Protein Family IF11386

Metagenome Isolate
212 Members
149 Samples
123 Scaffolds
330.65 Avg Length

🧬 Representative Sequence

ID
iso_pr_bacteria|2724678956|2724788701|
Length
362 aa
Sequence
MDAAKEPAKDASSSQPQVASPEAGSSQAVEAHKPAPNMPQFTRAEDLHAYHEMLLIRRFEEKAGQLYGMGLIGGFCHLYIGQEAVVIGMQMASIDGDQVITGYRDHGHMLACGMDPKGVMAELTGRRGGYSRGKGGSMHMFSREKQFFGGHGIVGAQVSLGTGLAFADHYRENGKVSLTYMGDGAANQGQVYESFNMAALWKLPVVYVIENNRYAMGTSVARASAQTDFSKRGISFGIPGEQVDGMDVRTVREAAARAVEHARSGQGPYILEMQTYRYRGHSMSDPAKYRTKDEVSKMRDEHDPIEMVRKRLIELHGVPEAEIKATDAKVRETVNAAAEFATNDPEPDPAELWTDILLDAHA

📊 Sample Types

Isolate 42.0%
Metagenome 58.0%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Drosophilidae 25.9%
Unclassified 15.0%
Termitidae 10.9%
Kalotermitidae 9.5%
Apidae 8.2%
Formicidae 8.2%
Elmidae 4.8%
Blattidae 3.4%
Armadillidiidae 2.7%
Culicidae 2.7%
Rhinotermitidae 2.0%
Termopsidae 2.0%
Nephropidae 1.4%
Ixodidae 1.4%
Tenebrionidae 0.7%
Muscidae 0.7%
Ceratopogonidae 0.7%

🌳 Taxonomy

Archaea 0
Bacteria 201
Eukaryota 0
Viruses 0
Unclassified 11

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2744054723 Ehrlichia ruminantium Palm River Isolate Unclassified
2 2806310572 Pukyongiella litopenaei SH-1 Isolate Unclassified
3 2828301124 Sphingomonas leidyi DSM 4733 Isolate Unclassified
4 2834165886 Saccharibacter sp. M18 Isolate Apidae
5 2835143510 Yoonia maritima YPC211 Isolate Nephropidae
6 2854576727 Acetobacter okinawensis DsW_060 Isolate Drosophilidae
7 2858089842 Acetobacter tropicalis DmW_042 Isolate Drosophilidae
8 2858110640 Acetobacter indonesiensis DmL_051 Isolate Drosophilidae
9 2901819457 Bombella sp. ESL0385 Isolate Apidae
10 2940264388 Lachnospiraceae bacterium PFB1-17 Isolate Blattidae
11 2940267548 Lachnospiraceae bacterium PFB1-22 Isolate Blattidae
12 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
13 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
14 3300056564 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) Metagenome Tenebrionidae
15 8067579126 Gluconobacter kondonii Dm-16 Isolate Drosophilidae
16 8067581993 Gluconobacter kondonii Dm-54 Isolate Drosophilidae
17 8067598439 Gluconobacter wancherniae Dm-17 Isolate Drosophilidae
18 650716015 Candidatus Midichloria mitochondrii IricVA Isolate Ixodidae
19 3300002931 Ant worker gut metagenome for colony PL010 Metagenome Formicidae
20 3300002934 Ant worker gut metagenome for colony PL005 Metagenome Formicidae
21 3300007052 Ant gut microbial communities from Cephalotes eduarduli, Brazil Metagenome Formicidae
22 3300007190 Ant gut microbial communities from Cephalotes umbraculatus, Peru Metagenome Formicidae
23 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
24 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
25 3300012829 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG Metagenome Armadillidiidae
26 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
27 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
28 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
29 2711768164 Tritonibacter mobilis S1942 Isolate Unclassified
30 2816332478 Acetobacter tropicalis BDGP1 Isolate Drosophilidae
31 2816332545 Tritonibacter mobilis S1923 Isolate Unclassified
32 2820146621 Unclassified Proteobacteria Emb289P3bin103 Isolate Unclassified
33 2843864159 Acetobacter pomorum SH Isolate Drosophilidae
34 2854540230 Acetobacter sp. DsW_063 Isolate Drosophilidae
35 2864951976 Brevundimonas bullata S00223 Isolate Elmidae
36 2868677537 Acetobacter orientalis DsW_061 Isolate Drosophilidae
37 2920412021 Bombella sp. ESL0387 Isolate Apidae
38 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
