Protein Family IF11351

Metagenome Metatranscriptome Isolate
348 Members
196 Samples
224 Scaffolds
156.4 Avg Length

🧬 Representative Sequence

ID
iso_pr_bacteria|2718217749|2718707365|
Length
194 aa
Sequence
MARRKGAPKREIFPDPLFRSELLAKFINTVIRNGKKSVAESIVYGALDVVAKRVRGKGRAEEEGGEGGDKVGGGPKKKGGGEEDDIRVNEKTRAVALDTFKKALGNVMPSVEVKSRRVGGSTYQVPVEIRAVRRQALAMRWLSEYANKRNEKTMILRLANEILDAVENRGGAVKKKEDVHRMAKANQAFAHYRW

📊 Sample Types

Isolate 35.6%
Metagenome 63.5%
MAG 0.0%
Metatranscriptome 0.9%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 30.9%
Termitidae 14.4%
Apidae 9.8%
Kalotermitidae 7.2%
Anthocoridae 5.2%
Tenebrionidae 4.1%
Scarabaeidae 3.1%
Elmidae 2.6%
Cambaridae 2.6%
Culicidae 2.6%
Armadillidiidae 2.1%
Ixodidae 1.5%
Termopsidae 1.5%
Rhinotermitidae 1.5%
Psyllidae 1.5%
Dytiscidae 1.5%
Hydrophilidae 1.0%
Drosophilidae 1.0%
Formicidae 1.0%
Chironomidae 0.5%
Cimicidae 0.5%
Pediculidae 0.5%
Hodotermitidae 0.5%
Pyralidae 0.5%
Cicadellidae 0.5%
Cerambycidae 0.5%
Pyrrhocoridae 0.5%
Aphididae 0.5%

🌳 Taxonomy

Archaea 0
Bacteria 304
Eukaryota 0
Viruses 0
Unclassified 44

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 8110340172 Bifidobacterium choladohabitans B14384H11 Isolate Apidae
2 2519899775 Bifidobacterium asteroides PRL2011 Isolate Apidae
3 2524023214 Leucobacter chironomi DSM 19883 Isolate Chironomidae
4 2597490239 Bifidobacterium bohemicum DSM 22767 Isolate Unclassified
5 2663763384 Bifidobacterium bombi DSM 19703 Isolate Apidae
6 2681812870 Oerskovia enterophila DFA-19 Isolate Unclassified
7 2848356102 Xylanimonas allomyrinae 2JSPR-7 Isolate Scarabaeidae
8 2850695442 Lactococcus allomyrinae 1JSPR-7 Isolate Scarabaeidae
9 2862075925 Corynebacterium lactis S064 Isolate Ixodidae
10 2864755708 Massilia timonae S00006 Isolate Elmidae
11 2865983822 Bifidobacterium xylocopae XV2 Isolate Apidae
12 2894932631 Leucobacter sp. OAMLP11 Isolate Anthocoridae
13 2894966443 Leucobacter sp. OLCALW19 Isolate Anthocoridae
14 3300000333 Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony Metagenome Apidae
15 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
16 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
17 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
18 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
19 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
20 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
21 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
22 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
23 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
24 2505679068 Isoptericola variabilis 225 Isolate Unclassified
25 2513237174 Bifidobacterium asteroides ATCC 25910 Isolate Apidae
26 2645727657 Bifidobacterium actinocoloniiforme DSM 22766 Isolate Unclassified
27 2820833147 Unclassified Actinobacteria Lab288P4bin85 Isolate Unclassified
28 2820836992 Unclassified Actinobacteria Lab288P4bin32 Isolate Unclassified
29 2820849606 Unclassified Actinobacteria Lab288P3bin39 Isolate Unclassified
30 2820906387 Unclassified Actinobacteria Emb289P4bin41 Isolate Unclassified
31 2820922474 Unclassified Actinobacteria Emb289P3bin154 Isolate Unclassified
32 2820926697 Unclassified Actinobacteria Emb289P3bin125 Isolate Unclassified
33 2824199081 Bifidobacterium commune DSM 28792 Isolate Unclassified
34 2837204985 Lysinimonas sp. 2DFWR-13 Isolate Scarabaeidae
35 2865982043 Bifidobacterium aemilianum XV10 Isolate Apidae
36 2873586004 Sanguibacter sp. HDW7 Isolate Hydrophilidae
37 2878857142 Lactococcus lactis DmW198 Isolate Drosophilidae
38 2894944011 Leucobacter sp. OLAS13 Isolate Anthocoridae
39 2915166107 Leucobacter sp. cx-87 Isolate Cambaridae
