Protein Family IF11351
Metagenome
Metatranscriptome
Isolate
348
Members
196
Samples
224
Scaffolds
156.4
Avg Length
Representative Sequence
- ID
- iso_pr_bacteria|2718217749|2718707365|
- Length
- 194 aa
- Sequence
- MARRKGAPKREIFPDPLFRSELLAKFINTVIRNGKKSVAESIVYGALDVVAKRVRGKGRAEEEGGEGGDKVGGGPKKKGGGEEDDIRVNEKTRAVALDTFKKALGNVMPSVEVKSRRVGGSTYQVPVEIRAVRRQALAMRWLSEYANKRNEKTMILRLANEILDAVENRGGAVKKKEDVHRMAKANQAFAHYRW
Sample Types
Isolate
35.6%
Metagenome
63.5%
MAG
0.0%
Metatranscriptome
0.9%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
30.9%
Termitidae
14.4%
Apidae
9.8%
Kalotermitidae
7.2%
Anthocoridae
5.2%
Tenebrionidae
4.1%
Scarabaeidae
3.1%
Elmidae
2.6%
Cambaridae
2.6%
Culicidae
2.6%
Armadillidiidae
2.1%
Ixodidae
1.5%
Termopsidae
1.5%
Rhinotermitidae
1.5%
Psyllidae
1.5%
Dytiscidae
1.5%
Hydrophilidae
1.0%
Drosophilidae
1.0%
Formicidae
1.0%
Chironomidae
0.5%
Cimicidae
0.5%
Pediculidae
0.5%
Hodotermitidae
0.5%
Pyralidae
0.5%
Cicadellidae
0.5%
Cerambycidae
0.5%
Pyrrhocoridae
0.5%
Aphididae
0.5%
Taxonomy
Archaea
0
Bacteria
304
Eukaryota
0
Viruses
0
Unclassified
44
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 8110340172 | Bifidobacterium choladohabitans B14384H11 | Isolate | Apidae |
| 2 | 2519899775 | Bifidobacterium asteroides PRL2011 | Isolate | Apidae |
| 3 | 2524023214 | Leucobacter chironomi DSM 19883 | Isolate | Chironomidae |
| 4 | 2597490239 | Bifidobacterium bohemicum DSM 22767 | Isolate | Unclassified |
| 5 | 2663763384 | Bifidobacterium bombi DSM 19703 | Isolate | Apidae |
| 6 | 2681812870 | Oerskovia enterophila DFA-19 | Isolate | Unclassified |
| 7 | 2848356102 | Xylanimonas allomyrinae 2JSPR-7 | Isolate | Scarabaeidae |
| 8 | 2850695442 | Lactococcus allomyrinae 1JSPR-7 | Isolate | Scarabaeidae |
| 9 | 2862075925 | Corynebacterium lactis S064 | Isolate | Ixodidae |
| 10 | 2864755708 | Massilia timonae S00006 | Isolate | Elmidae |
| 11 | 2865983822 | Bifidobacterium xylocopae XV2 | Isolate | Apidae |
| 12 | 2894932631 | Leucobacter sp. OAMLP11 | Isolate | Anthocoridae |
| 13 | 2894966443 | Leucobacter sp. OLCALW19 | Isolate | Anthocoridae |
| 14 | 3300000333 | Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony | Metagenome | Apidae |
| 15 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 16 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 17 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 18 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 19 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 20 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 21 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 22 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 23 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 24 | 2505679068 | Isoptericola variabilis 225 | Isolate | Unclassified |
| 25 | 2513237174 | Bifidobacterium asteroides ATCC 25910 | Isolate | Apidae |
| 26 | 2645727657 | Bifidobacterium actinocoloniiforme DSM 22766 | Isolate | Unclassified |
| 27 | 2820833147 | Unclassified Actinobacteria Lab288P4bin85 | Isolate | Unclassified |
| 28 | 2820836992 | Unclassified Actinobacteria Lab288P4bin32 | Isolate | Unclassified |
| 29 | 2820849606 | Unclassified Actinobacteria Lab288P3bin39 | Isolate | Unclassified |
| 30 | 2820906387 | Unclassified Actinobacteria Emb289P4bin41 | Isolate | Unclassified |
| 31 | 2820922474 | Unclassified Actinobacteria Emb289P3bin154 | Isolate | Unclassified |
| 32 | 2820926697 | Unclassified Actinobacteria Emb289P3bin125 | Isolate | Unclassified |
| 33 | 2824199081 | Bifidobacterium commune DSM 28792 | Isolate | Unclassified |
| 34 | 2837204985 | Lysinimonas sp. 2DFWR-13 | Isolate | Scarabaeidae |
| 35 | 2865982043 | Bifidobacterium aemilianum XV10 | Isolate | Apidae |