39 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
40 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
41 651324000 Acetobacter pomorum DM001 Isolate Drosophilidae
42 8067588748 Gluconobacter kondonii Dm-42 Isolate Drosophilidae
43 8074809037 Bombella apis MRM1 Isolate Apidae
44 639279308 Ehrlichia ruminantium Welgevonden, ARC-OVI Isolate Unclassified
45 3002394112 Gluconobacter sp. Gdi Isolate Drosophilidae
46 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
47 3300028918 Ant gut bacterial community from Dolichoderus sp. 2-PL2018, Madre de Dios, Puerto Maldonado, Peru - colony JSC085 Metagenome Formicidae
48 3300029810 Ant gut bacterial community from Dolichoderus sp. 4-PL2018, Madre de Dios, Puerto Maldonado, Peru - colony JSC189 Metagenome Formicidae
49 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
50 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
51 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
52 2816332503 Tritonibacter mobilis S1611 Isolate Unclassified
53 2854548700 Acetobacter persici DmL_053 Isolate Drosophilidae
54 2868683769 Acetobacter sp. DmW_043 Isolate Drosophilidae
55 2873468275 Agrobacterium vitis S00131 Isolate Elmidae
56 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
57 8074810961 Bombella apis SME1 Isolate Apidae
58 8100534375 Gluconobacter sp. Dm-74 Isolate Drosophilidae
59 3300012846 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG Metagenome Armadillidiidae
60 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
61 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
62 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
63 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
64 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
65 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
66 2791354941 Bombella intestini R-52487 Isolate Unclassified
67 2820234266 Unclassified Firmicutes Th196P3bin99 Isolate Unclassified
68 2834038347 Gluconobacter sp. DsW_058 Isolate Drosophilidae
69 2858084324 Acetobacter sp. DsW_54 Isolate Drosophilidae
70 2858119979 Acetobacter malorum DsW_057 Isolate Drosophilidae
71 2864955722 Sphingomonas kyeonggiensis S00224 Isolate Elmidae
72 2940273867 Lachnoclostridium sp. PH1-16 Isolate Blattidae
73 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
74 8067604290 Gluconobacter wancherniae Dm-19 Isolate Drosophilidae
75 8067607133 Gluconobacter wancherniae Dm-15 Isolate Drosophilidae
76 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
77 3300007129 Ant gut microbial communities from Cephalotes atratus, Brazil Metagenome Formicidae
78 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
79 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
80 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
81 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
82 2617271320 Acetobacter pomorum DmCS_004 Isolate Drosophilidae
83 2724678956 Methylobacterium sp. GXS13 Isolate Unclassified
84 2839192570 Gluconobacter sp. DsW_056 Isolate Drosophilidae
85 2839785767 Thalassobius sp. I31.1 Isolate Nephropidae
86 2854518031 Acetobacter indonesiensis DmW_046 Isolate Drosophilidae
87 3300002938 Larval gut metagenome for colony PL005 Metagenome Formicidae
88 3300029809 Ant gut bacterial community from Dolichoderus sp. 3-PL2018, Madre de Dios, Puerto Maldonado, Peru - colony JSC188 Metagenome Formicidae
89 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
90 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
91 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
92 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