40 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
41 3300012834 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG Metagenome
42 3300012846 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG Metagenome Armadillidiidae
43 3300012857 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG Metagenome Culicidae
44 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
45 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
46 646564587 Tsukamurella paurometabola 33, DSM 20162 Isolate Cimicidae
47 8062637095 Yimella sp. cx-51 Isolate Cambaridae
48 8077775691 Tsukamurella sp. PLM1 Isolate Formicidae
49 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
50 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
51 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
52 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
53 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
54 2209111014 Host-associated microbial communities from Diaphorina citri thoracic segments in Florida, USA - ACP Metagenome Psyllidae
55 2684622918 Bifidobacterium asteroides Bi_198 Isolate Unclassified
56 2772190788 Candidatus Riesia pediculischaeffi PTSK Isolate Pediculidae
57 2820800812 Unclassified Actinobacteria Th196P4bin28 Isolate Unclassified
58 2820880921 Unclassified Actinobacteria Lab288P1bin60 Isolate Unclassified
59 2820897376 Unclassified Actinobacteria Lab288P1bin101 Isolate Unclassified
60 2820934415 Unclassified Actinobacteria Emb289P1bin68 Isolate Unclassified
61 2832201259 Rickettsiella grylli TrM1 Isolate Unclassified
62 2864899338 Mycobacteroides chelonae S00154 Isolate Elmidae
63 2894926108 Leucobacter sp. OLES1 Isolate Anthocoridae
64 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
65 3300056790 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) Metagenome Tenebrionidae
66 3300056856 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) Metagenome Tenebrionidae
67 8024981139 Bifidobacterium asteroides ESL0170 Isolate Apidae
68 8024984606 Bifidobacterium asteroides ESL0199 Isolate Apidae
69 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
70 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
71 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
72 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
73 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
74 2504756063 Isoptericola variabilis J5 Isolate Unclassified
75 2597490194 Bifidobacterium coryneforme LMG 18911 Isolate Apidae
76 2671180601 Bifidobacterium asteroides DSM 20089 Isolate Unclassified
77 2773857880 Candidatus Profftella armatura YCPA Isolate Psyllidae
78 2734481968 Xylanimicrobium pachnodae JCM 13526, NBRC 107786 Isolate Scarabaeidae
79 2820416776 Unclassified Firmicutes Lab288P3bin9 Isolate Unclassified
80 2820813074 Unclassified Actinobacteria Nt197P3bin52 Isolate Unclassified
81 2820814774 Unclassified Actinobacteria Nt197P3bin39 Isolate Unclassified
82 2820854745 Unclassified Actinobacteria Lab288P3bin234 Isolate Unclassified
83 2820873081 Unclassified Actinobacteria Lab288P1bin96 Isolate Unclassified
84 2820921285 Unclassified Actinobacteria Emb289P3bin53 Isolate Unclassified
85 2864964650 Tsukamurella ocularis S00236 Isolate Elmidae
86 2873589062 Phycicoccus sp. HDW14 Isolate Hydrophilidae
87 2900354037 Nocardia macrotermitis RB20 Isolate Termitidae
88 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
89 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
90 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
91 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
92 3300012839 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG Metagenome Culicidae
93 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
