Protein Family IF11350

Metagenome Isolate
408 Members
199 Samples
311 Scaffolds
180.07 Avg Length

🧬 Representative Sequence

ID
iso_pr_bacteria|2718217749|2718707349|
Length
200 aa
Sequence
MAQKSEYLPQMAKSLTYKAKNMVELQELYKKTIIPTLQKEFGFKSVMAVPGIEKITLNMGIGEAVADKKVIERAMEDMMRISGQKPIITYARKSEAGFKIRTGWPIGCKVTLRRERMYEFLKRLISIAIPRIRDFRGFNAKSFDGRGNFSLGIREQIVFPEIQYDKIDAIRGMDITITTRARTNEEGQALLKAFGFPLKD

📊 Sample Types

Isolate 23.8%
Metagenome 76.2%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 19.2%
Termitidae 15.5%
Coreidae 13.0%
Formicidae 8.8%
Kalotermitidae 7.3%
Elmidae 6.2%
Culicidae 5.7%
Sarcophagidae 3.1%
Drosophilidae 3.1%
Termopsidae 2.1%
Curculionidae 2.1%
Armadillidiidae 2.1%
Rhinotermitidae 1.6%
Psyllidae 1.6%
Largidae 1.0%
Apidae 1.0%
Ixodidae 1.0%
Alydidae 1.0%
Passalidae 1.0%
Stratiomyidae 0.5%
Pediculidae 0.5%
Crambidae 0.5%
Noctuidae 0.5%
Hydrophilidae 0.5%
Hodotermitidae 0.5%
Cixiidae 0.5%

🌳 Taxonomy

Archaea 0
Bacteria 345
Eukaryota 0
Viruses 0
Unclassified 63

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2831380896 Ignatzschineria ureiclastica KCTC 22644 Isolate Sarcophagidae
2 2864863795 Acinetobacter johnsonii S00116 Isolate Elmidae
3 2820065746 Unclassified Proteobacteria Nt197P3bin56 Isolate Unclassified
4 2820084079 Unclassified Proteobacteria Lab288P4bin103 Isolate Unclassified
5 3003869270 Paraburkholderia sp. PGU16 Isolate Largidae
6 3006156446 Acinetobacter baretiae B10A Isolate Apidae
7 3300000333 Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony Metagenome Apidae
8 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
9 3300007142 Ant gut microbial communities from Cephalotes grandinosus, Brazil Metagenome Formicidae
10 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
11 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
12 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
13 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
14 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
15 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
16 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
17 8025685901 Caballeronia fortuita LZ035 Isolate Coreidae
18 8078130113 Caballeronia sp. INDeC2 Isolate Coreidae
19 8100455565 Delftia sp. S67 Isolate Curculionidae
20 8102102351 Caballeronia sp. INML1 Isolate Coreidae
21 8102174626 Caballeronia sp. LZ024 Isolate Coreidae
22 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
23 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
24 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
25 2864843793 Acinetobacter johnsonii S00075 Isolate Elmidae
26 2864870719 Comamonas odontotermitis S00124 Isolate Elmidae
27 2864937364 Acidovorax soli S00198 Isolate Elmidae
28 2891720358 Azoarcus nasutitermitis CC-YHH838 Isolate Unclassified
29 2791354930 Wohlfahrtiimonas larvae kbl006 Isolate Stratiomyidae
30 2820042117 Unclassified Proteobacteria Th196P4bin58 Isolate Unclassified
31 2820050117 Unclassified Proteobacteria Th196P3bin129 Isolate Unclassified
32 2820086750 Unclassified Proteobacteria Lab288P3bin98 Isolate Unclassified
33 2820157249 Unclassified Proteobacteria Cu122P4bin11 Isolate Unclassified
34 2820161938 Unclassified Proteobacteria Cu122P3bin14 Isolate Unclassified
35 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
36 3300007130 Drosophila gut microbial communities from New York, USA - Drosophila falleni male 4 gut Metagenome Drosophilidae
37 3300012857 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG Metagenome Culicidae
38 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
39 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
40 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
41 641522603 Acinetobacter baumannii SDF Isolate Pediculidae
42 8025650824 Caballeronia hypogeia LZ032 Isolate Coreidae
43 8025671076 Caballeronia cordobensis LZ034LL Isolate Coreidae
44 8102117041 Caballeronia sp. INML3 Isolate Coreidae
45 8102138357 Caballeronia sp. INSB1 Isolate Coreidae
46 8102216467 Caballeronia sp. LZ033 Isolate Coreidae
47 8102230706 Caballeronia sp. LZ035 Isolate Coreidae
48 8102239244 Caballeronia sp. LZ043 Isolate Coreidae
49 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
50 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
51 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
52 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
53 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
54 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
55 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
56 2832039703 Ignatzschineria cameli UAE-HKU59 Isolate Sarcophagidae
57 2848339753 Ephemeroptericola cinctiostellae F02 Isolate Unclassified
58 2864804954 Acinetobacter johnsonii S00050 Isolate Elmidae
59 2864914039 Chromobacterium alkanivorans S00172 Isolate Elmidae
60 2864973726 Acinetobacter schindleri S00243 Isolate Elmidae
61 2864988360 Chromobacterium alkanivorans S00296 Isolate Elmidae
62 2648501628 Xanthomonas sp. Cag60 Isolate Unclassified
63 2820103659 Unclassified Proteobacteria Emb289P4bin67 Isolate Unclassified
64 2820123897 Unclassified Proteobacteria Emb289P4bin18 Isolate Unclassified
65 2820164216 Unclassified Proteobacteria Cu122P1bin22 Isolate Unclassified
66 2820259584 Unclassified Firmicutes Th196P3bin43 Isolate Unclassified
67 3002773460 Coxiella endosymbiont of Amblyomma nuttalli Craf2019 Isolate Ixodidae
68 3006190525 Acinetobacter sp. S54 Isolate Curculionidae
69 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
70 3300007085 Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut Metagenome Drosophilidae
71 3300007088 Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 4 gut Metagenome Drosophilidae
72 3300007141 Ant gut microbial communities from Cephalotes maculatus, Brazil Metagenome Formicidae