| 36 | 2873586004 | Sanguibacter sp. HDW7 | Isolate | Hydrophilidae |
| 37 | 2878857142 | Lactococcus lactis DmW198 | Isolate | Drosophilidae |
| 38 | 2894944011 | Leucobacter sp. OLAS13 | Isolate | Anthocoridae |
| 39 | 2915166107 | Leucobacter sp. cx-87 | Isolate | Cambaridae |
| 40 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 41 | 3300012834 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG | Metagenome | |
| 42 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 43 | 3300012857 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG | Metagenome | Culicidae |
| 44 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 45 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 46 | 646564587 | Tsukamurella paurometabola 33, DSM 20162 | Isolate | Cimicidae |
| 47 | 8062637095 | Yimella sp. cx-51 | Isolate | Cambaridae |
| 48 | 8077775691 | Tsukamurella sp. PLM1 | Isolate | Formicidae |
| 49 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 50 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 51 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 52 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 53 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 54 | 2209111014 | Host-associated microbial communities from Diaphorina citri thoracic segments in Florida, USA - ACP | Metagenome | Psyllidae |
| 55 | 2684622918 | Bifidobacterium asteroides Bi_198 | Isolate | Unclassified |
| 56 | 2772190788 | Candidatus Riesia pediculischaeffi PTSK | Isolate | Pediculidae |
| 57 | 2820800812 | Unclassified Actinobacteria Th196P4bin28 | Isolate | Unclassified |
| 58 | 2820880921 | Unclassified Actinobacteria Lab288P1bin60 | Isolate | Unclassified |
| 59 | 2820897376 | Unclassified Actinobacteria Lab288P1bin101 | Isolate | Unclassified |
| 60 | 2820934415 | Unclassified Actinobacteria Emb289P1bin68 | Isolate | Unclassified |
| 61 | 2832201259 | Rickettsiella grylli TrM1 | Isolate | Unclassified |
| 62 | 2864899338 | Mycobacteroides chelonae S00154 | Isolate | Elmidae |
| 63 | 2894926108 | Leucobacter sp. OLES1 | Isolate | Anthocoridae |
| 64 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 65 | 3300056790 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) | Metagenome | Tenebrionidae |
| 66 | 3300056856 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) | Metagenome | Tenebrionidae |
| 67 | 8024981139 | Bifidobacterium asteroides ESL0170 | Isolate | Apidae |
| 68 | 8024984606 | Bifidobacterium asteroides ESL0199 | Isolate | Apidae |
| 69 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 70 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 71 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 72 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 73 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 74 | 2504756063 | Isoptericola variabilis J5 | Isolate | Unclassified |
| 75 | 2597490194 | Bifidobacterium coryneforme LMG 18911 | Isolate | Apidae |
| 76 | 2671180601 | Bifidobacterium asteroides DSM 20089 | Isolate | Unclassified |
| 77 | 2773857880 | Candidatus Profftella armatura YCPA | Isolate | Psyllidae |
| 78 | 2734481968 | Xylanimicrobium pachnodae JCM 13526, NBRC 107786 | Isolate | Scarabaeidae |
| 79 | 2820416776 | Unclassified Firmicutes Lab288P3bin9 | Isolate | Unclassified |
| 80 | 2820813074 | Unclassified Actinobacteria Nt197P3bin52 | Isolate | Unclassified |
| 81 | 2820814774 | Unclassified Actinobacteria Nt197P3bin39 | Isolate | Unclassified |
| 82 | 2820854745 | Unclassified Actinobacteria Lab288P3bin234 | Isolate | Unclassified |
| 83 | 2820873081 | Unclassified Actinobacteria Lab288P1bin96 | Isolate | Unclassified |
| 84 | 2820921285 | Unclassified Actinobacteria Emb289P3bin53 | Isolate | Unclassified |
| 85 | 2864964650 | Tsukamurella ocularis S00236 | Isolate | Elmidae |