94 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
95 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
96 3300056814 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) Metagenome Tenebrionidae
97 3300056857 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) Metagenome Tenebrionidae
98 3300057007 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) Metagenome Tenebrionidae
99 8109397740 Rhodococcus triatomae DSM 44892 Isolate Unclassified
100 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
101 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
102 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
103 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
104 2684622920 Bifidobacterium asteroides Bi_200 Isolate Unclassified
105 2718217749 Coxiella mudrowiae CRt Isolate Ixodidae
106 2802429577 Bifidobacterium indicum DSM 20214 Isolate Unclassified
107 2820610792 Unclassified Firmicutes Emb289P1bin33 Isolate Unclassified
108 2820806175 Unclassified Actinobacteria Th196P3bin122 Isolate Unclassified
109 2820809073 Unclassified Actinobacteria Nt197P3bin55 Isolate Unclassified
110 2820822094 Unclassified Actinobacteria Nt197P3bin131 Isolate Unclassified
111 2820867525 Unclassified Actinobacteria Lab288P3bin128 Isolate Unclassified
112 2864918810 Tsukamurella ocularis S00175 Isolate Elmidae
113 2873614151 Leucobacter viscericola HDW9C Isolate Dytiscidae
114 2879643867 Bifidobacterium sp. wkB344 Isolate Apidae
115 2884351759 Cellulosimicrobium sp. BI34T Isolate Pyralidae
116 2894897082 Leucobacter sp. OLCS4 Isolate Anthocoridae
117 2894974975 Leucobacter sp. OLIS6 Isolate Anthocoridae
118 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
119 3300012806 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E1 MG Metagenome
120 3300012858 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG Metagenome Armadillidiidae
121 3300060773 Metatranscriptome of mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D15_HDPE_oats_a (Metagenome Metatranscriptome) Metatranscriptome Tenebrionidae
122 8062747827 Yimella sp. cx-51 Isolate Cambaridae
123 2562617066 Rickettsiella grylli AAQJ Isolate Armadillidiidae
124 2660238275 Bifidobacterium indicum DSM 20214 Isolate Unclassified
125 2684622916 Bifidobacterium asteroides Bi_170 Isolate Unclassified
126 2684622917 Bifidobacterium coryneforme Bi_197 Isolate Unclassified
127 2693429521 Bifidobacterium coryneforme DSM 20216 Isolate Unclassified
128 2718217844 Candidatus Baumannia cicadellinicola B-GSS Isolate Cicadellidae
129 2788500098 Bombiscardovia coagulans DSM 22924 Isolate Apidae
130 2820236043 Unclassified Firmicutes Th196P3bin97 Isolate Unclassified
131 2820471304 Unclassified Firmicutes Lab288P1bin89 Isolate Unclassified
132 2820799971 Unclassified Actinobacteria Th196P4bin46 Isolate Unclassified
133 2820825283 Unclassified Actinobacteria Nt197P3bin111 Isolate Unclassified
134 2820831444 Unclassified Actinobacteria Nc150P4bin21 Isolate Unclassified
135 2820911766 Unclassified Actinobacteria Emb289P3bin96 Isolate Unclassified
136 2820916033 Unclassified Actinobacteria Emb289P3bin63 Isolate Unclassified
137 2820924633 Unclassified Actinobacteria Emb289P3bin142 Isolate Unclassified
138 2820939604 Unclassified Actinobacteria Emb289P1bin4 Isolate Unclassified
139 2873620646 Leucobacter coleopterorum HDW9A Isolate Dytiscidae
140 2894935787 Leucobacter sp. OLJS4 Isolate Anthocoridae
141 3300002932 Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 Metagenome Formicidae
142 3300005721 Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 Metagenome Apidae
143 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