73 3300007188 Ant gut microbial communities from Cephalotes rohweri, Arizona, USA Metagenome Formicidae
74 3300012835 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG Metagenome Culicidae
75 3300012837 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG Metagenome Armadillidiidae
76 3300012849 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG Metagenome Culicidae
77 3300012850 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E0 MG Metagenome Culicidae
78 3300012854 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG Metagenome Culicidae
79 8025694439 Caballeronia cordobensis LZ033 Isolate Coreidae
80 8025701579 Caballeronia telluris LZ031 Isolate Coreidae
81 8102201977 Caballeronia sp. LZ031 Isolate Coreidae
82 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
83 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
84 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
85 2834230000 Pandoraea novymonadis E262 Isolate Unclassified
86 2855798354 Achromobacter insolitus AR476-2 Isolate Crambidae
87 2513237114 Ignatzschineria larvae DSM 13226 Isolate Sarcophagidae
88 2531839311 Acinetobacter sp. HA Isolate Noctuidae
89 2597489944 Caballeronia insecticola RPE64 Isolate Alydidae
90 2820062699 Unclassified Proteobacteria Nt197P4bin15 Isolate Unclassified
91 2820077244 Unclassified Proteobacteria Lab288P4bin72 Isolate Unclassified
92 2820152154 Unclassified Proteobacteria Cu122P5bin47 Isolate Unclassified
93 2820432912 Unclassified Firmicutes Lab288P3bin219 Isolate Unclassified
94 2820530790 Unclassified Firmicutes Lab288P1bin141 Isolate Unclassified
95 3003878002 Paraburkholderia sp. PGU19 Isolate Largidae
96 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
97 3300007067 Ant gut microbial communities from Cephalotes spinosus, Peru Metagenome Formicidae
98 3300007068 Ant gut microbial communities from Cephalotes simillimus, Peru Metagenome Formicidae
99 3300007139 Ant gut microbial communities from Cephalotes pellans, Brazil Metagenome Formicidae
100 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
101 3300012820 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E6 MG Metagenome Armadillidiidae
102 3300012825 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG Metagenome
103 3300012845 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG Metagenome Culicidae
104 3300012861 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG Metagenome Culicidae
105 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
106 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
107 8024031916 Cupriavidus pauculus BHJ32i Isolate Alydidae
108 8100449422 Delftia sp. S66 Isolate Curculionidae
109 2873571580 Diaphorobacter sp. HDW4B Isolate Hydrophilidae
110 2517487021 Wohlfahrtiimonas chitiniclastica DSM 18708 Isolate Sarcophagidae
111 2773857880 Candidatus Profftella armatura YCPA Isolate Psyllidae
112 2820047982 Unclassified Proteobacteria Th196P3bin67 Isolate Unclassified
113 3300002931 Ant worker gut metagenome for colony PL010 Metagenome Formicidae
114 3300002934 Ant worker gut metagenome for colony PL005 Metagenome Formicidae
115 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
116 3300007052 Ant gut microbial communities from Cephalotes eduarduli, Brazil Metagenome Formicidae
117 3300007080 Ant gut microbial communities from Cephalotes clypeatus, Brazil Metagenome Formicidae
118 3300007190 Ant gut microbial communities from Cephalotes umbraculatus, Peru Metagenome Formicidae
119 3300007192 Ant gut microbial communities from Cephalotes persimplex, Brazil Metagenome Formicidae
120 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
121 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
122 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
123 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
124 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
125 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
126 8021899934 Acinetobacter sp. AR2-3 Isolate Culicidae
127 8102208438 Caballeronia sp. LZ032 Isolate Coreidae
128 8102251710 Caballeronia sp. LZ065 Isolate Coreidae
129 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
130 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
131 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
132 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
133 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
134 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
135 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
136 2864840607 Acinetobacter johnsonii S00071 Isolate Elmidae
137 2518285616 Brachymonas chironomi DSM 19884 Isolate Unclassified
138 2603880165 Burkholderiales A1 Isolate Unclassified
139 2603880170 Burkholderiales A2 Isolate Unclassified
140 2603880172 Burkholderiales C Isolate Unclassified
141 2617270844 Dyella sp. HyOG Isolate Cixiidae
142 2775506951 Candidatus Coxiella mudrowiae CRS-CAT Isolate Unclassified
143 2820082748 Unclassified Proteobacteria Lab288P4bin14 Isolate Unclassified
144 2820089333 Unclassified Proteobacteria Lab288P3bin88 Isolate Unclassified
145 2565956547 Candidatus Profftella armatura Isolate Psyllidae
146 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
147 3300007129 Ant gut microbial communities from Cephalotes atratus, Brazil Metagenome Formicidae
148 3300007150 Drosophila gut microbial communities from New York, USA - Drosophila falleni female 3 gut Metagenome Drosophilidae
149 3300007505 Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut Metagenome Drosophilidae
150 3300012798 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E6 MG Metagenome
151 3300012805 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG Metagenome
152 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
