVILEAEAMKEKQVLEATGQAEAIKKVADAEKYQIEIVYSAIHAGNPTNDLIAVKYLEALGKVADGQATKIFLPLETAGVTASIGGVAELFKDPSKIAKAISADKK

📊 Sample Types

Isolate 5.4%
Metagenome 94.6%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 31.2%
Kalotermitidae 29.2%
Unclassified 22.9%
Termopsidae 8.3%
Rhinotermitidae 6.2%
Hodotermitidae 2.1%

🌳 Taxonomy

Archaea 0
Bacteria 117
Eukaryota 0
Viruses 0
Unclassified 31

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2772190889 Unclassified Elusimicrobia Cu122P5_bin43 Isolate Unclassified
2 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
3 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
4 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
5 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
6 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
7 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
8 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
9 2820950349 Unclassified Acidobacteria Lab288P3bin89 Isolate Unclassified
10 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
11 642555172 Endomicrobium trichonymphae Rs-D17 Isolate Unclassified
12 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
13 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
14 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
15 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
16 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
17 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
18 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
19 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
20 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
21 2772190891 Unclassified Elusimicrobia Emb289P1_bin41 Isolate Unclassified
22 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
23 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
24 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
25 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
26 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
27 2754412482 Unclassified Elusimicrobia Emb289P3bin85 Isolate Unclassified
28 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
29 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
30 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
31 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
32 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
33 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
34 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
35 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
36 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
37 2772190892 Unclassified Elusimicrobia Lab288P3_bin37 Isolate Unclassified
38 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
39 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
40 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
41 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
42 2820044805 Unclassified Proteobacteria Th196P4bin15 Isolate Unclassified
43 2861449170 Desulfovibrio intestinalis DSM 11275 Isolate Unclassified
44 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
45 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
46 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
47 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
48 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466690_377853 3300042590 Bacteria 1217
2 Ga0466691_004916 3300042593 Unclassified 3197
3 JGI24702J35022_10053380 3300002462 Bacteria 2156