144 3300012820 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E6 MG Metagenome Armadillidiidae
145 3300012861 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG Metagenome Culicidae
146 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
147 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
148 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
149 8024982947 Bifidobacterium asteroides ESL0200 Isolate Apidae
150 8110341875 Bifidobacterium polysaccharolyticum W8117 Isolate Apidae
151 2084038013 Anoplophora glabripennis gut microbial communities from Worchester, Massachusetts, USA - Larvae Metagenome Cerambycidae
152 2808606957 Bifidobacterium sp. ESL0447 Isolate Unclassified
153 2820838073 Unclassified Actinobacteria Lab288P4bin27 Isolate Unclassified
154 2820842553 Unclassified Actinobacteria Lab288P4bin104 Isolate Unclassified
155 2820848511 Unclassified Actinobacteria Lab288P3bin86 Isolate Unclassified
156 2820876581 Unclassified Actinobacteria Lab288P1bin83 Isolate Unclassified
157 2820917597 Unclassified Actinobacteria Emb289P3bin57 Isolate Unclassified
158 2820918931 Unclassified Actinobacteria Emb289P3bin56 Isolate Unclassified
159 2820941830 Unclassified Actinobacteria Cu122P5bin49 Isolate Unclassified
160 2864773010 Tsukamurella ocularis S00022 Isolate Elmidae
161 2894981435 Leucobacter sp. OLDS2 Isolate Anthocoridae
162 2909412500 Yimella sp. cx-573 Isolate Cambaridae
163 3002773460 Coxiella endosymbiont of Amblyomma nuttalli Craf2019 Isolate Ixodidae
164 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
165 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
166 3300012835 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG Metagenome Culicidae
167 3300012849 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG Metagenome Culicidae
168 3300022820 Termite gut microbial communities from Nasutitermes sp. nest - French Guiana - 36-11 mRNA Metatranscriptome Termitidae
169 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
170 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
171 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
172 2503538010 Coriobacterium glomerans PW2, DSM 20642 Isolate Pyrrhocoridae
173 2565956547 Candidatus Profftella armatura Isolate Psyllidae
174 2568526170 Bifidobacterium sp. A11 Isolate Apidae
175 2600255079 Bifidobacterium bombi DSM 19703 Isolate Apidae
176 2684622919 Bifidobacterium asteroides Bi_199 Isolate Unclassified
177 2731957681 Xylanimicrobium pachnodae JCM 13526, NBRC 107786 Isolate Scarabaeidae
178 2775506951 Candidatus Coxiella mudrowiae CRS-CAT Isolate Unclassified
179 2820856540 Unclassified Actinobacteria Lab288P3bin21 Isolate Unclassified
180 2873617540 Leucobacter insecticola HDW9B Isolate Dytiscidae
181 2883683260 Protaetiibacter larvae KACC 19322 Isolate Scarabaeidae
182 2888667245 Corynebacterium diphtheriae FRC0190 Isolate Unclassified
183 2894900265 Leucobacter sp. OLTLW20 Isolate Anthocoridae
184 2894929448 Leucobacter sp. OAMSW11 Isolate Anthocoridae
185 2915168811 Leucobacter sp. cx-169 Isolate Cambaridae
186 2984883310 Serratia symbiotica SCifornacula/2912 Isolate Aphididae
187 3300002501 Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 Metagenome Termitidae
188 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
189 3300007505 Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut Metagenome Drosophilidae
190 3300060896 Metatranscriptome of mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D7_PS_c (Metagenome Metatranscriptome) Metatranscriptome Tenebrionidae
191 8024986378 Bifidobacterium asteroides ESL0198 Isolate Apidae
192 8032009961 Bifidobacterium indicum ESL0197 Isolate Apidae