| 86 | 2873589062 | Phycicoccus sp. HDW14 | Isolate | Hydrophilidae |
| 87 | 2900354037 | Nocardia macrotermitis RB20 | Isolate | Termitidae |
| 88 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 89 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 90 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 91 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 92 | 3300012839 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG | Metagenome | Culicidae |
| 93 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 94 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 95 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 96 | 3300056814 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) | Metagenome | Tenebrionidae |
| 97 | 3300056857 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) | Metagenome | Tenebrionidae |
| 98 | 3300057007 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) | Metagenome | Tenebrionidae |
| 99 | 8109397740 | Rhodococcus triatomae DSM 44892 | Isolate | Unclassified |
| 100 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 101 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 102 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 103 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 104 | 2684622920 | Bifidobacterium asteroides Bi_200 | Isolate | Unclassified |
| 105 | 2718217749 | Coxiella mudrowiae CRt | Isolate | Ixodidae |
| 106 | 2802429577 | Bifidobacterium indicum DSM 20214 | Isolate | Unclassified |
| 107 | 2820610792 | Unclassified Firmicutes Emb289P1bin33 | Isolate | Unclassified |
| 108 | 2820806175 | Unclassified Actinobacteria Th196P3bin122 | Isolate | Unclassified |
| 109 | 2820809073 | Unclassified Actinobacteria Nt197P3bin55 | Isolate | Unclassified |
| 110 | 2820822094 | Unclassified Actinobacteria Nt197P3bin131 | Isolate | Unclassified |
| 111 | 2820867525 | Unclassified Actinobacteria Lab288P3bin128 | Isolate | Unclassified |
| 112 | 2864918810 | Tsukamurella ocularis S00175 | Isolate | Elmidae |
| 113 | 2873614151 | Leucobacter viscericola HDW9C | Isolate | Dytiscidae |
| 114 | 2879643867 | Bifidobacterium sp. wkB344 | Isolate | Apidae |
| 115 | 2884351759 | Cellulosimicrobium sp. BI34T | Isolate | Pyralidae |
| 116 | 2894897082 | Leucobacter sp. OLCS4 | Isolate | Anthocoridae |
| 117 | 2894974975 | Leucobacter sp. OLIS6 | Isolate | Anthocoridae |
| 118 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 119 | 3300012806 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E1 MG | Metagenome | |
| 120 | 3300012858 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG | Metagenome | Armadillidiidae |
| 121 | 3300060773 | Metatranscriptome of mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D15_HDPE_oats_a (Metagenome Metatranscriptome) | Metatranscriptome | Tenebrionidae |
| 122 | 8062747827 | Yimella sp. cx-51 | Isolate | Cambaridae |
| 123 | 2562617066 | Rickettsiella grylli AAQJ | Isolate | Armadillidiidae |
| 124 | 2660238275 | Bifidobacterium indicum DSM 20214 | Isolate | Unclassified |
| 125 | 2684622916 | Bifidobacterium asteroides Bi_170 | Isolate | Unclassified |
| 126 | 2684622917 | Bifidobacterium coryneforme Bi_197 | Isolate | Unclassified |
| 127 | 2693429521 | Bifidobacterium coryneforme DSM 20216 | Isolate | Unclassified |
| 128 | 2718217844 | Candidatus Baumannia cicadellinicola B-GSS | Isolate | Cicadellidae |
| 129 | 2788500098 | Bombiscardovia coagulans DSM 22924 | Isolate | Apidae |
| 130 | 2820236043 | Unclassified Firmicutes Th196P3bin97 | Isolate | Unclassified |
| 131 | 2820471304 | Unclassified Firmicutes Lab288P1bin89 | Isolate | Unclassified |
| 132 | 2820799971 | Unclassified Actinobacteria Th196P4bin46 | Isolate | Unclassified |