93 2718218026 Phaeobacter porticola P97 Isolate Unclassified
94 2751185679 Parasaccharibacter apium G7_7_3c Isolate Apidae
95 2820501819 Unclassified Firmicutes Lab288P1bin51 Isolate Unclassified
96 2831736028 Parasaccharibacter apium A29 Isolate Apidae
97 2834852038 Acetobacter cibinongensis DsW_47 Isolate Drosophilidae
98 2841330038 Sulfitobacter sp. D7 Isolate
99 2858105562 Acetobacter sp. DsW_059 Isolate Drosophilidae
100 2864934081 Brevundimonas vesicularis S00192 Isolate Elmidae
101 2864993140 Agrobacterium vitis S00303 Isolate Elmidae
102 2900132049 Bartonella massiliensis OS09 Isolate Unclassified
103 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
104 8067483258 Ochrobactrum soli MTP-C0764 Isolate Muscidae
105 8067585538 Gluconobacter kondonii Dm-68 Isolate Drosophilidae
106 8074812948 Bombella apis MRM1 Isolate Apidae
107 3002401049 Gluconobacter sp. Dm-62 Isolate Drosophilidae
108 3300007067 Ant gut microbial communities from Cephalotes spinosus, Peru Metagenome Formicidae
109 3300007763 Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 5 gut Metagenome Drosophilidae
110 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
111 3300012820 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E6 MG Metagenome Armadillidiidae
112 3300012845 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG Metagenome Culicidae
113 2619619079 Sphingomonas sp. Mn802worker Isolate Termitidae
114 2681813507 Insolitispirillum peregrinum integrum DSM 11589 Isolate Unclassified
115 2786546124 Acetobacter sp. JWB Isolate Drosophilidae
116 2585427698 Occidentia massiliensis OS118 Isolate Unclassified
117 2854520951 Acetobacter pasteurianus AD Isolate Unclassified
118 2854536247 Acetobacter senegalensis DmL_050 Isolate Drosophilidae
119 2858102877 Acetobacter orientalis DmW_048 Isolate Drosophilidae
120 2858129007 Acetobacter orientalis DmW_045 Isolate Drosophilidae
121 2864866972 Brevundimonas bullata S00123 Isolate Elmidae
122 2940270707 Lachnoclostridium sp. PF1-13 Isolate Blattidae
123 8067591850 Gluconobacter kondonii Dm-47 Isolate Drosophilidae
124 8100528075 Gluconobacter sp. Dm-44 Isolate Drosophilidae
125 639279309 Ehrlichia ruminantium Welgevonden, CIRAD Isolate Unclassified
126 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
127 3300012812 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E11 MG Metagenome Culicidae
128 3300012819 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG Metagenome Armadillidiidae
129 3300028910 Ant gut bacterial community from Dolichoderus sp. 1-PL2018, Madre de Dios, Puerto Maldonado, Peru - colony JSC161 Metagenome Formicidae
130 2556921622 Terasakiella pusilla DSM 6293 Isolate Unclassified
131 2597490292 Acetobacter malorum DmCS_005 Isolate Drosophilidae
132 2599185121 Rickettsiales bacterium Ac37b Isolate Ixodidae
133 2834143536 Parasaccharibacter apium AS1 Isolate Apidae
134 2834160066 Parasaccharibacter apium B8 Isolate Apidae
135 2834764525 Rickettsia endosymbiont of Culicoides newsteadi RiCNE Isolate Ceratopogonidae
136 2841175817 Komagataeibacter saccharivorans JH1 Isolate Unclassified
137 2864976888 Novosphingobium chloroacetimidivorans S00245 Isolate Elmidae
138 2899194184 Bombella sp. ESL0378 Isolate Apidae
139 2920413932 Bombella sp. ESL0380 Isolate Apidae
140 2940228231 Anaerovoracaceae bacterium PM5-7 Isolate Blattidae
141 8067594896 Gluconobacter kondonii Dm-18 Isolate Drosophilidae
142 8100531325 Gluconobacter sp. Dm-73 Isolate Drosophilidae
143 3300007188 Ant gut microbial communities from Cephalotes rohweri, Arizona, USA Metagenome Formicidae