153 8025658853 Caballeronia temeraria LZ065 Isolate Coreidae
154 8025708040 Caballeronia jiangsuensis LZ029 Isolate Coreidae
155 8102124461 Caballeronia sp. INML3B Isolate Coreidae
156 8102193924 Caballeronia sp. LZ029 Isolate Coreidae
157 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
158 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
159 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
160 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
161 2833478085 Oceanospirillum multiglobuliferum ATCC 33336 Isolate Unclassified
162 2864859030 Chromobacterium alkanivorans S00115 Isolate Elmidae
163 2864960361 Comamonas odontotermitis S00229 Isolate Elmidae
164 2868169047 Comamonas aquatica S00077 Isolate Elmidae
165 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
166 2687453742 Burkholderiales bacterium B_Cag20 Isolate Unclassified
167 2718217749 Coxiella mudrowiae CRt Isolate Ixodidae
168 2820093073 Unclassified Proteobacteria Lab288P3bin233 Isolate Unclassified
169 3300007083 Ant gut microbial communities from Cephalotes persimilis, Brazil Metagenome Formicidae
170 3300007140 Ant gut microbial communities from Cephalotes pallens, Brazil Metagenome Formicidae
171 3300007143 Drosophila gut microbial communities from New York, USA - Drosophila putrida female 3 gut Metagenome Drosophilidae
172 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
173 3300012806 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E1 MG Metagenome
174 3300012812 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E11 MG Metagenome Culicidae
175 3300012832 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E6 MG Metagenome Culicidae
176 3300012858 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG Metagenome Armadillidiidae
177 8025678175 Caballeronia hypogeia LZ043 Isolate Coreidae
178 8025728939 Caballeronia telluris LZ024 Isolate Coreidae
179 8100461708 Delftia sp. S65 Isolate Curculionidae
180 2832037495 Ignatzschineria indica KCTC 22643 Isolate Sarcophagidae
181 2838140227 Dyella sp. OAE510 Isolate Unclassified
182 2209111014 Host-associated microbial communities from Diaphorina citri thoracic segments in Florida, USA - ACP Metagenome Psyllidae
183 2582581321 Oceanospirillum multiglobuliferum ATCC 33336 Isolate Unclassified
184 2687453753 Burkholderiales bacterium B_Cag25 Isolate Unclassified
185 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
186 3300002938 Larval gut metagenome for colony PL005 Metagenome Formicidae
187 3300007095 Ant gut microbial communities from Cephalotes minutus, Brazil Metagenome Formicidae
188 3300012813 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG Metagenome Culicidae
189 3300012841 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG Metagenome Armadillidiidae
190 3300012852 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG Metagenome
191 8065340634 Ignatzschineria ureiclastica KCTC 22644 Isolate Sarcophagidae
192 8102094248 Caballeronia sp. GaOx3 Isolate Coreidae
193 8102109360 Caballeronia sp. INML2 Isolate Coreidae
194 8102223607 Caballeronia sp. LZ034LL Isolate Coreidae
195 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
196 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
197 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
198 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
199 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466697_099832 3300042611 Bacteria 2564
2 Ga0466705_276363 3300042612 Bacteria 19722
3 Ga0466733_059229 3300042659 Bacteria 36946
4 Ga0466710_458456 3300042613 Unclassified 1223
5 Ga0466715_030743 3300042616 Bacteria 4935
6 Ga0466726_067584 3300042619 Bacteria 4925
7 Ga0466701_048756 3300042598 Bacteria 9025
8 Ga0466701_057745 3300042598 Bacteria 2351
9 Ga0466701_060092 3300042598 Bacteria 2343
10 Ga0466717_222936 3300042604 Bacteria 2706
11 Ga0466717_280629 3300042604 Unclassified 3870
12 Ga0160470_102347 3300012813 Unclassified 3628
13 Ga0160458_100594 3300012832 Unclassified 13044
14 Ga0160447_107843 3300012849 Unclassified 2622
15 Ga0160434_119020 3300012850 Unclassified 1059
16 Ga0160436_1000158 3300012861 Bacteria 34161
17 Ga0466657_295945 3300042582 Bacteria 10947
18 Ga0466692_193948 3300042591 Bacteria 9758
19 Ga0466695_379396 3300042595 Unclassified 2769
20 Ga0466696_283703 3300042596 Bacteria 19581
21 Ga0466734_083453 3300042623 Bacteria 6358
22 Ga0466734_128631 3300042623 Unclassified 1951
23 Ga0466702_420939 3300042635 Bacteria 6684
24 Ga0466725_025670 3300042654 Bacteria 15034
25 Ga0466725_408172 3300042654 Bacteria 1529
26 Ga0466727_137609 3300042655 Bacteria 15927
27 Ga0123357_10018066 3300009784 Bacteria 9365
28 Ga0123356_10005609 3300010049 Bacteria 12758
29 Ga0123356_10979075 3300010049 Bacteria 1016
30 Ga0123353_10354942 3300010167 Unclassified 2207
31 JGI24702J35022_10074246 3300002462 Bacteria 1835
32 CVPL010W_10005074 3300002931 Bacteria 14271
33 CVPL005W_1001807 3300002934 Unclassified 6782
34 Ga0068302_10000086 3300005071 Bacteria 8701
35 Ga0103265_1000457 3300007068 Unclassified 6945
36 Ga0102734_1000029 3300007129 Bacteria 68380
37 Ga0102738_1000014 3300007141 Bacteria 90212
38 Ga0103264_1000587 3300007188 Bacteria 23529
39 Ga0103268_1005849 3300007192 Bacteria 2491
40 Ga0123357_10000005 3300009784 Bacteria 295874
41 Ga0123357_10001915 3300009784 Bacteria 22651
42 Ga0466723_001810 3300042618 Bacteria 1041
43 Ga0466726_032824 3300042619 Bacteria 12093
44 Ga0466726_188842 3300042619 Bacteria 15083
45 Ga0466729_129497 3300042621 Bacteria 7258
46 Ga0466701_092728 3300042598 Bacteria 2092
47 Ga0466714_165404 3300042603 Bacteria 1984
48 Ga0466719_055618 3300042606 Bacteria 10384
49 Ga0160441_100201 3300012825 Unclassified 60884
50 Ga0160455_100048 3300012837 Bacteria 254011
51 Ga0160435_1001779 3300012857 Bacteria 5325