| 133 | 2820825283 | Unclassified Actinobacteria Nt197P3bin111 | Isolate | Unclassified |
| 134 | 2820831444 | Unclassified Actinobacteria Nc150P4bin21 | Isolate | Unclassified |
| 135 | 2820911766 | Unclassified Actinobacteria Emb289P3bin96 | Isolate | Unclassified |
| 136 | 2820916033 | Unclassified Actinobacteria Emb289P3bin63 | Isolate | Unclassified |
| 137 | 2820924633 | Unclassified Actinobacteria Emb289P3bin142 | Isolate | Unclassified |
| 138 | 2820939604 | Unclassified Actinobacteria Emb289P1bin4 | Isolate | Unclassified |
| 139 | 2873620646 | Leucobacter coleopterorum HDW9A | Isolate | Dytiscidae |
| 140 | 2894935787 | Leucobacter sp. OLJS4 | Isolate | Anthocoridae |
| 141 | 3300002932 | Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 | Metagenome | Formicidae |
| 142 | 3300005721 | Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 | Metagenome | Apidae |
| 143 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 144 | 3300012820 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E6 MG | Metagenome | Armadillidiidae |
| 145 | 3300012861 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG | Metagenome | Culicidae |
| 146 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 147 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 148 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 149 | 8024982947 | Bifidobacterium asteroides ESL0200 | Isolate | Apidae |
| 150 | 8110341875 | Bifidobacterium polysaccharolyticum W8117 | Isolate | Apidae |
| 151 | 2084038013 | Anoplophora glabripennis gut microbial communities from Worchester, Massachusetts, USA - Larvae | Metagenome | Cerambycidae |
| 152 | 2808606957 | Bifidobacterium sp. ESL0447 | Isolate | Unclassified |
| 153 | 2820838073 | Unclassified Actinobacteria Lab288P4bin27 | Isolate | Unclassified |
| 154 | 2820842553 | Unclassified Actinobacteria Lab288P4bin104 | Isolate | Unclassified |
| 155 | 2820848511 | Unclassified Actinobacteria Lab288P3bin86 | Isolate | Unclassified |
| 156 | 2820876581 | Unclassified Actinobacteria Lab288P1bin83 | Isolate | Unclassified |
| 157 | 2820917597 | Unclassified Actinobacteria Emb289P3bin57 | Isolate | Unclassified |
| 158 | 2820918931 | Unclassified Actinobacteria Emb289P3bin56 | Isolate | Unclassified |
| 159 | 2820941830 | Unclassified Actinobacteria Cu122P5bin49 | Isolate | Unclassified |
| 160 | 2864773010 | Tsukamurella ocularis S00022 | Isolate | Elmidae |
| 161 | 2894981435 | Leucobacter sp. OLDS2 | Isolate | Anthocoridae |
| 162 | 2909412500 | Yimella sp. cx-573 | Isolate | Cambaridae |
| 163 | 3002773460 | Coxiella endosymbiont of Amblyomma nuttalli Craf2019 | Isolate | Ixodidae |
| 164 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 165 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 166 | 3300012835 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG | Metagenome | Culicidae |
| 167 | 3300012849 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG | Metagenome | Culicidae |
| 168 | 3300022820 | Termite gut microbial communities from Nasutitermes sp. nest - French Guiana - 36-11 mRNA | Metatranscriptome | Termitidae |
| 169 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 170 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 171 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 172 | 2503538010 | Coriobacterium glomerans PW2, DSM 20642 | Isolate | Pyrrhocoridae |
| 173 | 2565956547 | Candidatus Profftella armatura | Isolate | Psyllidae |
| 174 | 2568526170 | Bifidobacterium sp. A11 | Isolate | Apidae |
| 175 | 2600255079 | Bifidobacterium bombi DSM 19703 | Isolate | Apidae |
| 176 | 2684622919 | Bifidobacterium asteroides Bi_199 | Isolate | Unclassified |
| 177 | 2731957681 | Xylanimicrobium pachnodae JCM 13526, NBRC 107786 | Isolate | Scarabaeidae |