144 3300009460 Microbial communities of aphids from Pistacia texana in Langtry, TX, USA - Geopemphigus sp. seqcov Metagenome
145 3300012831 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG Metagenome Culicidae
146 3300012835 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG Metagenome Culicidae
147 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
148 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
149 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_238066 3300042612 Bacteria 6903
2 CVPL010W_10000046 3300002931 Bacteria 72984
3 Ga0127649_101174 3300009460 Bacteria 51970
4 Ga0466719_231803 3300042606 Bacteria 3094
5 Ga0466705_417361 3300042612 Unclassified 38581
6 Ga0466711_059535 3300042615 Bacteria 20049
7 Ga0123357_10220084 3300009784 Bacteria 2108
8 Ga0123353_10703606 3300010167 Bacteria 1417
9 Ga0466709_361306 3300042648 Bacteria 1414
10 Ga0466705_272892 3300042612 Bacteria 10606
11 CVPL005W_1000081 3300002934 Bacteria 37014
12 Ga0103264_1000520 3300007188 Bacteria 20031
13 Ga0466713_117051 3300042602 Bacteria 14825
14 Ga0466714_097452 3300042603 Bacteria 3109
15 Ga0466717_248157 3300042604 Unclassified 1534
16 Ga0466698_221064 3300042610 Bacteria 12363
17 Ga0466715_114127 3300042616 Bacteria 3796
18 Ga0466726_091773 3300042619 Bacteria 15612
19 Ga0466726_287379 3300042619 Bacteria 3124
20 Ga0160467_100492 3300012829 Bacteria 38180
21 Ga0466692_142749 3300042591 Bacteria 3759
22 Ga0123356_10353887 3300010049 Bacteria 1593
23 Ga0123356_10355176 3300010049 Bacteria 1591
24 Ga0466734_030990 3300042623 Bacteria 1721
25 Ga0068302_10127949 3300005071 Bacteria 3067
26 Ga0102736_1005516 3300007052 Bacteria 1612
27 Ga0466707_352343 3300042601 Bacteria 2786
28 Ga0466711_517693 3300042615 Bacteria 10474
29 Ga0466715_029280 3300042616 Bacteria 24753
30 Ga0466723_297882 3300042618 Bacteria 1511
31 Ga0466728_157307 3300042620 Unclassified 5910
32 Ga0466728_427273 3300042620 Bacteria 5706
33 Ga0160456_100004 3300012820 Bacteria 631412
34 Ga0160433_100593 3300012846 Bacteria 15221
35 Ga0415639_018703 3300038395 Bacteria 3914
36 Ga0123355_10002885 3300009826 Bacteria 24415
37 Ga0123356_10038234 3300010049 Unclassified 4472
38 Ga0123356_10043012 3300010049 Bacteria 4206
39 Ga0466703_105310 3300042636 Bacteria 64560
40 Ga0466704_136556 3300042643 Bacteria 3834
41 Ga0466704_415171 3300042643 Bacteria 1335
42 Ga0466708_079679 3300042652 Bacteria 41277
43 JGI24705J35276_12237491 3300002504 Bacteria 11388
44 CVPL005L_10000001 3300002938 Bacteria 447235
45 Ga0103266_1000028 3300007067 Bacteria 136279
46 Ga0466723_002252 3300042618 Bacteria 12443
47 Ga0466692_133650 3300042591 Bacteria 13235
48 Ga0466691_005964 3300042593 Bacteria 10019
49 Ga0466696_078936 3300042596 Bacteria 4903
50 Ga0123356_10004876 3300010049 Unclassified 13788
51 Ga0123356_10005398 3300010049 Bacteria 13016
52 Ga0123356_10314038 3300010049 Bacteria 1678
53 Ga0123353_10171169 3300010167 Bacteria 3447
54 Ga0466708_102826 3300042652 Bacteria 39124
55 CVPL005W_1001957 3300002934 Bacteria 4597
56 Ga0102734_1001334 3300007129 Bacteria 18976
57 Ga0466722_053869 3300042609 Bacteria 40279
58 Ga0466710_034360 3300042613 Bacteria 1265
59 Ga0466723_221067 3300042618 Bacteria 2567
60 Ga0466726_035068 3300042619 Bacteria 1397
61 Ga0466729_162357 3300042621 Bacteria 1539
62 Ga0160446_100112 3300012835 Bacteria 73516
63 Ga0160460_100177 3300012845 Bacteria 70489
64 Ga0466691_203768 3300042593 Bacteria 6908
65 Ga0466696_336295 3300042596 Unclassified 2118
66 Ga0466696_346773 3300042596 Bacteria 16510
67 Ga0160471_100007 3300012812 Bacteria 543831
68 Ga0466734_097317 3300042623 Bacteria 1382
69 Ga0466703_400865 3300042636 Bacteria 9966