193 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
194 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
195 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
196 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0562375_0569 3300056856 Bacteria 72979
2 Ga0466715_054330 3300042616 Bacteria 75121
3 Ga0466718_144330 3300042617 Unclassified 1469
4 Ga0466726_369433 3300042619 Bacteria 2857
5 Ga0466728_375194 3300042620 Unclassified 3251
6 Ga0160452_101282 3300012834 Bacteria 7681
7 Ga0160472_100006 3300012839 Bacteria 656551
8 Ga0160436_1000191 3300012861 Bacteria 30420
9 Ga0466657_120132 3300042582 Bacteria 5822
10 Ga0466693_189648 3300042592 Bacteria 16531
11 Ga0466722_183422 3300042609 Bacteria 24688
12 Ga0466698_344232 3300042610 Bacteria 2234
13 Ga0123357_10784201 3300009784 Bacteria 650
14 Ga0123356_10000385 3300010049 Bacteria 50352
15 Ga0123353_10000803 3300010167 Bacteria 38182
16 Ga0123354_10012403 3300010882 Bacteria 13208
17 Ga0466729_266001 3300042621 Bacteria 1406
18 Ga0466729_309738 3300042621 Bacteria 19337
19 Ga0466735_002810 3300042624 Bacteria 2072
20 Ga0466703_348284 3300042636 Bacteria 9095
21 Ga0466704_008359 3300042643 Bacteria 5557
22 Ga0466704_169176 3300042643 Bacteria 6365
23 Ga0466704_344625 3300042643 Bacteria 5510
24 Ga0466725_093133 3300042654 Bacteria 2294
25 Ga0466705_110243 3300042612 Bacteria 15481
26 Ga0466705_139183 3300042612 Bacteria 4539
27 Ga0562374_2642 3300057007 Unclassified 14593
28 JGI24702J35022_10012360 3300002462 Bacteria 4748
29 JGI24703J35330_11381737 3300002501 Bacteria 937
30 Ga0068302_10015651 3300005071 Bacteria 22613
31 Ga0072940_1070821 3300005200 Bacteria 9131
32 Ga0466711_433348 3300042615 Bacteria 2259
33 Ga0466715_048937 3300042616 Unclassified 1279
34 Ga0466723_289451 3300042618 Bacteria 49429
35 Ga0466728_050465 3300042620 Unclassified 1793
36 Ga0466728_403718 3300042620 Unclassified 2268
37 Ga0466690_244523 3300042590 Bacteria 2282
38 Ga0466692_203301 3300042591 Bacteria 6151
39 Ga0466691_156376 3300042593 Bacteria 14099
40 Ga0466716_440284 3300042605 Bacteria 1108
41 Ga0466719_092416 3300042606 Bacteria 67606
42 Ga0123357_10008408 3300009784 Bacteria 12887
43 Ga0123355_10012685 3300009826 Bacteria 13065
44 Ga0123356_10001550 3300010049 Bacteria 25300
45 Ga0123356_10438181 3300010049 Unclassified 1452
46 Ga0123353_10000855 3300010167 Bacteria 37005
47 Ga0123353_12213326 3300010167 Bacteria 665
48 Ga0466730_014716 3300042625 Bacteria 1309
49 Ga0466703_133753 3300042636 Bacteria 110740
50 Ga0466704_197616 3300042643 Bacteria 3232
51 Ga0466705_173313 3300042612 Unclassified 1629
52 Ga0562377_1726 3300056842 Bacteria 20503
53 Ga0466705_392983 3300042612 Unclassified 2913
54 Ga0466718_108836 3300042617 Bacteria 1548
55 Ga0466723_219131 3300042618 Bacteria 6063
56 Ga0160456_101617 3300012820 Bacteria 5114
57 Ga0466692_056061 3300042591 Bacteria 3404
58 Ga0466693_229757 3300042592 Bacteria 1608
59 Ga0466696_099927 3300042596 Bacteria 3921
60 Ga0466696_152694 3300042596 Unclassified 1084
61 Ga0466706_268417 3300042599 Bacteria 2367
62 Ga0466713_024575 3300042602 Bacteria 38766
63 Ga0466719_468537 3300042606 Bacteria 80797
64 Ga0466722_004093 3300042609 Bacteria 1048
65 Ga0123355_10015705 3300009826 Bacteria 11904
66 Ga0123356_10590637 3300010049 Bacteria 1275
67 Ga0123354_10192554 3300010882 Bacteria 2276
68 Ga0123354_10556472 3300010882 Bacteria 862
69 Ga0466702_399695 3300042635 Bacteria 3391
70 Ga0466704_403558 3300042643 Unclassified 1628
71 Ga0466708_076169 3300042652 Bacteria 2278
72 Ga0466708_097335 3300042652 Bacteria 43487
73 Ga0466705_032213 3300042612 Bacteria 14399
74 Ga0466705_046048 3300042612 Bacteria 4255