52 Ga0466690_406175 3300042590 Bacteria 69346
53 Ga0466701_005098 3300042598 Unclassified 2222
54 Ga0466734_029421 3300042623 Bacteria 26553
55 Ga0466704_473875 3300042643 Bacteria 7315
56 Ga0466709_407126 3300042648 Bacteria 3997
57 Ga0466724_62199 3300042649 Bacteria 9065
58 Ga0466708_158539 3300042652 Bacteria 14078
59 Ga0466708_215602 3300042652 Bacteria 15739
60 Ga0466725_167598 3300042654 Bacteria 15022
61 Ga0466727_335351 3300042655 Bacteria 67580
62 Ga0123353_10389727 3300010167 Bacteria 2079
63 JGI24702J35022_10008095 3300002462 Bacteria 5983
64 Ga0102735_1005860 3300007080 Unclassified 2343
65 Ga0103261_1000039 3300007083 Bacteria 43477
66 Ga0102739_1000001 3300007095 Bacteria 120035
67 Ga0104042_1073570 3300007130 Unclassified 709
68 Ga0102738_1004908 3300007141 Unclassified 1899
69 Ga0102738_1032118 3300007141 Unclassified 789
70 Ga0102737_1003109 3300007142 Bacteria 3899
71 Ga0104019_1191147 3300007150 Bacteria 1928
72 Ga0103264_1000443 3300007188 Bacteria 21903
73 Ga0103268_1049146 3300007192 Unclassified 1667
74 Ga0105005_1097781 3300007505 Unclassified 1204
75 Ga0466697_090556 3300042611 Bacteria 7645
76 Ga0466710_038761 3300042613 Bacteria 64329
77 Ga0466710_058355 3300042613 Bacteria 1849
78 Ga0466710_115345 3300042613 Bacteria 8153
79 Ga0466711_226259 3300042615 Bacteria 4193
80 Ga0466729_051623 3300042621 Unclassified 2596
81 Ga0466729_084932 3300042621 Bacteria 104590
82 Ga0466701_038995 3300042598 Bacteria 5162
83 Ga0466706_278377 3300042599 Bacteria 1359
84 Ga0466707_258979 3300042601 Bacteria 7487
85 Ga0466719_486350 3300042606 Bacteria 13185
86 Ga0466722_202204 3300042609 Bacteria 5956
87 Ga0160456_100416 3300012820 Bacteria 14373
88 Ga0160446_103994 3300012835 Bacteria 2246
89 Ga0160430_109942 3300012852 Unclassified 1672
90 Ga0160448_100555 3300012854 Bacteria 12673
91 Ga0160448_131554 3300012854 Bacteria 764
92 Ga0160435_1013143 3300012857 Unclassified 1644
93 Ga0415639_084109 3300038395 Bacteria 5592
94 Ga0466657_051167 3300042582 Bacteria 10371
95 Ga0466657_320365 3300042582 Bacteria 1515
96 Ga0466657_322606 3300042582 Bacteria 9653
97 Ga0466690_149138 3300042590 Bacteria 14715
98 Ga0466690_289774 3300042590 Bacteria 3568
99 Ga0466690_321140 3300042590 Bacteria 25918
100 Ga0466701_001027 3300042598 Bacteria 90142
101 Ga0466734_005435 3300042623 Bacteria 6040
102 Ga0466734_030009 3300042623 Unclassified 1693
103 Ga0466704_332081 3300042643 Bacteria 1506
104 Ga0466725_164280 3300042654 Bacteria 17642
105 Ga0466725_185939 3300042654 Bacteria 36509
106 Ga0466725_296922 3300042654 Bacteria 3248
107 Ga0123357_10219977 3300009784 Unclassified 2109
108 Ga0123353_10008266 3300010167 Bacteria 14186
109 Ga0123354_10026109 3300010882 Bacteria 9212
110 Ga0123354_10038081 3300010882 Bacteria 7471
111 JGI24702J35022_10033351 3300002462 Bacteria 2755
112 JGI24705J35276_12235518 3300002504 Bacteria 6624
113 CVPL005L_10000093 3300002938 Bacteria 63243
114 Ga0072941_1141096 3300005201 Bacteria 10652
115 Ga0102735_1002079 3300007080 Unclassified 7934
116 Ga0104047_1124693 3300007088 Unclassified 885
117 Ga0102734_1000504 3300007129 Bacteria 12926
118 Ga0103260_1005442 3300007139 Unclassified 1873
119 Ga0102737_1001244 3300007142 Unclassified 7310
120 Ga0103267_1000450 3300007190 Unclassified 13045
121 Ga0103268_1001471 3300007192 Unclassified 5814
122 Ga0466697_086601 3300042611 Bacteria 3052
123 Ga0466710_042268 3300042613 Unclassified 5941
124 Ga0466711_063795 3300042615 Bacteria 5388
125 Ga0466715_438666 3300042616 Bacteria 23685
126 Ga0466723_020620 3300042618 Bacteria 11703
127 Ga0466726_047171 3300042619 Bacteria 2325
128 Ga0466726_079457 3300042619 Bacteria 4157
129 Ga0466728_181251 3300042620 Bacteria 18833
130 Ga0466701_045249 3300042598 Unclassified 102024
131 Ga0466701_053737 3300042598 Bacteria 3550
132 Ga0466719_112619 3300042606 Bacteria 9806
133 Ga0466657_021707 3300042582 Bacteria 36648
134 Ga0466657_144931 3300042582 Bacteria 5126
135 Ga0466657_165250 3300042582 Bacteria 1218
136 Ga0466691_077504 3300042593 Bacteria 2153
137 Ga0466691_106582 3300042593 Bacteria 7070
138 Ga0466696_110075 3300042596 Bacteria 5185
139 Ga0466699_121087 3300042597 Bacteria 3662
140 Ga0466729_282678 3300042621 Unclassified 1429
141 Ga0466731_247532 3300042622 Unclassified 1310
142 Ga0466730_040457 3300042625 Bacteria 1598
143 Ga0466703_060848 3300042636 Bacteria 8939
144 Ga0466703_320420 3300042636 Bacteria 23900
145 Ga0466704_195288 3300042643 Bacteria 25757
146 Ga0466709_172994 3300042648 Bacteria 28560
147 Ga0466725_087681 3300042654 Bacteria 5011
148 Ga0123355_10317937 3300009826 Bacteria 2101
149 Ga0123356_10020919 3300010049 Bacteria 6189
150 Ga0123354_10116493 3300010882 Bacteria 3484
151 Ga0160454_100702 3300012798 Bacteria 7292
152 Ga0160471_108544 3300012812 Unclassified 1189
153 2217907778 2209111014 Unclassified 2556
154 JGI24702J35022_10004800 3300002462 Bacteria 7988
155 Ga0104045_1080481 3300007085 Unclassified 1197
156 Ga0102734_1034942 3300007129 Unclassified 1303
157 Ga0103260_1000020 3300007139 Bacteria 70191
158 Ga0102737_1000494 3300007142 Bacteria 12852
159 Ga0103268_1000925 3300007192 Unclassified 8015
160 Ga0466697_178025 3300042611 Bacteria 8041
161 Ga0466732_077377 3300042656 Bacteria 3461
162 Ga0466705_389907 3300042612 Bacteria 51380
163 Ga0466710_017414 3300042613 Bacteria 1039
164 Ga0466710_276996 3300042613 Bacteria 1413
165 Ga0466711_247281 3300042615 Bacteria 5801
166 Ga0466715_193807 3300042616 Bacteria 17352
167 Ga0466723_124011 3300042618 Bacteria 17539
168 Ga0466706_231592 3300042599 Bacteria 4461
169 Ga0466700_386178 3300042600 Bacteria 3495
170 Ga0466719_047699 3300042606 Bacteria 11168
171 Ga0466719_079825 3300042606 Bacteria 11953
172 Ga0466722_141657 3300042609 Bacteria 8529
173 Ga0466657_099882 3300042582 Unclassified 1499