| 178 | 2775506951 | Candidatus Coxiella mudrowiae CRS-CAT | Isolate | Unclassified |
| 179 | 2820856540 | Unclassified Actinobacteria Lab288P3bin21 | Isolate | Unclassified |
| 180 | 2873617540 | Leucobacter insecticola HDW9B | Isolate | Dytiscidae |
| 181 | 2883683260 | Protaetiibacter larvae KACC 19322 | Isolate | Scarabaeidae |
| 182 | 2888667245 | Corynebacterium diphtheriae FRC0190 | Isolate | Unclassified |
| 183 | 2894900265 | Leucobacter sp. OLTLW20 | Isolate | Anthocoridae |
| 184 | 2894929448 | Leucobacter sp. OAMSW11 | Isolate | Anthocoridae |
| 185 | 2915168811 | Leucobacter sp. cx-169 | Isolate | Cambaridae |
| 186 | 2984883310 | Serratia symbiotica SCifornacula/2912 | Isolate | Aphididae |
| 187 | 3300002501 | Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 | Metagenome | Termitidae |
| 188 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 189 | 3300007505 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut | Metagenome | Drosophilidae |
| 190 | 3300060896 | Metatranscriptome of mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D7_PS_c (Metagenome Metatranscriptome) | Metatranscriptome | Tenebrionidae |
| 191 | 8024986378 | Bifidobacterium asteroides ESL0198 | Isolate | Apidae |
| 192 | 8032009961 | Bifidobacterium indicum ESL0197 | Isolate | Apidae |
| 193 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 194 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 195 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 196 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0562375_0569 | 3300056856 | Bacteria | 72979 |
| 2 | Ga0466715_054330 | 3300042616 | Bacteria | 75121 |
| 3 | Ga0466718_144330 | 3300042617 | Unclassified | 1469 |
| 4 | Ga0466726_369433 | 3300042619 | Bacteria | 2857 |
| 5 | Ga0466728_375194 | 3300042620 | Unclassified | 3251 |
| 6 | Ga0160452_101282 | 3300012834 | Bacteria | 7681 |
| 7 | Ga0160472_100006 | 3300012839 | Bacteria | 656551 |
| 8 | Ga0160436_1000191 | 3300012861 | Bacteria | 30420 |
| 9 | Ga0466657_120132 | 3300042582 | Bacteria | 5822 |
| 10 | Ga0466693_189648 | 3300042592 | Bacteria | 16531 |
| 11 | Ga0466722_183422 | 3300042609 | Bacteria | 24688 |
| 12 | Ga0466698_344232 | 3300042610 | Bacteria | 2234 |
| 13 | Ga0123357_10784201 | 3300009784 | Bacteria | 650 |
| 14 | Ga0123356_10000385 | 3300010049 | Bacteria | 50352 |
| 15 | Ga0123353_10000803 | 3300010167 | Bacteria | 38182 |
| 16 | Ga0123354_10012403 | 3300010882 | Bacteria | 13208 |
| 17 | Ga0466729_266001 | 3300042621 | Bacteria | 1406 |
| 18 | Ga0466729_309738 | 3300042621 | Bacteria | 19337 |
| 19 | Ga0466735_002810 | 3300042624 | Bacteria | 2072 |
| 20 | Ga0466703_348284 | 3300042636 | Bacteria | 9095 |
| 21 | Ga0466704_008359 | 3300042643 | Bacteria | 5557 |
| 22 | Ga0466704_169176 | 3300042643 | Bacteria | 6365 |
| 23 | Ga0466704_344625 | 3300042643 | Bacteria | 5510 |
| 24 | Ga0466725_093133 | 3300042654 | Bacteria | 2294 |
| 25 | Ga0466705_110243 | 3300042612 | Bacteria | 15481 |
| 26 | Ga0466705_139183 | 3300042612 | Bacteria | 4539 |
| 27 | Ga0562374_2642 | 3300057007 | Unclassified | 14593 |
| 28 | JGI24702J35022_10012360 | 3300002462 | Bacteria | 4748 |
| 29 | JGI24703J35330_11381737 | 3300002501 | Bacteria | 937 |
| 30 | Ga0068302_10015651 | 3300005071 | Bacteria | 22613 |
| 31 | Ga0072940_1070821 | 3300005200 | Bacteria | 9131 |
| 32 | Ga0466711_433348 | 3300042615 | Bacteria | 2259 |
| 33 | Ga0466715_048937 | 3300042616 | Unclassified | 1279 |
| 34 | Ga0466723_289451 | 3300042618 | Bacteria | 49429 |
| 35 | Ga0466728_050465 | 3300042620 | Unclassified | 1793 |
| 36 | Ga0466728_403718 | 3300042620 | Unclassified | 2268 |
| 37 | Ga0466690_244523 | 3300042590 | Bacteria | 2282 |
| 38 | Ga0466692_203301 | 3300042591 | Bacteria | 6151 |