70 Ga0466727_259305 3300042655 Bacteria 1271
71 Ga0466697_184761 3300042611 Bacteria 2180
72 Ga0466705_172593 3300042612 Unclassified 4147
73 Ga0466705_262384 3300042612 Bacteria 13428
74 Ga0530661_000807 3300056564 Bacteria 19847
75 CVPL010W_10010189 3300002931 Bacteria 8236
76 Ga0466707_303768 3300042601 Bacteria 21084
77 Ga0160433_100004 3300012846 Bacteria 543746
78 Ga0309901_1000013 3300028918 Bacteria 346588
79 Ga0309904_1000016 3300029810 Bacteria 70698
80 Ga0466657_043659 3300042582 Unclassified 3645
81 Ga0466657_165439 3300042582 Bacteria 6043
82 Ga0466690_012460 3300042590 Bacteria 15225
83 Ga0123353_10446041 3300010167 Bacteria 1907
84 Ga0466734_141634 3300042623 Bacteria 54922
85 Ga0466703_288938 3300042636 Bacteria 16390
86 Ga0466704_130376 3300042643 Bacteria 60549
87 Ga0466725_370409 3300042654 Bacteria 1312
88 Ga0102736_1016141 3300007052 Bacteria 1455
89 Ga0105004_1026207 3300007763 Bacteria 2385
90 Ga0466700_025103 3300042600 Unclassified 14818
91 Ga0466700_398659 3300042600 Bacteria 2267
92 Ga0466717_011898 3300042604 Bacteria 3188
93 Ga0309902_000001 3300028910 Bacteria 348555
94 Ga0309903_100005 3300029809 Bacteria 95692
95 Ga0415639_094185 3300038395 Bacteria 2457
96 Ga0123355_10435328 3300009826 Bacteria 1665
97 Ga0123356_10011207 3300010049 Bacteria 8754
98 Ga0123356_10085909 3300010049 Unclassified 2985
99 Ga0123356_10409095 3300010049 Bacteria 1496
100 Ga0123353_10341683 3300010167 Bacteria 2261
101 Ga0123353_10651536 3300010167 Unclassified 1491
102 Ga0466734_015083 3300042623 Bacteria 2840
103 Ga0466725_260301 3300042654 Bacteria 1640
104 Ga0466705_019481 3300042612 Bacteria 57905
105 Ga0466705_170954 3300042612 Bacteria 1596
106 JGI24705J35276_12238790 3300002504 Bacteria 69628
107 CVPL010W_10000242 3300002931 Bacteria 51431
108 Ga0103264_1001271 3300007188 Bacteria 17688
109 Ga0103267_1000011 3300007190 Bacteria 88011
110 Ga0466716_409557 3300042605 Bacteria 2246
111 Ga0466719_515297 3300042606 Bacteria 4890
112 Ga0466722_020859 3300042609 Bacteria 10979
113 Ga0466726_392206 3300042619 Bacteria 32327
114 Ga0160468_100001 3300012819 Bacteria 1115787
115 Ga0160459_100464 3300012831 Bacteria 15940
116 Ga0123356_10060404 3300010049 Bacteria 3537
117 Ga0123353_10047725 3300010167 Bacteria 6813
118 Ga0123353_10610755 3300010167 Bacteria 1556
119 Ga0466704_028795 3300042643 Bacteria 1465
120 Ga0466704_564361 3300042643 Bacteria 4457
121 Ga0466708_064335 3300042652 Bacteria 39210
122 Ga0466725_194965 3300042654 Bacteria 3141
123 Ga0466725_382118 3300042654 Bacteria 3721

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042612 Ga0466705_262384 Ga0466705_262384_11784_12737 285
2 3300042621 Ga0466729_162357 Ga0466729_162357_265_1251 287
3 3300042616 Ga0466715_114127 Ga0466715_114127_2232_3149 289
4 3300009826 Ga0123355_10435328 Ga0123355_104353282 294
5 3300007052 Ga0102736_1016141 Ga0102736_10161412 300
6 3300042636 Ga0466703_288938 Ga0466703_288938_9058_10032 305
7 3300042613 Ga0466710_034360 Ga0466710_034360_293_1213 306
8 3300042643 Ga0466704_136556 Ga0466704_136556_1399_2322 307
9 3300042618 Ga0466723_002252 Ga0466723_002252_9955_10926 308
10 3300010049 Ga0123356_10409095 Ga0123356_104090952 309
11 3300042612 Ga0466705_417361 Ga0466705_417361_10470_11399 309
12 3300042596 Ga0466696_336295 Ga0466696_336295_1087_2022 311
13 3300042601 Ga0466707_303768 Ga0466707_303768_12957_13931 311
14 3300042619 Ga0466726_035068 Ga0466726_035068_16_951 311
15 3300042612 Ga0466705_238066 Ga0466705_238066_2681_3664 312
16 3300010049 Ga0123356_10011207 Ga0123356_100112077 315
17 3300010049 Ga0123356_10043012 Ga0123356_100430122 315