174 Ga0466692_184437 3300042591 Bacteria 20938
175 Ga0466694_302740 3300042594 Bacteria 3330
176 Ga0466734_079060 3300042623 Bacteria 8664
177 Ga0466735_033269 3300042624 Bacteria 5749
178 Ga0466730_059466 3300042625 Bacteria 59728
179 Ga0466704_150483 3300042643 Bacteria 8168
180 Ga0466708_308504 3300042652 Bacteria 17035
181 Ga0466708_431611 3300042652 Bacteria 17147
182 Ga0466725_146840 3300042654 Bacteria 3520
183 Ga0466725_366896 3300042654 Unclassified 3228
184 Ga0466725_399048 3300042654 Bacteria 14201
185 2227301894 2225789004 Bacteria 1221
186 JGI24696J40584_12933683 3300002834 Unclassified 1525
187 Ga0072941_1289878 3300005201 Bacteria 6081
188 Ga0103266_1000200 3300007067 Bacteria 16981
189 Ga0102735_1000064 3300007080 Bacteria 53865
190 Ga0103261_1000695 3300007083 Unclassified 9466
191 Ga0102740_1001232 3300007140 Unclassified 6635
192 Ga0103264_1000188 3300007188 Bacteria 52510
193 Ga0466705_144704 3300042612 Bacteria 26960
194 Ga0466733_093838 3300042659 Bacteria 4293
195 Ga0466712_182347 3300042614 Bacteria 11394
196 Ga0466711_109307 3300042615 Bacteria 29995
197 Ga0466715_109155 3300042616 Bacteria 3627
198 Ga0466715_269641 3300042616 Bacteria 3729
199 Ga0466729_037640 3300042621 Bacteria 1242
200 Ga0466717_058368 3300042604 Bacteria 4391
201 Ga0466716_288795 3300042605 Bacteria 12220
202 Ga0466719_142224 3300042606 Bacteria 4621
203 Ga0466722_155417 3300042609 Bacteria 2209
204 Ga0466722_196355 3300042609 Bacteria 12120
205 Ga0160470_108444 3300012813 Unclassified 1040
206 Ga0160458_100003 3300012832 Bacteria 774753
207 Ga0160460_112876 3300012845 Unclassified 985
208 Ga0160430_100531 3300012852 Bacteria 20613
209 Ga0160457_1000003 3300012858 Bacteria 1020748
210 Ga0415639_012149 3300038395 Bacteria 25902
211 Ga0466657_056362 3300042582 Bacteria 20258
212 Ga0466691_156291 3300042593 Bacteria 26465
213 Ga0466695_078306 3300042595 Bacteria 5706
214 Ga0466701_004340 3300042598 Bacteria 2227
215 Ga0466734_034177 3300042623 Unclassified 2257
216 Ga0466734_076859 3300042623 Bacteria 25073
217 Ga0466734_128421 3300042623 Bacteria 1979
218 Ga0466735_207643 3300042624 Unclassified 1718
219 Ga0466709_083350 3300042648 Bacteria 4650
220 Ga0466709_217396 3300042648 Bacteria 210619
221 Ga0466724_07269 3300042649 Unclassified 5832
222 Ga0466725_049736 3300042654 Bacteria 2193
223 Ga0466725_272788 3300042654 Bacteria 15338
224 Ga0123357_10668122 3300009784 Bacteria 760
225 Ga0123356_10811307 3300010049 Unclassified 1107
226 Ga0123354_10120119 3300010882 Bacteria 3400
227 Ga0160464_100135 3300012805 Bacteria 81696
228 HBC_ctgsDRAFT_1021392 3300000333 Bacteria 1580
229 CVPL010W_10006354 3300002931 Bacteria 21839
230 Ga0103266_1000773 3300007067 Unclassified 6173
231 Ga0103265_1026679 3300007068 Unclassified 772
232 Ga0102739_1000846 3300007095 Unclassified 5451
233 Ga0102739_1008447 3300007095 Unclassified 1356
234 Ga0103260_1000257 3300007139 Bacteria 20061
235 Ga0104048_1168521 3300007143 Bacteria 4147
236 Ga0103264_1000021 3300007188 Bacteria 137150
237 Ga0466705_069381 3300042612 Unclassified 7318
238 Ga0466710_211598 3300042613 Bacteria 14971
239 Ga0466723_233813 3300042618 Bacteria 18111
240 Ga0466701_066530 3300042598 Bacteria 6962
241 Ga0466701_083530 3300042598 Bacteria 21770
242 Ga0466701_093913 3300042598 Bacteria 9709
243 Ga0466707_398396 3300042601 Bacteria 9298
244 Ga0466717_091910 3300042604 Bacteria 9410
245 Ga0160447_119094 3300012849 Unclassified 1147
246 Ga0466656_233770 3300042550 Bacteria 3515
247 Ga0466657_044938 3300042582 Unclassified 3573
248 Ga0466657_390228 3300042582 Bacteria 1578
249 Ga0466692_128697 3300042591 Bacteria 29218
250 Ga0466693_116240 3300042592 Unclassified 4740
251 Ga0466696_042576 3300042596 Bacteria 13410
252 Ga0466734_085482 3300042623 Bacteria 4977
253 Ga0466730_008869 3300042625 Bacteria 313970
254 Ga0466703_276609 3300042636 Bacteria 60964
255 Ga0466704_501270 3300042643 Bacteria 6076
256 Ga0466725_128862 3300042654 Unclassified 4263
257 Ga0466725_172464 3300042654 Bacteria 4063
258 Ga0466725_183948 3300042654 Bacteria 1926
259 Ga0123356_10098973 3300010049 Bacteria 2794
260 Ga0123356_11324145 3300010049 Bacteria 883
261 Ga0123354_10002414 3300010882 Bacteria 24635
262 IMNBL1DRAFT_c0010256 3300000062 Bacteria 4516
263 CVPL010W_10012209 3300002931 Bacteria 6905
264 CVPL010W_10032043 3300002931 Bacteria 2007
265 CVPL005W_1000434 3300002934 Unclassified 16988
266 Ga0068305_10277852 3300005083 Bacteria 15502
267 Ga0072941_1125686 3300005201 Bacteria 4666
268 Ga0072941_1340102 3300005201 Bacteria 2801
269 Ga0102736_1000277 3300007052 Bacteria 11410
270 Ga0102739_1000381 3300007095 Bacteria 9630
271 Ga0102739_1002286 3300007095 Unclassified 2989
272 Ga0102734_1011377 3300007129 Bacteria 3259
273 Ga0103264_1013761 3300007188 Bacteria 3973
274 Ga0466710_048207 3300042613 Bacteria 5505
275 Ga0466710_051504 3300042613 Bacteria 4169
276 Ga0466711_145003 3300042615 Bacteria 32111
277 Ga0466728_179152 3300042620 Bacteria 4284
278 Ga0466729_165527 3300042621 Bacteria 3812
279 Ga0466706_199859 3300042599 Bacteria 9363
280 Ga0466706_241347 3300042599 Bacteria 14034
281 Ga0466707_378605 3300042601 Bacteria 1962
282 Ga0466713_091546 3300042602 Bacteria 18477
283 Ga0466713_109624 3300042602 Bacteria 13785
284 Ga0466714_006309 3300042603 Bacteria 1145
285 Ga0466717_222166 3300042604 Bacteria 3124
286 Ga0466719_157184 3300042606 Bacteria 16488
287 Ga0160444_100021 3300012841 Bacteria 297202
288 Ga0415639_085138 3300038395 Bacteria 1282
289 Ga0466657_093175 3300042582 Bacteria 1079
290 Ga0466657_141958 3300042582 Bacteria 2300
291 Ga0466692_058899 3300042591 Bacteria 20827
292 Ga0466691_209335 3300042593 Bacteria 25069
293 Ga0466734_015756 3300042623 Bacteria 28187
294 Ga0466735_221921 3300042624 Bacteria 30703