| 39 | Ga0466691_156376 | 3300042593 | Bacteria | 14099 |
| 40 | Ga0466716_440284 | 3300042605 | Bacteria | 1108 |
| 41 | Ga0466719_092416 | 3300042606 | Bacteria | 67606 |
| 42 | Ga0123357_10008408 | 3300009784 | Bacteria | 12887 |
| 43 | Ga0123355_10012685 | 3300009826 | Bacteria | 13065 |
| 44 | Ga0123356_10001550 | 3300010049 | Bacteria | 25300 |
| 45 | Ga0123356_10438181 | 3300010049 | Unclassified | 1452 |
| 46 | Ga0123353_10000855 | 3300010167 | Bacteria | 37005 |
| 47 | Ga0123353_12213326 | 3300010167 | Bacteria | 665 |
| 48 | Ga0466730_014716 | 3300042625 | Bacteria | 1309 |
| 49 | Ga0466703_133753 | 3300042636 | Bacteria | 110740 |
| 50 | Ga0466704_197616 | 3300042643 | Bacteria | 3232 |
| 51 | Ga0466705_173313 | 3300042612 | Unclassified | 1629 |
| 52 | Ga0562377_1726 | 3300056842 | Bacteria | 20503 |
| 53 | Ga0466705_392983 | 3300042612 | Unclassified | 2913 |
| 54 | Ga0466718_108836 | 3300042617 | Bacteria | 1548 |
| 55 | Ga0466723_219131 | 3300042618 | Bacteria | 6063 |
| 56 | Ga0160456_101617 | 3300012820 | Bacteria | 5114 |
| 57 | Ga0466692_056061 | 3300042591 | Bacteria | 3404 |
| 58 | Ga0466693_229757 | 3300042592 | Bacteria | 1608 |
| 59 | Ga0466696_099927 | 3300042596 | Bacteria | 3921 |
| 60 | Ga0466696_152694 | 3300042596 | Unclassified | 1084 |
| 61 | Ga0466706_268417 | 3300042599 | Bacteria | 2367 |
| 62 | Ga0466713_024575 | 3300042602 | Bacteria | 38766 |
| 63 | Ga0466719_468537 | 3300042606 | Bacteria | 80797 |
| 64 | Ga0466722_004093 | 3300042609 | Bacteria | 1048 |
| 65 | Ga0123355_10015705 | 3300009826 | Bacteria | 11904 |
| 66 | Ga0123356_10590637 | 3300010049 | Bacteria | 1275 |
| 67 | Ga0123354_10192554 | 3300010882 | Bacteria | 2276 |
| 68 | Ga0123354_10556472 | 3300010882 | Bacteria | 862 |
| 69 | Ga0466702_399695 | 3300042635 | Bacteria | 3391 |
| 70 | Ga0466704_403558 | 3300042643 | Unclassified | 1628 |
| 71 | Ga0466708_076169 | 3300042652 | Bacteria | 2278 |
| 72 | Ga0466708_097335 | 3300042652 | Bacteria | 43487 |
| 73 | Ga0466705_032213 | 3300042612 | Bacteria | 14399 |
| 74 | Ga0466705_046048 | 3300042612 | Bacteria | 4255 |
| 75 | Ga0466705_207419 | 3300042612 | Bacteria | 3859 |
| 76 | Ga0466705_220327 | 3300042612 | Bacteria | 34237 |
| 77 | Ga0466705_357805 | 3300042612 | Bacteria | 15135 |
| 78 | JGI24702J35022_10021090 | 3300002462 | Bacteria | 3536 |
| 79 | JGI24705J35276_12211380 | 3300002504 | Bacteria | 1854 |
| 80 | Ga0072940_1300899 | 3300005200 | Bacteria | 1493 |
| 81 | Ga0466705_481337 | 3300042612 | Bacteria | 2373 |
| 82 | Ga0466726_376208 | 3300042619 | Bacteria | 25969 |
| 83 | Ga0160433_104075 | 3300012846 | Bacteria | 2421 |
| 84 | Ga0160447_103016 | 3300012849 | Unclassified | 5589 |
| 85 | Ga0466693_215783 | 3300042592 | Unclassified | 1223 |
| 86 | Ga0466706_282606 | 3300042599 | Unclassified | 1404 |
| 87 | Ga0466700_200157 | 3300042600 | Bacteria | 2281 |
| 88 | Ga0466707_418658 | 3300042601 | Unclassified | 1148 |
| 89 | Ga0466714_003033 | 3300042603 | Bacteria | 3326 |
| 90 | Ga0123355_10071802 | 3300009826 | Unclassified | 5555 |
| 91 | Ga0123353_10018232 | 3300010167 | Bacteria | 10368 |
| 92 | Ga0123354_10000166 | 3300010882 | Bacteria | 53754 |
| 93 | Ga0466703_343943 | 3300042636 | Bacteria | 18085 |
| 94 | Ga0466708_290341 | 3300042652 | Bacteria | 1866 |
| 95 | Ga0466705_287983 | 3300042612 | Unclassified | 2351 |
| 96 | Ga0562376_0246 | 3300056857 | Bacteria | 106482 |
| 97 | AglaG_contig11531 | 2084038013 | Bacteria | 1271 |
| 98 | AustNasuHG_c1002003 | 3300000089 | Bacteria | 7329 |
| 99 | HBC_ctgsDRAFT_1089359 | 3300000333 | Bacteria | 722 |
| 100 | JGI24702J35022_10025499 | 3300002462 | Bacteria | 3190 |
| 101 | Ga0068302_10025260 | 3300005071 | Bacteria | 19492 |