4 JGI24696J40584_12930044 3300002834 Bacteria 1463
5 Ga0068305_10000079 3300005083 Bacteria 163717
6 Ga0466706_148071 3300042599 Bacteria 16150
7 Ga0466706_217033 3300042599 Bacteria 132615
8 Ga0466706_254954 3300042599 Bacteria 21529
9 Ga0466707_360682 3300042601 Bacteria 24713
10 Ga0466707_362795 3300042601 Bacteria 8281
11 Ga0466719_127211 3300042606 Bacteria 279481
12 Ga0466711_065300 3300042615 Bacteria 112913
13 Ga0466711_186304 3300042615 Bacteria 8882
14 Ga0466711_192771 3300042615 Unclassified 6371
15 Ga0466728_380833 3300042620 Bacteria 49387
16 Ga0466729_068122 3300042621 Bacteria 10181
17 Ga0466735_047591 3300042624 Unclassified 5634
18 Ga0466704_004355 3300042643 Bacteria 5473
19 Ga0466704_167270 3300042643 Bacteria 32596
20 Ga0123355_10238117 3300009826 Unclassified 2584
21 Ga0123353_10056533 3300010167 Bacteria 6280
22 Ga0466692_093889 3300042591 Bacteria 9334
23 Ga0072940_1080546 3300005200 Bacteria 9882
24 Ga0466706_166478 3300042599 Bacteria 103376
25 Ga0466707_078534 3300042601 Bacteria 53059
26 Ga0466707_308312 3300042601 Bacteria 8470
27 Ga0466707_311805 3300042601 Bacteria 94534
28 Ga0466716_022606 3300042605 Bacteria 12385
29 Ga0466722_177440 3300042609 Bacteria 34429
30 Ga0466705_143986 3300042612 Bacteria 113378
31 Ga0466711_152179 3300042615 Unclassified 19214
32 Ga0466711_427370 3300042615 Bacteria 90157
33 Ga0466715_191600 3300042616 Bacteria 6853
34 Ga0466723_106583 3300042618 Bacteria 10042
35 Ga0466729_009144 3300042621 Bacteria 3660
36 Ga0466703_158285 3300042636 Bacteria 84792
37 Ga0466704_009076 3300042643 Bacteria 2743
38 Ga0466704_440731 3300042643 Unclassified 36701
39 Ga0466709_266294 3300042648 Bacteria 9331
40 Ga0466708_038980 3300042652 Bacteria 16274
41 Ga0123353_10000902 3300010167 Unclassified 36219
42 Ga0466694_236279 3300042594 Bacteria 3046
43 Ga0068302_10020953 3300005071 Unclassified 6953
44 Ga0068305_10000140 3300005083 Bacteria 37543
45 Ga0068305_10000274 3300005083 Bacteria 30353
46 Ga0466713_115381 3300042602 Bacteria 78358
47 Ga0466713_123047 3300042602 Bacteria 2020
48 Ga0466716_342092 3300042605 Bacteria 4769
49 Ga0466719_127487 3300042606 Bacteria 8578
50 Ga0466719_130653 3300042606 Bacteria 158630
51 Ga0466711_408074 3300042615 Bacteria 10359
52 Ga0466723_097650 3300042618 Bacteria 5344
53 Ga0466726_217236 3300042619 Bacteria 220873
54 Ga0466728_427667 3300042620 Bacteria 41368
55 Ga0466729_185786 3300042621 Bacteria 54149
56 Ga0466735_008330 3300042624 Bacteria 38328
57 Ga0466735_131186 3300042624 Bacteria 6907
58 Ga0466727_195812 3300042655 Bacteria 6735
59 JGI24702J35022_10024259 3300002462 Unclassified 3277
60 Ga0068305_10000924 3300005083 Unclassified 65035
61 Ga0466705_382719 3300042612 Bacteria 57295
62 Ga0466711_182012 3300042615 Unclassified 9050
63 Ga0466715_199189 3300042616 Bacteria 10946
64 Ga0466715_318153 3300042616 Unclassified 7026
65 Ga0466718_054877 3300042617 Bacteria 1160
66 Ga0466735_202470 3300042624 Bacteria 8131
67 Ga0466704_013417 3300042643 Unclassified 2346
68 Ga0466708_241765 3300042652 Unclassified 1550
69 Ga0466727_203476 3300042655 Bacteria 22578
70 Ga0466727_298426 3300042655 Bacteria 81478
71 Ga0466690_137309 3300042590 Bacteria 4038
72 Ga0466691_150879 3300042593 Unclassified 4528
73 JGI24702J35022_10005169 3300002462 Unclassified 7656
74 Ga0068302_10008740 3300005071 Bacteria 10277
75 Ga0466706_010205 3300042599 Bacteria 97987
76 Ga0466706_037575 3300042599 Bacteria 87054
77 Ga0466713_099642 3300042602 Bacteria 24894