295 Ga0466709_317533 3300042648 Bacteria 2747
296 Ga0466724_03072 3300042649 Bacteria 18268
297 Ga0466708_117775 3300042652 Bacteria 15479
298 Ga0466725_461929 3300042654 Bacteria 22391
299 Ga0123356_10581044 3300010049 Bacteria 1284
300 Ga0123353_10000519 3300010167 Bacteria 47639
301 Ga0160442_100028 3300012806 Bacteria 266276
302 CVPL010W_10002681 3300002931 Bacteria 20768
303 CVPL010W_10003429 3300002931 Bacteria 18525
304 CVPL005L_10000204 3300002938 Bacteria 52271
305 Ga0102736_1000002 3300007052 Bacteria 204958
306 Ga0102736_1001354 3300007052 Bacteria 7087
307 Ga0102740_1030512 3300007140 Unclassified 837
308 Ga0104048_1021965 3300007143 Unclassified 3447
309 Ga0103264_1000318 3300007188 Bacteria 26213
310 Ga0103264_1010575 3300007188 Bacteria 4505
311 Ga0103267_1000117 3300007190 Bacteria 30369

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042649 Ga0466724_07269 Ga0466724_07269_3935_4471 169
2 3300042648 Ga0466709_172994 Ga0466709_172994_3863_4399 170
3 3300042593 Ga0466691_209335 Ga0466691_209335_7148_7669 173
4 3300042618 Ga0466723_233813 Ga0466723_233813_14967_15488 173
5 3300042599 Ga0466706_278377 Ga0466706_278377_429_953 174
6 3300007052 Ga0102736_1001354 Ga0102736_10013547 176
7 3300042582 Ga0466657_165250 Ga0466657_165250_509_1045 178
8 3300042598 Ga0466701_045249 Ga0466701_045249_62065_62601 178
9 3300042598 Ga0466701_060092 Ga0466701_060092_827_1363 178
10 3300042613 Ga0466710_017414 Ga0466710_017414_291_827 178
11 3300042625 Ga0466730_059466 Ga0466730_059466_19778_20314 178
12 iso_pr_bacteria 2531839311 2533038375 178
13 iso_pr_bacteria 2864804954 2864807521 178
14 iso_pr_bacteria 2864840607 2864843074 178
15 iso_pr_bacteria 2864843793 2864845535 178
16 iso_pr_bacteria 2864863795 2864866138 178
17 iso_pr_bacteria 2864973726 2864973955 178
18 iso_pr_bacteria 3006156446 3006156978 178
19 iso_pr_bacteria 3006190525 3006193779 178
20 iso_pr_bacteria 641522603 641583065 178
21 iso_pr_bacteria 8021899934 8021901411 178
22 2209111014 2217907778 2217804936 179
23 2225789004 2227301894 2227751735 179
24 3300000333 HBC_ctgsDRAFT_1021392 HBC_ctgsDRAFT_10213922 179
25 3300007143 Ga0104048_1021965 Ga0104048_10219655 179
26 3300007505 Ga0105005_1097781 Ga0105005_10977811 179
27 3300038395 Ga0415639_085138 Ga0415639_085138_640_1179 179
28 3300042582 Ga0466657_021707 Ga0466657_021707_6292_6831 179
29 3300042582 Ga0466657_044938 Ga0466657_044938_3002_3541 179
30 3300042582 Ga0466657_051167 Ga0466657_051167_4390_4929 179
31 3300042582 Ga0466657_099882 Ga0466657_099882_280_819 179
32 3300042582 Ga0466657_141958 Ga0466657_141958_13_552 179
33 3300042582 Ga0466657_144931 Ga0466657_144931_2216_2755 179
34 3300042582 Ga0466657_322606 Ga0466657_322606_890_1429 179
35 3300042590 Ga0466690_149138 Ga0466690_149138_7738_8277 179
36 3300042590 Ga0466690_289774 Ga0466690_289774_2954_3493 179
37 3300042590 Ga0466690_321140 Ga0466690_321140_11997_12536 179
38 3300042590 Ga0466690_406175 Ga0466690_406175_57881_58420 179
39 3300042591 Ga0466692_058899 Ga0466692_058899_4169_4708 179
40 3300042591 Ga0466692_128697 Ga0466692_128697_17887_18426 179
41 3300042591 Ga0466692_184437 Ga0466692_184437_2949_3488 179
42 3300042591 Ga0466692_193948 Ga0466692_193948_8115_8654 179
43 3300042592 Ga0466693_116240 Ga0466693_116240_466_1005 179
44 3300042593 Ga0466691_077504 Ga0466691_077504_793_1332 179
45 3300042593 Ga0466691_106582 Ga0466691_106582_1013_1552 179
46 3300042593 Ga0466691_156291 Ga0466691_156291_24630_25169 179
47 3300042595 Ga0466695_078306 Ga0466695_078306_924_1463 179
48 3300042596 Ga0466696_042576 Ga0466696_042576_7226_7765 179
49 3300042596 Ga0466696_110075 Ga0466696_110075_1976_2515 179
50 3300042598 Ga0466701_001027 Ga0466701_001027_6652_7191 179
51 3300042598 Ga0466701_004340 Ga0466701_004340_48_587 179
52 3300042598 Ga0466701_005098 Ga0466701_005098_48_587 179
53 3300042598 Ga0466701_038995 Ga0466701_038995_1473_2012 179
54 3300042598 Ga0466701_053737 Ga0466701_053737_2037_2576 179
55 3300042598 Ga0466701_057745 Ga0466701_057745_569_1108 179
56 3300042598 Ga0466701_092728 Ga0466701_092728_335_874 179
57 3300042599 Ga0466706_199859 Ga0466706_199859_1090_1629 179
58 3300042599 Ga0466706_241347 Ga0466706_241347_5376_5915 179
59 3300042600 Ga0466700_386178 Ga0466700_386178_319_858 179
60 3300042601 Ga0466707_258979 Ga0466707_258979_5701_6240 179
61 3300042601 Ga0466707_378605 Ga0466707_378605_1000_1539 179
62 3300042601 Ga0466707_398396 Ga0466707_398396_1248_1787 179
63 3300042602 Ga0466713_091546 Ga0466713_091546_7450_7989 179
64 3300042602 Ga0466713_109624 Ga0466713_109624_790_1329 179
65 3300042603 Ga0466714_165404 Ga0466714_165404_1357_1896 179
66 3300042604 Ga0466717_058368 Ga0466717_058368_1732_2271 179
67 3300042604 Ga0466717_091910 Ga0466717_091910_6365_6904 179
68 3300042604 Ga0466717_222166 Ga0466717_222166_1727_2266 179
69 3300042604 Ga0466717_222936 Ga0466717_222936_1733_2272 179
70 3300042604 Ga0466717_280629 Ga0466717_280629_3078_3617 179
71 3300042605 Ga0466716_288795 Ga0466716_288795_6229_6768 179
72 3300042606 Ga0466719_047699 Ga0466719_047699_8104_8643 179
73 3300042606 Ga0466719_055618 Ga0466719_055618_1153_1692 179
74 3300042606 Ga0466719_079825 Ga0466719_079825_2159_2698 179
75 3300042606 Ga0466719_112619 Ga0466719_112619_757_1296 179
76 3300042606 Ga0466719_142224 Ga0466719_142224_889_1428 179
77 3300042606 Ga0466719_157184 Ga0466719_157184_11213_11752 179
78 3300042606 Ga0466719_486350 Ga0466719_486350_6150_6689 179
79 3300042609 Ga0466722_141657 Ga0466722_141657_7155_7694 179
80 3300042609 Ga0466722_155417 Ga0466722_155417_679_1218 179
81 3300042609 Ga0466722_196355 Ga0466722_196355_7226_7765 179
82 3300042609 Ga0466722_202204 Ga0466722_202204_3535_4074 179
83 3300042611 Ga0466697_099832 Ga0466697_099832_660_1199 179