| 102 | Ga0068302_10052865 | 3300005071 | Bacteria | 4851 |
| 103 | Ga0074278_141663 | 3300005721 | Bacteria | 6060 |
| 104 | Ga0466715_554750 | 3300042616 | Bacteria | 5267 |
| 105 | Ga0466718_111049 | 3300042617 | Bacteria | 1050 |
| 106 | Ga0466729_136485 | 3300042621 | Bacteria | 1311 |
| 107 | Ga0255809_1031655 | 3300022820 | Bacteria | 1708 |
| 108 | Ga0466693_070193 | 3300042592 | Bacteria | 6074 |
| 109 | Ga0466696_028301 | 3300042596 | Bacteria | 1023 |
| 110 | Ga0466696_277781 | 3300042596 | Bacteria | 1922 |
| 111 | Ga0466696_331555 | 3300042596 | Unclassified | 4057 |
| 112 | Ga0466706_262031 | 3300042599 | Bacteria | 4790 |
| 113 | Ga0466698_496384 | 3300042610 | Unclassified | 2360 |
| 114 | Ga0123355_10010726 | 3300009826 | Bacteria | 14078 |
| 115 | Ga0123355_10424151 | 3300009826 | Bacteria | 1697 |
| 116 | Ga0123355_10797917 | 3300009826 | Bacteria | 1054 |
| 117 | Ga0123356_10000248 | 3300010049 | Bacteria | 61776 |
| 118 | Ga0123356_10001142 | 3300010049 | Bacteria | 29321 |
| 119 | Ga0123353_10009329 | 3300010167 | Bacteria | 13526 |
| 120 | Ga0123353_10641770 | 3300010167 | Unclassified | 1505 |
| 121 | Ga0160442_100413 | 3300012806 | Unclassified | 14913 |
| 122 | Ga0466729_245691 | 3300042621 | Bacteria | 5360 |
| 123 | Ga0466734_103663 | 3300042623 | Bacteria | 1549 |
| 124 | Ga0466703_337453 | 3300042636 | Bacteria | 1052 |
| 125 | Ga0466703_351789 | 3300042636 | Bacteria | 1860 |
| 126 | Ga0466704_478900 | 3300042643 | Unclassified | 3379 |
| 127 | Ga0466709_314485 | 3300042648 | Bacteria | 14194 |
| 128 | Ga0466724_27060 | 3300042649 | Unclassified | 3532 |
| 129 | Ga0466705_279280 | 3300042612 | Bacteria | 14131 |
| 130 | Ga0562379_0010 | 3300056790 | Bacteria | 1659178 |
| 131 | Ga0562377_0137 | 3300056842 | Bacteria | 212469 |
| 132 | 2218088035 | 2209111014 | Bacteria | 3131 |
| 133 | JGI24699J35502_10528842 | 3300002509 | Bacteria | 634 |
| 134 | Ga0072940_1084680 | 3300005200 | Bacteria | 721 |
| 135 | Ga0466710_348449 | 3300042613 | Bacteria | 7553 |
| 136 | Ga0466728_045708 | 3300042620 | Unclassified | 1005 |
| 137 | Ga0466693_003338 | 3300042592 | Bacteria | 3149 |
| 138 | Ga0466693_275193 | 3300042592 | Bacteria | 1369 |
| 139 | Ga0466696_058492 | 3300042596 | Unclassified | 4746 |
| 140 | Ga0466696_064151 | 3300042596 | Bacteria | 18163 |
| 141 | Ga0466706_196232 | 3300042599 | Bacteria | 1874 |
| 142 | Ga0466707_101530 | 3300042601 | Bacteria | 1748 |
| 143 | Ga0466714_138868 | 3300042603 | Unclassified | 1438 |
| 144 | Ga0466719_003424 | 3300042606 | Unclassified | 8146 |
| 145 | Ga0123357_10050227 | 3300009784 | Bacteria | 5647 |
| 146 | Ga0123356_10042151 | 3300010049 | Bacteria | 4252 |
| 147 | Ga0123353_10015115 | 3300010167 | Bacteria | 11188 |
| 148 | Ga0123353_10032979 | 3300010167 | Bacteria | 8054 |
| 149 | Ga0466708_466452 | 3300042652 | Bacteria | 12044 |
| 150 | Ga0466705_129332 | 3300042612 | Unclassified | 1629 |
| 151 | Ga0466705_215684 | 3300042612 | Bacteria | 3507 |
| 152 | Ga0562376_0384 | 3300056857 | Bacteria | 83970 |
| 153 | Ga0562374_0182 | 3300057007 | Bacteria | 137963 |
| 154 | JGI24705J35276_12147416 | 3300002504 | Bacteria | 1167 |
| 155 | CVPL010L_1000290 | 3300002932 | Unclassified | 21869 |
| 156 | Ga0466711_474415 | 3300042615 | Bacteria | 1778 |
| 157 | Ga0466715_642187 | 3300042616 | Bacteria | 1511 |
| 158 | Ga0466718_152904 | 3300042617 | Bacteria | 12214 |
| 159 | Ga0466726_196699 | 3300042619 | Unclassified | 15690 |
| 160 | Ga0160452_101275 | 3300012834 | Bacteria | 7758 |
| 161 | Ga0160435_1000456 | 3300012857 | Unclassified | 13956 |
| 162 | Ga0160457_1005446 | 3300012858 | Unclassified | 1941 |
| 163 | Ga0466693_161371 | 3300042592 | Bacteria | 51371 |
| 164 | Ga0466696_348382 | 3300042596 | Unclassified | 1270 |