78 Ga0466714_002903 3300042603 Bacteria 22685
79 Ga0466698_295840 3300042610 Bacteria 3373
80 Ga0466711_511332 3300042615 Bacteria 1214
81 Ga0466728_134295 3300042620 Bacteria 11818
82 Ga0466728_394234 3300042620 Unclassified 14980
83 Ga0466735_003950 3300042624 Unclassified 10110
84 Ga0466735_037671 3300042624 Bacteria 6840
85 Ga0466735_122327 3300042624 Bacteria 18290
86 Ga0466709_405840 3300042648 Bacteria 15583
87 Ga0123353_10292862 3300010167 Unclassified 2491
88 Ga0466690_084823 3300042590 Unclassified 13016
89 Ga0466732_291219 3300042656 Bacteria 9790
90 Ga0466713_056922 3300042602 Bacteria 3443
91 Ga0466719_068744 3300042606 Bacteria 48898
92 Ga0466711_117944 3300042615 Bacteria 215972
93 Ga0466711_214817 3300042615 Unclassified 7899
94 Ga0466715_436492 3300042616 Bacteria 169505
95 Ga0466715_613120 3300042616 Bacteria 1650
96 Ga0466726_010951 3300042619 Bacteria 7533
97 Ga0466729_198612 3300042621 Bacteria 122910
98 Ga0466729_205530 3300042621 Bacteria 1688
99 Ga0466703_395188 3300042636 Bacteria 299836
100 Ga0466704_104849 3300042643 Bacteria 5278
101 Ga0466704_427282 3300042643 Bacteria 1871
102 Ga0466727_271147 3300042655 Bacteria 176023
103 Ga0123357_10012410 3300009784 Bacteria 10993
104 Ga0466690_039786 3300042590 Bacteria 31557
105 Ga0466691_010657 3300042593 Unclassified 5034
106 Ga0466706_152737 3300042599 Bacteria 7283
107 Ga0466722_080002 3300042609 Bacteria 1579
108 Ga0466705_387052 3300042612 Unclassified 29888
109 Ga0466711_448087 3300042615 Bacteria 2672
110 Ga0466715_026286 3300042616 Bacteria 37068
111 Ga0466715_306223 3300042616 Bacteria 28309
112 Ga0466723_000695 3300042618 Unclassified 1898
113 Ga0466723_042388 3300042618 Bacteria 7228
114 Ga0466726_275868 3300042619 Unclassified 2964
115 Ga0466726_284750 3300042619 Unclassified 20964
116 Ga0466726_462755 3300042619 Bacteria 24529
117 Ga0466734_059179 3300042623 Bacteria 2964
118 Ga0466735_001817 3300042624 Bacteria 8959
119 Ga0466702_089902 3300042635 Unclassified 1315
120 Ga0466703_110964 3300042636 Bacteria 165564
121 Ga0466704_021170 3300042643 Unclassified 2343
122 Ga0466708_422468 3300042652 Unclassified 15330
123 Ga0123356_10000069 3300010049 Bacteria 108106
124 Ga0123356_10000716 3300010049 Bacteria 36801
125 Ga0466692_176542 3300042591 Bacteria 2745
126 Ga0466696_377217 3300042596 Unclassified 13142
127 Ga0068305_10020929 3300005083 Bacteria 6121
128 Ga0466707_307607 3300042601 Bacteria 28198
129 Ga0466713_070887 3300042602 Bacteria 102768
130 Ga0466716_545394 3300042605 Bacteria 1136
131 Ga0466705_048392 3300042612 Bacteria 1569
132 Ga0466705_284782 3300042612 Bacteria 31117
133 Ga0466710_025697 3300042613 Bacteria 11764
134 Ga0466715_005134 3300042616 Bacteria 2561
135 Ga0466726_214600 3300042619 Bacteria 58941
136 Ga0466726_218302 3300042619 Bacteria 1681
137 Ga0466729_020210 3300042621 Bacteria 38709
138 Ga0466709_066348 3300042648 Bacteria 39651
139 Ga0466708_347024 3300042652 Bacteria 31983
140 Ga0466727_330892 3300042655 Unclassified 4042

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042656 Ga0466732_291219 Ga0466732_291219_707_1591 218
2 3300042652 Ga0466708_241765 Ga0466708_241765_290_1171 222
3 3300042615 Ga0466711_448087 Ga0466711_448087_708_1646 225
4 3300042617 Ga0466718_054877 Ga0466718_054877_247_1131 226
5 3300002462 JGI24702J35022_10053380 JGI24702J35022_100533801 227
6 3300042643 Ga0466704_013417 Ga0466704_013417_284_1171 231
7 3300042643 Ga0466704_021170 Ga0466704_021170_1025_1912 231