84 3300042611 Ga0466697_178025 Ga0466697_178025_4321_4860 179
85 3300042612 Ga0466705_069381 Ga0466705_069381_1469_2008 179
86 3300042612 Ga0466705_389907 Ga0466705_389907_37872_38411 179
87 3300042613 Ga0466710_038761 Ga0466710_038761_6805_7344 179
88 3300042613 Ga0466710_042268 Ga0466710_042268_2710_3249 179
89 3300042613 Ga0466710_048207 Ga0466710_048207_1009_1548 179
90 3300042613 Ga0466710_051504 Ga0466710_051504_3228_3767 179
91 3300042613 Ga0466710_058355 Ga0466710_058355_728_1267 179
92 3300042613 Ga0466710_115345 Ga0466710_115345_6309_6848 179
93 3300042614 Ga0466712_182347 Ga0466712_182347_8094_8633 179
94 3300042615 Ga0466711_063795 Ga0466711_063795_3023_3562 179
95 3300042615 Ga0466711_109307 Ga0466711_109307_6223_6762 179
96 3300042615 Ga0466711_145003 Ga0466711_145003_15674_16213 179
97 3300042615 Ga0466711_247281 Ga0466711_247281_3290_3829 179
98 3300042616 Ga0466715_030743 Ga0466715_030743_1852_2391 179
99 3300042616 Ga0466715_109155 Ga0466715_109155_2349_2888 179
100 3300042616 Ga0466715_269641 Ga0466715_269641_2995_3534 179
101 3300042616 Ga0466715_438666 Ga0466715_438666_1178_1717 179
102 3300042618 Ga0466723_001810 Ga0466723_001810_142_681 179
103 3300042618 Ga0466723_020620 Ga0466723_020620_2854_3393 179
104 3300042618 Ga0466723_124011 Ga0466723_124011_10330_10869 179
105 3300042619 Ga0466726_032824 Ga0466726_032824_8255_8794 179
106 3300042619 Ga0466726_047171 Ga0466726_047171_742_1281 179
107 3300042619 Ga0466726_067584 Ga0466726_067584_3486_4025 179
108 3300042619 Ga0466726_079457 Ga0466726_079457_130_669 179
109 3300042619 Ga0466726_188842 Ga0466726_188842_8303_8842 179
110 3300042620 Ga0466728_179152 Ga0466728_179152_2356_2895 179
111 3300042620 Ga0466728_181251 Ga0466728_181251_7864_8403 179
112 3300042621 Ga0466729_037640 Ga0466729_037640_388_927 179
113 3300042621 Ga0466729_051623 Ga0466729_051623_1077_1616 179
114 3300042621 Ga0466729_084932 Ga0466729_084932_98920_99459 179
115 3300042621 Ga0466729_129497 Ga0466729_129497_1367_1906 179
116 3300042621 Ga0466729_165527 Ga0466729_165527_1563_2102 179
117 3300042621 Ga0466729_282678 Ga0466729_282678_683_1222 179
118 3300042623 Ga0466734_005435 Ga0466734_005435_4057_4596 179
119 3300042623 Ga0466734_015756 Ga0466734_015756_6516_7055 179
120 3300042623 Ga0466734_029421 Ga0466734_029421_1413_1952 179
121 3300042623 Ga0466734_030009 Ga0466734_030009_132_671 179
122 3300042623 Ga0466734_079060 Ga0466734_079060_4751_5290 179
123 3300042623 Ga0466734_128421 Ga0466734_128421_1021_1560 179
124 3300042624 Ga0466735_033269 Ga0466735_033269_3500_4039 179
125 3300042624 Ga0466735_207643 Ga0466735_207643_1114_1653 179
126 3300042625 Ga0466730_008869 Ga0466730_008869_69385_69924 179
127 3300042635 Ga0466702_420939 Ga0466702_420939_779_1318 179
128 3300042636 Ga0466703_060848 Ga0466703_060848_7938_8477 179
129 3300042636 Ga0466703_276609 Ga0466703_276609_16524_17063 179
130 3300042636 Ga0466703_320420 Ga0466703_320420_15286_15825 179
131 3300042643 Ga0466704_150483 Ga0466704_150483_7365_7904 179
132 3300042643 Ga0466704_195288 Ga0466704_195288_8606_9145 179
133 3300042643 Ga0466704_332081 Ga0466704_332081_403_942 179
134 3300042643 Ga0466704_473875 Ga0466704_473875_784_1323 179
135 3300042643 Ga0466704_501270 Ga0466704_501270_2007_2546 179
136 3300042648 Ga0466709_083350 Ga0466709_083350_2407_2946 179
137 3300042648 Ga0466709_317533 Ga0466709_317533_325_864 179
138 3300042648 Ga0466709_407126 Ga0466709_407126_760_1299 179
139 3300042649 Ga0466724_62199 Ga0466724_62199_7453_7992 179
140 3300042652 Ga0466708_117775 Ga0466708_117775_6720_7259 179
141 3300042652 Ga0466708_158539 Ga0466708_158539_3641_4180 179
142 3300042652 Ga0466708_215602 Ga0466708_215602_8460_8999 179
143 3300042652 Ga0466708_308504 Ga0466708_308504_8849_9388 179
144 3300042652 Ga0466708_431611 Ga0466708_431611_2398_2937 179
145 3300042654 Ga0466725_049736 Ga0466725_049736_456_995 179
146 3300042654 Ga0466725_087681 Ga0466725_087681_2489_3028 179
147 3300042654 Ga0466725_128862 Ga0466725_128862_1914_2453 179
148 3300042654 Ga0466725_146840 Ga0466725_146840_1718_2257 179
149 3300042654 Ga0466725_164280 Ga0466725_164280_5624_6163 179
150 3300042654 Ga0466725_167598 Ga0466725_167598_8812_9351 179
151 3300042654 Ga0466725_185939 Ga0466725_185939_29686_30225 179
152 3300042654 Ga0466725_272788 Ga0466725_272788_6455_6994 179
153 3300042654 Ga0466725_296922 Ga0466725_296922_621_1160 179
154 3300042654 Ga0466725_399048 Ga0466725_399048_9022_9561 179
155 3300042654 Ga0466725_408172 Ga0466725_408172_355_894 179
156 3300042654 Ga0466725_461929 Ga0466725_461929_6180_6719 179
157 3300042655 Ga0466727_137609 Ga0466727_137609_7281_7820 179
158 3300042655 Ga0466727_335351 Ga0466727_335351_19515_20054 179
159 3300042656 Ga0466732_077377 Ga0466732_077377_1227_1766 179
160 3300042659 Ga0466733_059229 Ga0466733_059229_19623_20162 179
161 3300042659 Ga0466733_093838 Ga0466733_093838_2513_3052 179
162 iso_pr_bacteria 2517487021 2517564023 179
163 iso_pr_bacteria 2518285616 2518642509 179
164 iso_pr_bacteria 2565956547 2566131796 179
165 iso_pr_bacteria 2582581321 2585353548 179
166 iso_pr_bacteria 2597489944 2598058618 179
167 iso_pr_bacteria 2603880165 2606014691 179
168 iso_pr_bacteria 2603880170 2606028724 179
169 iso_pr_bacteria 2603880172 2606035063 179
170 iso_pr_bacteria 2617270844 2617733410 179
171 iso_pr_bacteria 2648501628 2650560491 179
172 iso_pr_bacteria 2687453742 2689987325 179
173 iso_pr_bacteria 2687453753 2690037905 179
174 iso_pr_bacteria 2773857880 2774725166 179
175 iso_pr_bacteria 2775506951 2776480440 179
176 iso_pr_bacteria 2791354930 2792025601 179
177 iso_pr_bacteria 2820042117 2820044557 179
178 iso_pr_bacteria 2820047982 2820048113 179
179 iso_pr_bacteria 2820050117 2820051524 179
180 iso_pr_bacteria 2820062699 2820063439 179