18 3300010049 Ga0123356_10060404 Ga0123356_100604043 315
19 3300010167 Ga0123353_10047725 Ga0123353_100477253 315
20 3300010167 Ga0123353_10171169 Ga0123353_101711692 315
21 3300010167 Ga0123353_10610755 Ga0123353_106107552 315
22 3300010167 Ga0123353_10703606 Ga0123353_107036061 315
23 3300042593 Ga0466691_005964 Ga0466691_005964_4303_5253 316
24 3300042615 Ga0466711_517693 Ga0466711_517693_4941_5891 316
25 3300042618 Ga0466723_297882 Ga0466723_297882_297_1247 316
26 3300042652 Ga0466708_064335 Ga0466708_064335_9144_10094 316
27 3300042655 Ga0466727_259305 Ga0466727_259305_112_1062 316
28 3300012835 Ga0160446_100112 Ga0160446_10011272 317
29 3300042612 Ga0466705_170954 Ga0466705_170954_121_1074 317
30 3300042643 Ga0466704_415171 Ga0466704_415171_344_1297 317
31 3300042643 Ga0466704_564361 Ga0466704_564361_2252_3205 317
32 3300042605 Ga0466716_409557 Ga0466716_409557_669_1625 318
33 3300042609 Ga0466722_053869 Ga0466722_053869_27223_28179 318
34 3300042616 Ga0466715_029280 Ga0466715_029280_19919_20875 318
35 3300042636 Ga0466703_400865 Ga0466703_400865_6118_7074 318
36 iso_pr_bacteria 2940264388 2940266566 318
37 iso_pr_bacteria 2940267548 2940269645 318
38 iso_pr_bacteria 2940270707 2940272884 318
39 iso_pr_bacteria 2940273867 2940275969 318
40 3300012831 Ga0160459_100464 Ga0160459_10046413 319
41 3300042590 Ga0466690_012460 Ga0466690_012460_8575_9534 319
42 3300042591 Ga0466692_142749 Ga0466692_142749_596_1555 319
43 3300042606 Ga0466719_231803 Ga0466719_231803_393_1352 319
44 3300042609 Ga0466722_020859 Ga0466722_020859_5744_6703 319
45 iso_pr_bacteria 2820501819 2820503732 320
46 3300010049 Ga0123356_10353887 Ga0123356_103538872 321
47 3300010049 Ga0123356_10355176 Ga0123356_103551762 321
48 3300042603 Ga0466714_097452 Ga0466714_097452_125_1090 321
49 3300042596 Ga0466696_346773 Ga0466696_346773_7336_8307 323
50 3300042606 Ga0466719_515297 Ga0466719_515297_1047_2018 323
51 3300042612 Ga0466705_019481 Ga0466705_019481_22018_22989 323
52 3300042618 Ga0466723_221067 Ga0466723_221067_808_1779 323
53 3300042619 Ga0466726_091773 Ga0466726_091773_10258_11229 323
54 3300042619 Ga0466726_287379 Ga0466726_287379_1673_2644 323
55 3300042602 Ga0466713_117051 Ga0466713_117051_321_1295 324
56 3300042612 Ga0466705_272892 Ga0466705_272892_7810_8784 324
57 3300042615 Ga0466711_059535 Ga0466711_059535_17997_18971 324
58 3300042620 Ga0466728_157307 Ga0466728_157307_3885_4859 324
59 3300042620 Ga0466728_427273 Ga0466728_427273_3891_4865 324
60 3300042643 Ga0466704_028795 Ga0466704_028795_265_1239 324
61 3300042648 Ga0466709_361306 Ga0466709_361306_164_1138 324
62 3300042652 Ga0466708_102826 Ga0466708_102826_10873_11847 324
63 3300005071 Ga0068302_10127949 Ga0068302_101279491 325
64 3300010049 Ga0123356_10038234 Ga0123356_100382344 325
65 3300042591 Ga0466692_133650 Ga0466692_133650_7504_8481 325
66 3300042596 Ga0466696_078936 Ga0466696_078936_2534_3511 325
67 3300042612 Ga0466705_172593 Ga0466705_172593_117_1094 325
68 3300042623 Ga0466734_097317 Ga0466734_097317_179_1156 325
69 3300042643 Ga0466704_130376 Ga0466704_130376_38171_39148 325
70 iso_pr_bacteria 2820234266 2820234328 325
71 iso_pr_bacteria 650716015 650987018 325
72 3300012846 Ga0160433_100004 Ga0160433_100004421 326
73 3300028918 Ga0309901_1000013 Ga0309901_1000013175 326
74 3300042601 Ga0466707_352343 Ga0466707_352343_243_1223 326
75 3300042610 Ga0466698_221064 Ga0466698_221064_1178_2158 326
76 3300042619 Ga0466726_392206 Ga0466726_392206_15352_16332 326
77 3300042654 Ga0466725_194965 Ga0466725_194965_1918_2898 326
78 3300042654 Ga0466725_382118 Ga0466725_382118_2711_3691 326