8 3300042652 Ga0466708_038980 Ga0466708_038980_212_1090 232
9 3300010049 Ga0123356_10000069 Ga0123356_100000696 233
10 3300042616 Ga0466715_613120 Ga0466715_613120_126_1013 233
11 3300042618 Ga0466723_000695 Ga0466723_000695_260_1144 233
12 3300042643 Ga0466704_427282 Ga0466704_427282_758_1645 233
13 3300042618 Ga0466723_097650 Ga0466723_097650_3849_4733 234
14 3300042613 Ga0466710_025697 Ga0466710_025697_6207_7151 241
15 3300042612 Ga0466705_284782 Ga0466705_284782_23091_24038 245
16 3300010167 Ga0123353_10056533 Ga0123353_100565334 248
17 3300042623 Ga0466734_059179 Ga0466734_059179_1215_2126 248
18 3300002462 JGI24702J35022_10024259 JGI24702J35022_100242594 249
19 3300005083 Ga0068305_10020929 Ga0068305_100209297 249
20 3300009784 Ga0123357_10012410 Ga0123357_100124105 249
21 3300002462 JGI24702J35022_10005169 JGI24702J35022_100051694 250
22 3300042606 Ga0466719_127487 Ga0466719_127487_5275_6219 250
23 3300042635 Ga0466702_089902 Ga0466702_089902_267_1178 250
24 3300005200 Ga0072940_1080546 Ga0072940_10805467 251
25 3300042594 Ga0466694_236279 Ga0466694_236279_604_1521 251
26 3300042619 Ga0466726_218302 Ga0466726_218302_747_1628 251
27 3300042643 Ga0466704_167270 Ga0466704_167270_27717_28658 251
28 3300002834 JGI24696J40584_12930044 JGI24696J40584_129300442 252
29 3300010167 Ga0123353_10292862 Ga0123353_102928624 252
30 3300042624 Ga0466735_037671 Ga0466735_037671_1172_2053 252
31 3300042652 Ga0466708_422468 Ga0466708_422468_2789_3751 252
32 3300042590 Ga0466690_084823 Ga0466690_084823_8386_9318 253
33 3300042599 Ga0466706_010205 Ga0466706_010205_58884_59759 253
34 3300042610 Ga0466698_295840 Ga0466698_295840_1251_2195 253
35 3300042616 Ga0466715_191600 Ga0466715_191600_892_1827 253
36 3300042620 Ga0466728_394234 Ga0466728_394234_3451_4368 253
37 3300042648 Ga0466709_405840 Ga0466709_405840_1801_2745 253
38 3300042616 Ga0466715_005134 Ga0466715_005134_24_968 254
39 3300042591 Ga0466692_093889 Ga0466692_093889_6935_7879 255
40 3300042599 Ga0466706_166478 Ga0466706_166478_24230_25129 255
41 3300042616 Ga0466715_306223 Ga0466715_306223_22242_23174 255
42 3300042619 Ga0466726_217236 Ga0466726_217236_20803_21723 255
43 3300042621 Ga0466729_068122 Ga0466729_068122_2971_3897 255
44 3300042624 Ga0466735_202470 Ga0466735_202470_3316_4236 255
45 3300042643 Ga0466704_104849 Ga0466704_104849_3246_4166 255
46 3300042601 Ga0466707_362795 Ga0466707_362795_6083_7030 256
47 3300042620 Ga0466728_427667 Ga0466728_427667_16309_17217 256
48 3300042599 Ga0466706_152737 Ga0466706_152737_3356_4258 257
49 3300042599 Ga0466706_217033 Ga0466706_217033_51435_52331 257
50 3300042605 Ga0466716_545394 Ga0466716_545394_154_1107 257
51 3300042615 Ga0466711_511332 Ga0466711_511332_256_1179 257
52 3300042620 Ga0466728_380833 Ga0466728_380833_1491_2423 257
53 3300042599 Ga0466706_148071 Ga0466706_148071_2852_3751 258
54 3300042621 Ga0466729_009144 Ga0466729_009144_2616_3557 258
55 3300042621 Ga0466729_185786 Ga0466729_185786_42925_43845 258
56 3300042643 Ga0466704_440731 Ga0466704_440731_32281_33213 258
57 3300042648 Ga0466709_066348 Ga0466709_066348_35068_36003 258
58 3300042655 Ga0466727_195812 Ga0466727_195812_733_1635 258
59 3300042609 Ga0466722_080002 Ga0466722_080002_482_1426 259
60 3300005071 Ga0068302_10020953 Ga0068302_100209532 260
61 3300042593 Ga0466691_150879 Ga0466691_150879_3355_4296 260
62 3300042618 Ga0466723_106583 Ga0466723_106583_7143_8051 260
63 3300005071 Ga0068302_10008740 Ga0068302_100087402 261