75 Ga0466705_207419 3300042612 Bacteria 3859
76 Ga0466705_220327 3300042612 Bacteria 34237
77 Ga0466705_357805 3300042612 Bacteria 15135
78 JGI24702J35022_10021090 3300002462 Bacteria 3536
79 JGI24705J35276_12211380 3300002504 Bacteria 1854
80 Ga0072940_1300899 3300005200 Bacteria 1493
81 Ga0466705_481337 3300042612 Bacteria 2373
82 Ga0466726_376208 3300042619 Bacteria 25969
83 Ga0160433_104075 3300012846 Bacteria 2421
84 Ga0160447_103016 3300012849 Unclassified 5589
85 Ga0466693_215783 3300042592 Unclassified 1223
86 Ga0466706_282606 3300042599 Unclassified 1404
87 Ga0466700_200157 3300042600 Bacteria 2281
88 Ga0466707_418658 3300042601 Unclassified 1148
89 Ga0466714_003033 3300042603 Bacteria 3326
90 Ga0123355_10071802 3300009826 Unclassified 5555
91 Ga0123353_10018232 3300010167 Bacteria 10368
92 Ga0123354_10000166 3300010882 Bacteria 53754
93 Ga0466703_343943 3300042636 Bacteria 18085
94 Ga0466708_290341 3300042652 Bacteria 1866
95 Ga0466705_287983 3300042612 Unclassified 2351
96 Ga0562376_0246 3300056857 Bacteria 106482
97 AglaG_contig11531 2084038013 Bacteria 1271
98 AustNasuHG_c1002003 3300000089 Bacteria 7329
99 HBC_ctgsDRAFT_1089359 3300000333 Bacteria 722
100 JGI24702J35022_10025499 3300002462 Bacteria 3190
101 Ga0068302_10025260 3300005071 Bacteria 19492
102 Ga0068302_10052865 3300005071 Bacteria 4851
103 Ga0074278_141663 3300005721 Bacteria 6060
104 Ga0466715_554750 3300042616 Bacteria 5267
105 Ga0466718_111049 3300042617 Bacteria 1050
106 Ga0466729_136485 3300042621 Bacteria 1311
107 Ga0255809_1031655 3300022820 Bacteria 1708
108 Ga0466693_070193 3300042592 Bacteria 6074
109 Ga0466696_028301 3300042596 Bacteria 1023
110 Ga0466696_277781 3300042596 Bacteria 1922
111 Ga0466696_331555 3300042596 Unclassified 4057
112 Ga0466706_262031 3300042599 Bacteria 4790
113 Ga0466698_496384 3300042610 Unclassified 2360
114 Ga0123355_10010726 3300009826 Bacteria 14078
115 Ga0123355_10424151 3300009826 Bacteria 1697
116 Ga0123355_10797917 3300009826 Bacteria 1054
117 Ga0123356_10000248 3300010049 Bacteria 61776
118 Ga0123356_10001142 3300010049 Bacteria 29321
119 Ga0123353_10009329 3300010167 Bacteria 13526
120 Ga0123353_10641770 3300010167 Unclassified 1505
121 Ga0160442_100413 3300012806 Unclassified 14913
122 Ga0466729_245691 3300042621 Bacteria 5360
123 Ga0466734_103663 3300042623 Bacteria 1549
124 Ga0466703_337453 3300042636 Bacteria 1052
125 Ga0466703_351789 3300042636 Bacteria 1860
126 Ga0466704_478900 3300042643 Unclassified 3379
127 Ga0466709_314485 3300042648 Bacteria 14194
128 Ga0466724_27060 3300042649 Unclassified 3532
129 Ga0466705_279280 3300042612 Bacteria 14131
130 Ga0562379_0010 3300056790 Bacteria 1659178
131 Ga0562377_0137 3300056842 Bacteria 212469
132 2218088035 2209111014 Bacteria 3131
133 JGI24699J35502_10528842 3300002509 Bacteria 634
134 Ga0072940_1084680 3300005200 Bacteria 721
135 Ga0466710_348449 3300042613 Bacteria 7553
136 Ga0466728_045708 3300042620 Unclassified 1005
137 Ga0466693_003338 3300042592 Bacteria 3149
138 Ga0466693_275193 3300042592 Bacteria 1369
139 Ga0466696_058492 3300042596 Unclassified 4746
140 Ga0466696_064151 3300042596 Bacteria 18163
141 Ga0466706_196232 3300042599 Bacteria 1874
142 Ga0466707_101530 3300042601 Bacteria 1748
143 Ga0466714_138868 3300042603 Unclassified 1438
144 Ga0466719_003424 3300042606 Unclassified 8146
145 Ga0123357_10050227 3300009784 Bacteria 5647
146 Ga0123356_10042151 3300010049 Bacteria 4252
147 Ga0123353_10015115 3300010167 Bacteria 11188
148 Ga0123353_10032979 3300010167 Bacteria 8054
149 Ga0466708_466452 3300042652 Bacteria 12044
150 Ga0466705_129332 3300042612 Unclassified 1629
151 Ga0466705_215684 3300042612 Bacteria 3507