79 3300010167 Ga0123353_10341683 Ga0123353_103416832 327
80 3300012820 Ga0160456_100004 Ga0160456_100004373 327
81 3300042652 Ga0466708_079679 Ga0466708_079679_26725_27711 328
82 iso_pr_bacteria 2834764525 2834765345 328
83 iso_pr_bacteria 639279309 639314317 328
84 3300042582 Ga0466657_165439 Ga0466657_165439_4873_5862 329
85 iso_pr_bacteria 2744054723 2745420377 329
86 iso_pr_bacteria 2806310572 2806766952 329
87 iso_pr_bacteria 2940228231 2940229354 329
88 iso_pr_bacteria 639279308 639304813 329
89 3300010049 Ga0123356_10314038 Ga0123356_103140381 330
90 3300042636 Ga0466703_105310 Ga0466703_105310_13349_14374 330
91 iso_pr_bacteria 2831736028 2831736455 331
92 iso_pr_bacteria 2839785767 2839789034 331
93 3300007067 Ga0103266_1000028 Ga0103266_10000288 332
94 iso_pr_bacteria 2585427698 2586253258 333
95 iso_pr_bacteria 2835143510 2835144245 333
96 3300010167 Ga0123353_10651536 Ga0123353_106515362 334
97 3300012812 Ga0160471_100007 Ga0160471_10000759 334
98 3300012845 Ga0160460_100177 Ga0160460_10017713 334
99 iso_pr_bacteria 2751185679 2752858035 334
100 iso_pr_bacteria 2791354941 2792066744 334
101 iso_pr_bacteria 2834038347 2834038914 334
102 iso_pr_bacteria 2834143536 2834143564 334
103 iso_pr_bacteria 2834160066 2834161795 334
104 iso_pr_bacteria 2834165886 2834165944 334
105 iso_pr_bacteria 2839192570 2839194343 334
106 iso_pr_bacteria 2899194184 2899194528 334
107 iso_pr_bacteria 2901819457 2901820294 334
108 iso_pr_bacteria 2920412021 2920412474 334
109 iso_pr_bacteria 2920413932 2920414453 334
110 iso_pr_bacteria 3002394112 3002395900 334
111 iso_pr_bacteria 3002401049 3002402706 334
112 iso_pr_bacteria 8067579126 8067579185 334
113 iso_pr_bacteria 8067581993 8067585371 334
114 iso_pr_bacteria 8067585538 8067586954 334
115 iso_pr_bacteria 8067588748 8067589613 334
116 iso_pr_bacteria 8067591850 8067593602 334
117 iso_pr_bacteria 8067594896 8067595114 334
118 iso_pr_bacteria 8067598439 8067599711 334
119 iso_pr_bacteria 8067604290 8067605509 334
120 iso_pr_bacteria 8067607133 8067609510 334
121 iso_pr_bacteria 8074809037 8074810371 334
122 iso_pr_bacteria 8074810961 8074812586 334
123 iso_pr_bacteria 8074812948 8074813299 334
124 iso_pr_bacteria 8100528075 8100528105 334
125 iso_pr_bacteria 8100531325 8100533995 334
126 iso_pr_bacteria 8100534375 8100535787 334
127 3300007763 Ga0105004_1026207 Ga0105004_10262075 335
128 iso_pr_bacteria 2841330038 2841331637 335
129 3300038395 Ga0415639_018703 Ga0415639_018703_2418_3428 336
130 3300042604 Ga0466717_011898 Ga0466717_011898_1200_2210 336
131 3300042654 Ga0466725_370409 Ga0466725_370409_215_1225 336
132 iso_pr_bacteria 2597490292 2598962024 336
133 iso_pr_bacteria 2617271320 2619532418 336
134 iso_pr_bacteria 2786546124 2786626904 336
135 iso_pr_bacteria 2816332478 2818027346 336
136 iso_pr_bacteria 2834852038 2834854168 336
137 iso_pr_bacteria 2841175817 2841176813 336
138 iso_pr_bacteria 2843864159 2843865766 336
139 iso_pr_bacteria 2854518031 2854518566 336
140 iso_pr_bacteria 2854520951 2854521573 336
141 iso_pr_bacteria 2854536247 2854536807 336
142 iso_pr_bacteria 2854548700 2854549366 336
143 iso_pr_bacteria 2854576727 2854578979 336
144 iso_pr_bacteria 2858084324 2858084638 336
145 iso_pr_bacteria 2858089842 2858090959 336
146 iso_pr_bacteria 2858102877 2858104517 336
147 iso_pr_bacteria 2858110640 2858111476 336
148 iso_pr_bacteria 2858119979 2858122106 336
149 iso_pr_bacteria 2858129007 2858129219 336
150 iso_pr_bacteria 2868677537 2868679068 336
151 iso_pr_bacteria 651324000 651475138 336
152 3300009784 Ga0123357_10220084 Ga0123357_102200842 337
153 3300010049 Ga0123356_10004876 Ga0123356_1000487612 337