64 3300042602 Ga0466713_115381 Ga0466713_115381_65540_66481 261
65 3300042655 Ga0466727_271147 Ga0466727_271147_86661_87566 261
66 3300005083 Ga0068305_10000274 Ga0068305_1000027415 262
67 3300042612 Ga0466705_387052 Ga0466705_387052_16829_17791 262
68 3300042615 Ga0466711_214817 Ga0466711_214817_2580_3524 262
69 3300042624 Ga0466735_131186 Ga0466735_131186_1578_2498 262
70 3300042652 Ga0466708_347024 Ga0466708_347024_518_1462 262
71 3300042655 Ga0466727_203476 Ga0466727_203476_21656_22561 262
72 3300042606 Ga0466719_127211 Ga0466719_127211_270095_271009 263
73 3300042612 Ga0466705_143986 Ga0466705_143986_96113_97054 263
74 3300042619 Ga0466726_284750 Ga0466726_284750_8750_9670 263
75 3300042624 Ga0466735_001817 Ga0466735_001817_2559_3479 263
76 3300042624 Ga0466735_003950 Ga0466735_003950_5264_6184 263
77 3300042624 Ga0466735_122327 Ga0466735_122327_14302_15222 263
78 3300042655 Ga0466727_298426 Ga0466727_298426_16402_17322 263
79 3300042599 Ga0466706_037575 Ga0466706_037575_49032_49955 264
80 3300042601 Ga0466707_360682 Ga0466707_360682_10753_11709 264
81 3300042603 Ga0466714_002903 Ga0466714_002903_1764_2684 264
82 3300042615 Ga0466711_408074 Ga0466711_408074_1988_2932 264
83 3300042619 Ga0466726_214600 Ga0466726_214600_51889_52848 264
84 3300042624 Ga0466735_008330 Ga0466735_008330_29110_30030 264
85 3300042655 Ga0466727_330892 Ga0466727_330892_1607_2566 264
86 3300042612 Ga0466705_382719 Ga0466705_382719_11427_12386 265
87 3300042615 Ga0466711_065300 Ga0466711_065300_32635_33594 265
88 3300042621 Ga0466729_020210 Ga0466729_020210_13482_14408 265
89 3300042615 Ga0466711_182012 Ga0466711_182012_5079_5996 266
90 3300042619 Ga0466726_462755 Ga0466726_462755_23044_23970 266
91 3300042636 Ga0466703_395188 Ga0466703_395188_148037_148990 266
92 3300009826 Ga0123355_10238117 Ga0123355_102381172 267
93 3300010167 Ga0123353_10000902 Ga0123353_1000090216 267
94 3300042590 Ga0466690_137309 Ga0466690_137309_1553_2485 267
95 3300042621 Ga0466729_205530 Ga0466729_205530_149_1081 267
96 3300042636 Ga0466703_110964 Ga0466703_110964_84779_85732 267
97 3300005083 Ga0068305_10000140 Ga0068305_1000014019 268
98 3300042590 Ga0466690_039786 Ga0466690_039786_25075_26010 268
99 3300042601 Ga0466707_078534 Ga0466707_078534_31099_32034 268
100 3300042601 Ga0466707_307607 Ga0466707_307607_21952_22884 268
101 3300042601 Ga0466707_308312 Ga0466707_308312_3777_4709 268
102 3300042602 Ga0466713_056922 Ga0466713_056922_1902_2870 268
103 3300042602 Ga0466713_070887 Ga0466713_070887_78714_79643 268
104 3300042616 Ga0466715_318153 Ga0466715_318153_2710_3642 268
105 3300042618 Ga0466723_042388 Ga0466723_042388_2905_3837 268
106 3300042636 Ga0466703_158285 Ga0466703_158285_63655_64587 268
107 3300005083 Ga0068305_10000079 Ga0068305_1000007999 269
108 3300042590 Ga0466690_377853 Ga0466690_377853_157_1092 269
109 3300042599 Ga0466706_254954 Ga0466706_254954_10502_11437 269
110 3300042615 Ga0466711_117944 Ga0466711_117944_179264_180190 269
111 3300042615 Ga0466711_192771 Ga0466711_192771_2368_3318 269
112 3300042615 Ga0466711_427370 Ga0466711_427370_35693_36631 269
113 3300042624 Ga0466735_047591 Ga0466735_047591_1072_2010 269
114 3300042606 Ga0466719_130653 Ga0466719_130653_81358_82296 270
115 3300042616 Ga0466715_436492 Ga0466715_436492_85495_86436 270
116 3300042593 Ga0466691_004916 Ga0466691_004916_1640_2611 271
117 3300042615 Ga0466711_186304 Ga0466711_186304_4987_5919 271
118 3300042616 Ga0466715_026286 Ga0466715_026286_29609_30544 272