152 Ga0562376_0384 3300056857 Bacteria 83970
153 Ga0562374_0182 3300057007 Bacteria 137963
154 JGI24705J35276_12147416 3300002504 Bacteria 1167
155 CVPL010L_1000290 3300002932 Unclassified 21869
156 Ga0466711_474415 3300042615 Bacteria 1778
157 Ga0466715_642187 3300042616 Bacteria 1511
158 Ga0466718_152904 3300042617 Bacteria 12214
159 Ga0466726_196699 3300042619 Unclassified 15690
160 Ga0160452_101275 3300012834 Bacteria 7758
161 Ga0160435_1000456 3300012857 Unclassified 13956
162 Ga0160457_1005446 3300012858 Unclassified 1941
163 Ga0466693_161371 3300042592 Bacteria 51371
164 Ga0466696_348382 3300042596 Unclassified 1270
165 Ga0466706_189120 3300042599 Bacteria 8969
166 Ga0466707_037773 3300042601 Unclassified 5332
167 Ga0466707_054562 3300042601 Bacteria 4253
168 Ga0466707_124507 3300042601 Bacteria 1751
169 Ga0466713_070719 3300042602 Unclassified 1870
170 Ga0466713_121349 3300042602 Bacteria 4614
171 Ga0466713_154030 3300042602 Bacteria 2248
172 Ga0466717_102305 3300042604 Bacteria 35520
173 Ga0123357_10346215 3300009784 Bacteria 1429
174 Ga0123355_10269118 3300009826 Unclassified 2371
175 Ga0123355_11100351 3300009826 Bacteria 827
176 Ga0123353_10470733 3300010167 Bacteria 1842
177 Ga0123354_10044180 3300010882 Bacteria 6837
178 Ga0123354_10083377 3300010882 Bacteria 4499
179 Ga0466731_302950 3300042622 Bacteria 3965
180 Ga0466734_143044 3300042623 Bacteria 1010
181 Ga0466703_312505 3300042636 Bacteria 4431
182 Ga0466708_083377 3300042652 Bacteria 45280
183 Ga0466705_045814 3300042612 Unclassified 2674
184 Ga0466705_180592 3300042612 Bacteria 1166
185 Ga0466705_283802 3300042612 Unclassified 3593
186 Ga0562378_0001 3300056814 Bacteria 3579584
187 Ga0562375_3802 3300056856 Unclassified 13087
188 Ga0590797_08436 3300060773 Bacteria 789
189 Ga0590775_02913 3300060896 Bacteria 2537
190 JGI24695J34938_10072457 3300002450 Bacteria 1437
191 JGI24702J35022_10000002 3300002462 Bacteria 104026
192 Ga0105005_1052610 3300007505 Bacteria 2376
193 Ga0466711_265300 3300042615 Unclassified 1134
194 Ga0466715_317702 3300042616 Bacteria 7662
195 Ga0466723_238899 3300042618 Bacteria 6171
196 Ga0466723_370679 3300042618 Bacteria 2418
197 Ga0466726_067981 3300042619 Unclassified 4225
198 Ga0466728_043237 3300042620 Bacteria 51050
199 Ga0466729_039665 3300042621 Bacteria 1501
200 Ga0466729_190659 3300042621 Bacteria 3729
201 Ga0160446_100161 3300012835 Bacteria 52061
202 Ga0160446_101864 3300012835 Bacteria 4052
203 Ga0466692_113392 3300042591 Bacteria 42952
204 Ga0466696_111192 3300042596 Bacteria 22526
205 Ga0466696_170357 3300042596 Unclassified 3121
206 Ga0466696_209421 3300042596 Bacteria 9362
207 Ga0466696_258511 3300042596 Unclassified 1363
208 Ga0466696_262377 3300042596 Bacteria 1115
209 Ga0466696_386734 3300042596 Bacteria 1108
210 Ga0466706_102043 3300042599 Bacteria 17149
211 Ga0466714_156273 3300042603 Bacteria 2034
212 Ga0466717_047893 3300042604 Bacteria 5943
213 Ga0466717_189836 3300042604 Bacteria 4136
214 Ga0466719_561107 3300042606 Bacteria 1041
215 Ga0123357_10461994 3300009784 Bacteria 1090
216 Ga0123355_10003978 3300009826 Bacteria 21391
217 Ga0123355_10109441 3300009826 Unclassified 4322
218 Ga0123356_10012934 3300010049 Bacteria 8080
219 Ga0123356_10861095 3300010049 Bacteria 1077
220 Ga0123353_10003840 3300010167 Bacteria 19170
221 Ga0123353_10663953 3300010167 Bacteria 1472
222 Ga0466734_145748 3300042623 Bacteria 1265
223 Ga0466704_196595 3300042643 Bacteria 2160
224 Ga0466725_161751 3300042654 Bacteria 1739

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00177 Ribosomal_S7 Ribosomal protein S7p/S5e 3 187 0.98

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.