154 3300042582 Ga0466657_043659 Ga0466657_043659_1567_2598 337
155 3300042600 Ga0466700_025103 Ga0466700_025103_11659_12690 337
156 3300042600 Ga0466700_398659 Ga0466700_398659_466_1479 337
157 3300042611 Ga0466697_184761 Ga0466697_184761_194_1225 337
158 iso_pr_bacteria 2556921622 2558100299 337
159 iso_pr_bacteria 2711768164 2712503654 337
160 iso_pr_bacteria 2718218026 2719801353 337
161 iso_pr_bacteria 2816332503 2818124484 337
162 iso_pr_bacteria 2816332545 2818333310 337
163 iso_pr_bacteria 2854540230 2854542098 337
164 3300009826 Ga0123355_10002885 Ga0123355_1000288525 338
165 3300010049 Ga0123356_10005398 Ga0123356_1000539817 338
166 iso_pr_bacteria 2681813507 2684380651 338
167 3300038395 Ga0415639_094185 Ga0415639_094185_1358_2377 339
168 3300042593 Ga0466691_203768 Ga0466691_203768_831_1850 339
169 iso_pr_bacteria 2599185121 2599225067 339
170 3300007190 Ga0103267_1000011 Ga0103267_100001188 340
171 3300028910 Ga0309902_000001 Ga0309902_000001_248999_250024 341
172 3300042604 Ga0466717_248157 Ga0466717_248157_49_1074 341
173 iso_pr_bacteria 2858105562 2858105994 341
174 iso_pr_bacteria 2868683769 2868684382 341
175 3300002504 JGI24705J35276_12237491 JGI24705J35276_122374914 342
176 3300002504 JGI24705J35276_12238790 JGI24705J35276_1223879046 342
177 3300042623 Ga0466734_030990 Ga0466734_030990_521_1549 342
178 iso_pr_bacteria 2864934081 2864934588 342
179 3300007052 Ga0102736_1005516 Ga0102736_10055161 343
180 iso_pr_bacteria 2864866972 2864868352 343
181 iso_pr_bacteria 2864951976 2864953356 343
182 iso_pr_bacteria 2820146621 2820147349 344
183 3300002931 CVPL010W_10000046 CVPL010W_1000004619 345
184 3300002931 CVPL010W_10000242 CVPL010W_1000024231 345
185 3300007188 Ga0103264_1000520 Ga0103264_10005209 345
186 3300007188 Ga0103264_1001271 Ga0103264_10012718 345
187 3300002934 CVPL005W_1001957 CVPL005W_10019573 346
188 3300029809 Ga0309903_100005 Ga0309903_10000588 346
189 iso_pr_bacteria 2900132049 2900133858 346
190 iso_pr_bacteria 8067483258 8067488516 346
191 3300009460 Ga0127649_101174 Ga0127649_10117450 347
192 3300029810 Ga0309904_1000016 Ga0309904_100001618 347
193 3300002938 CVPL005L_10000001 CVPL005L_1000000192 348
194 3300010167 Ga0123353_10446041 Ga0123353_104460412 348
195 3300012829 Ga0160467_100492 Ga0160467_10049218 348
196 iso_pr_bacteria 2828301124 2828302660 348
197 iso_pr_bacteria 2864955722 2864957762 348
198 iso_pr_bacteria 2864993140 2864995918 348
199 iso_pr_bacteria 2873468275 2873470870 348
200 3300042623 Ga0466734_015083 Ga0466734_015083_1145_2194 349
201 3300042654 Ga0466725_260301 Ga0466725_260301_551_1600 349
202 iso_pr_bacteria 2619619079 2620605348 349
203 3300002934 CVPL005W_1000081 CVPL005W_100008140 350
204 3300010049 Ga0123356_10085909 Ga0123356_100859092 350
205 3300002931 CVPL010W_10010189 CVPL010W_100101898 351
206 3300007129 Ga0102734_1001334 Ga0102734_100133421 351
207 3300012846 Ga0160433_100593 Ga0160433_1005933 351
208 3300042623 Ga0466734_141634 Ga0466734_141634_30192_31334 351
209 3300056564 Ga0530661_000807 Ga0530661_000807_17956_19011 351
210 3300012819 Ga0160468_100001 Ga0160468_100001672 353
211 iso_pr_bacteria 2864976888 2864976959 356
212 iso_pr_bacteria 2724678956 2724788701 362

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00676 E1_dh Dehydrogenase E1 component 52 349 0.98

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF00676 GO:0016624 oxidoreductase activity, acting on the aldehyde or oxo group of donors, disulfide as acceptor MF

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.85 0.92 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.