119 3300042593 Ga0466691_010657 Ga0466691_010657_3499_4449 273
120 3300042596 Ga0466696_377217 Ga0466696_377217_1148_2101 273
121 3300042643 Ga0466704_009076 Ga0466704_009076_463_1425 273
122 3300005083 Ga0068305_10000924 Ga0068305_1000092453 274
123 3300042619 Ga0466726_275868 Ga0466726_275868_699_1679 275
124 3300042606 Ga0466719_068744 Ga0466719_068744_46243_47202 276
125 3300042612 Ga0466705_048392 Ga0466705_048392_183_1142 276
126 3300042615 Ga0466711_152179 Ga0466711_152179_7916_8875 276
127 3300042621 Ga0466729_198612 Ga0466729_198612_6160_7104 277
128 3300042602 Ga0466713_099642 Ga0466713_099642_19086_20033 278
129 3300042605 Ga0466716_022606 Ga0466716_022606_1878_2828 278
130 3300042620 Ga0466728_134295 Ga0466728_134295_6767_7735 279
131 3300042605 Ga0466716_342092 Ga0466716_342092_2361_3323 282
132 3300042619 Ga0466726_010951 Ga0466726_010951_5792_6772 282
133 3300042643 Ga0466704_004355 Ga0466704_004355_3043_4020 282
134 3300042648 Ga0466709_266294 Ga0466709_266294_3456_4418 282
135 3300042601 Ga0466707_311805 Ga0466707_311805_13225_14217 287
136 3300042609 Ga0466722_177440 Ga0466722_177440_3642_4604 288
137 3300042616 Ga0466715_199189 Ga0466715_199189_159_1121 288
138 3300042591 Ga0466692_176542 Ga0466692_176542_1425_2387 289
139 3300042602 Ga0466713_123047 Ga0466713_123047_353_1303 289
140 iso_pr_bacteria 2820044805 2820045567 303
141 iso_pr_bacteria 2820950349 2820950428 303
142 3300010049 Ga0123356_10000716 Ga0123356_100007168 305
143 iso_pr_bacteria 642555172 642791229 306
144 iso_pr_bacteria 2772190892 2773436371 308
145 iso_pr_bacteria 2754412482 2755216094 309
146 iso_pr_bacteria 2772190891 2773435144 309
147 iso_pr_bacteria 2772190889 2773431649 310
148 iso_pr_bacteria 2861449170 2861451353 315

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01145 Band_7 SPFH domain / Band 7 family 22 190 0.98

🏗️ Structural Annotation – Top 5 Hits

IDDescriptionScoreStartEnd
8gn9-assembly1.cif.gz_A-2 SPFH domain of Pyrococcus horikoshii stomatin 0.973 61 164
4fvj-assembly2.cif.gz_B SPFH domain of the mouse stomatin (Crystal form 2) 0.944 56 165
3bk6-assembly1.cif.gz_B Crystal structure of a core domain of stomatin from Pyrococcus horikoshii 0.942 58 190
3bk6-assembly1.cif.gz_C Crystal structure of a core domain of stomatin from Pyrococcus horikoshii 0.904 56 203
3bk6-assembly1.cif.gz_A Crystal structure of a core domain of stomatin from Pyrococcus horikoshii 0.881 58 203
IDDescriptionScoreStartEndSuperfamily
af_Q8T4B6_101_212_3.30.479.30 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;Band 7 domain 0.9908 58 164 3.30.479.30
af_A0A1D8PTU3_111_221_3.30.479.30 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;Band 7 domain 0.9889 56 164 3.30.479.30
af_F1R5A4_90_200_3.30.479.30 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;Band 7 domain 0.9878 56 165 3.30.479.30
af_P0AA53_46_178_3.30.479.30 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;Band 7 domain 0.9845 46 176 3.30.479.30
af_Q9VGD7_116_226_3.30.479.30 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;Band 7 domain 0.9839 56 164 3.30.479.30
IDDescriptionScoreStartEndGO Terms
AF-A0A433VJH7-F1-model_v4 Band 7 domain-containing protein 0.9832 58 172 GO:0005886
GO:0098552
AF-A0A3M7DRY2-F1-model_v4 Band 7 domain-containing protein 0.9803 19 153 GO:0005739
GO:0005886
GO:0098552
GO:0007005

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.53 0.72 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.