| 165 | Ga0466706_189120 | 3300042599 | Bacteria | 8969 |
| 166 | Ga0466707_037773 | 3300042601 | Unclassified | 5332 |
| 167 | Ga0466707_054562 | 3300042601 | Bacteria | 4253 |
| 168 | Ga0466707_124507 | 3300042601 | Bacteria | 1751 |
| 169 | Ga0466713_070719 | 3300042602 | Unclassified | 1870 |
| 170 | Ga0466713_121349 | 3300042602 | Bacteria | 4614 |
| 171 | Ga0466713_154030 | 3300042602 | Bacteria | 2248 |
| 172 | Ga0466717_102305 | 3300042604 | Bacteria | 35520 |
| 173 | Ga0123357_10346215 | 3300009784 | Bacteria | 1429 |
| 174 | Ga0123355_10269118 | 3300009826 | Unclassified | 2371 |
| 175 | Ga0123355_11100351 | 3300009826 | Bacteria | 827 |
| 176 | Ga0123353_10470733 | 3300010167 | Bacteria | 1842 |
| 177 | Ga0123354_10044180 | 3300010882 | Bacteria | 6837 |
| 178 | Ga0123354_10083377 | 3300010882 | Bacteria | 4499 |
| 179 | Ga0466731_302950 | 3300042622 | Bacteria | 3965 |
| 180 | Ga0466734_143044 | 3300042623 | Bacteria | 1010 |
| 181 | Ga0466703_312505 | 3300042636 | Bacteria | 4431 |
| 182 | Ga0466708_083377 | 3300042652 | Bacteria | 45280 |
| 183 | Ga0466705_045814 | 3300042612 | Unclassified | 2674 |
| 184 | Ga0466705_180592 | 3300042612 | Bacteria | 1166 |
| 185 | Ga0466705_283802 | 3300042612 | Unclassified | 3593 |
| 186 | Ga0562378_0001 | 3300056814 | Bacteria | 3579584 |
| 187 | Ga0562375_3802 | 3300056856 | Unclassified | 13087 |
| 188 | Ga0590797_08436 | 3300060773 | Bacteria | 789 |
| 189 | Ga0590775_02913 | 3300060896 | Bacteria | 2537 |
| 190 | JGI24695J34938_10072457 | 3300002450 | Bacteria | 1437 |
| 191 | JGI24702J35022_10000002 | 3300002462 | Bacteria | 104026 |
| 192 | Ga0105005_1052610 | 3300007505 | Bacteria | 2376 |
| 193 | Ga0466711_265300 | 3300042615 | Unclassified | 1134 |
| 194 | Ga0466715_317702 | 3300042616 | Bacteria | 7662 |
| 195 | Ga0466723_238899 | 3300042618 | Bacteria | 6171 |
| 196 | Ga0466723_370679 | 3300042618 | Bacteria | 2418 |
| 197 | Ga0466726_067981 | 3300042619 | Unclassified | 4225 |
| 198 | Ga0466728_043237 | 3300042620 | Bacteria | 51050 |
| 199 | Ga0466729_039665 | 3300042621 | Bacteria | 1501 |
| 200 | Ga0466729_190659 | 3300042621 | Bacteria | 3729 |
| 201 | Ga0160446_100161 | 3300012835 | Bacteria | 52061 |
| 202 | Ga0160446_101864 | 3300012835 | Bacteria | 4052 |
| 203 | Ga0466692_113392 | 3300042591 | Bacteria | 42952 |
| 204 | Ga0466696_111192 | 3300042596 | Bacteria | 22526 |
| 205 | Ga0466696_170357 | 3300042596 | Unclassified | 3121 |
| 206 | Ga0466696_209421 | 3300042596 | Bacteria | 9362 |
| 207 | Ga0466696_258511 | 3300042596 | Unclassified | 1363 |
| 208 | Ga0466696_262377 | 3300042596 | Bacteria | 1115 |
| 209 | Ga0466696_386734 | 3300042596 | Bacteria | 1108 |
| 210 | Ga0466706_102043 | 3300042599 | Bacteria | 17149 |
| 211 | Ga0466714_156273 | 3300042603 | Bacteria | 2034 |
| 212 | Ga0466717_047893 | 3300042604 | Bacteria | 5943 |
| 213 | Ga0466717_189836 | 3300042604 | Bacteria | 4136 |
| 214 | Ga0466719_561107 | 3300042606 | Bacteria | 1041 |
| 215 | Ga0123357_10461994 | 3300009784 | Bacteria | 1090 |
| 216 | Ga0123355_10003978 | 3300009826 | Bacteria | 21391 |
| 217 | Ga0123355_10109441 | 3300009826 | Unclassified | 4322 |
| 218 | Ga0123356_10012934 | 3300010049 | Bacteria | 8080 |
| 219 | Ga0123356_10861095 | 3300010049 | Bacteria | 1077 |
| 220 | Ga0123353_10003840 | 3300010167 | Bacteria | 19170 |
| 221 | Ga0123353_10663953 | 3300010167 | Bacteria | 1472 |
| 222 | Ga0466734_145748 | 3300042623 | Bacteria | 1265 |
| 223 | Ga0466704_196595 | 3300042643 | Bacteria | 2160 |
| 224 | Ga0466725_161751 | 3300042654 | Bacteria | 1739 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00177 | Ribosomal_S7 | Ribosomal protein S7p/S5e | 3 | 187 | 0.98 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.