181 iso_pr_bacteria 2820065746 2820066506 179
182 iso_pr_bacteria 2820077244 2820079109 179
183 iso_pr_bacteria 2820084079 2820085464 179
184 iso_pr_bacteria 2820086750 2820088253 179
185 iso_pr_bacteria 2820089333 2820090589 179
186 iso_pr_bacteria 2820103659 2820105469 179
187 iso_pr_bacteria 2820123897 2820124515 179
188 iso_pr_bacteria 2820152154 2820152444 179
189 iso_pr_bacteria 2820157249 2820158655 179
190 iso_pr_bacteria 2820161938 2820162764 179
191 iso_pr_bacteria 2820164216 2820165920 179
192 iso_pr_bacteria 2820259584 2820260967 179
193 iso_pr_bacteria 2833478085 2833478899 179
194 iso_pr_bacteria 2834230000 2834230951 179
195 iso_pr_bacteria 2838140227 2838144176 179
196 iso_pr_bacteria 2848339753 2848340019 179
197 iso_pr_bacteria 2855798354 2855802051 179
198 iso_pr_bacteria 2864859030 2864862091 179
199 iso_pr_bacteria 2864914039 2864917087 179
200 iso_pr_bacteria 2864937364 2864941396 179
201 iso_pr_bacteria 2864988360 2864991050 179
202 iso_pr_bacteria 2868169047 2868170787 179
203 iso_pr_bacteria 2873571580 2873573340 179
204 iso_pr_bacteria 2891720358 2891723380 179
205 iso_pr_bacteria 3002773460 3002773747 179
206 iso_pr_bacteria 3003869270 3003872366 179
207 iso_pr_bacteria 3003878002 3003881401 179
208 iso_pr_bacteria 8025650824 8025653588 179
209 iso_pr_bacteria 8025658853 8025661696 179
210 iso_pr_bacteria 8025671076 8025673623 179
211 iso_pr_bacteria 8025678175 8025680561 179
212 iso_pr_bacteria 8025685901 8025689038 179
213 iso_pr_bacteria 8025694439 8025697268 179
214 iso_pr_bacteria 8025701579 8025706275 179
215 iso_pr_bacteria 8025708040 8025710750 179
216 iso_pr_bacteria 8025728939 8025731740 179
217 iso_pr_bacteria 8078130113 8078132660 179
218 iso_pr_bacteria 8100449422 8100449612 179
219 iso_pr_bacteria 8100455565 8100455851 179
220 iso_pr_bacteria 8100461708 8100467817 179
221 iso_pr_bacteria 8102094248 8102097156 179
222 iso_pr_bacteria 8102102351 8102104893 179
223 iso_pr_bacteria 8102109360 8102111965 179
224 iso_pr_bacteria 8102117041 8102119577 179
225 iso_pr_bacteria 8102124461 8102127196 179
226 iso_pr_bacteria 8102138357 8102140932 179
227 iso_pr_bacteria 8102174626 8102177427 179
228 iso_pr_bacteria 8102193924 8102196633 179
229 iso_pr_bacteria 8102201977 8102206673 179
230 iso_pr_bacteria 8102208438 8102211202 179
231 iso_pr_bacteria 8102216467 8102219296 179
232 iso_pr_bacteria 8102223607 8102226154 179
233 iso_pr_bacteria 8102230706 8102233843 179
234 iso_pr_bacteria 8102239244 8102241629 179
235 iso_pr_bacteria 8102251710 8102254553 179
236 3300000062 IMNBL1DRAFT_c0010256 IMNBL1DRAFT_00102569 180
237 3300002462 JGI24702J35022_10008095 JGI24702J35022_100080955 180
238 3300002462 JGI24702J35022_10033351 JGI24702J35022_100333511 180
239 3300002462 JGI24702J35022_10074246 JGI24702J35022_100742461 180
240 3300002504 JGI24705J35276_12235518 JGI24705J35276_122355187 180
241 3300002834 JGI24696J40584_12933683 JGI24696J40584_129336832 180
242 3300002931 CVPL010W_10003429 CVPL010W_1000342918 180
243 3300002931 CVPL010W_10005074 CVPL010W_1000507418 180
244 3300002931 CVPL010W_10006354 CVPL010W_100063543 180
245 3300002931 CVPL010W_10012209 CVPL010W_100122096 180
246 3300002931 CVPL010W_10032043 CVPL010W_100320433 180
247 3300002934 CVPL005W_1000434 CVPL005W_10004342 180
248 3300002934 CVPL005W_1001807 CVPL005W_100180712 180
249 3300002938 CVPL005L_10000093 CVPL005L_1000009338 180
250 3300002938 CVPL005L_10000204 CVPL005L_1000020444 180
251 3300005071 Ga0068302_10000086 Ga0068302_100000868 180
252 3300005083 Ga0068305_10277852 Ga0068305_1027785216 180
253 3300005201 Ga0072941_1125686 Ga0072941_11256866 180
254 3300005201 Ga0072941_1141096 Ga0072941_114109613 180
255 3300005201 Ga0072941_1340102 Ga0072941_13401022 180
256 3300007052 Ga0102736_1000277 Ga0102736_10002776 180
257 3300007067 Ga0103266_1000200 Ga0103266_100020013 180
258 3300007067 Ga0103266_1000773 Ga0103266_10007732 180
259 3300007068 Ga0103265_1000457 Ga0103265_100045710 180
260 3300007080 Ga0102735_1000064 Ga0102735_100006458 180
261 3300007080 Ga0102735_1002079 Ga0102735_10020795 180
262 3300007080 Ga0102735_1005860 Ga0102735_10058603 180
263 3300007083 Ga0103261_1000695 Ga0103261_100069516 180
264 3300007085 Ga0104045_1080481 Ga0104045_10804812 180
265 3300007088 Ga0104047_1124693 Ga0104047_11246932 180
266 3300007095 Ga0102739_1000381 Ga0102739_10003814 180
267 3300007095 Ga0102739_1000846 Ga0102739_10008462 180
268 3300007095 Ga0102739_1002286 Ga0102739_10022865 180
269 3300007095 Ga0102739_1008447 Ga0102739_10084472 180
270 3300007129 Ga0102734_1000504 Ga0102734_100050421 180
271 3300007129 Ga0102734_1011377 Ga0102734_10113774 180
272 3300007129 Ga0102734_1034942 Ga0102734_10349423 180
273 3300007130 Ga0104042_1073570 Ga0104042_10735702 180
274 3300007139 Ga0103260_1000257 Ga0103260_100025718 180
275 3300007139 Ga0103260_1005442 Ga0103260_10054423 180
276 3300007140 Ga0102740_1001232 Ga0102740_10012323 180
277 3300007140 Ga0102740_1030512 Ga0102740_10305121 180
278 3300007141 Ga0102738_1000014 Ga0102738_100001470 180
279 3300007141 Ga0102738_1004908 Ga0102738_10049083 180
280 3300007141 Ga0102738_1032118 Ga0102738_10321182 180
281 3300007142 Ga0102737_1000494 Ga0102737_10004948 180
282 3300007142 Ga0102737_1001244 Ga0102737_100124410 180
283 3300007142 Ga0102737_1003109 Ga0102737_10031095 180
284 3300007143 Ga0104048_1168521 Ga0104048_11685216 180
285 3300007150 Ga0104019_1191147 Ga0104019_11911472 180
286 3300007188 Ga0103264_1000021 Ga0103264_100002166 180
287 3300007188 Ga0103264_1000188 Ga0103264_100018830 180
288 3300007188 Ga0103264_1000318 Ga0103264_100031813 180
289 3300007188 Ga0103264_1000443 Ga0103264_100044330 180
290 3300007188 Ga0103264_1000587 Ga0103264_10005875 180
291 3300007188 Ga0103264_1010575 Ga0103264_10105758 180
292 3300007188 Ga0103264_1013761 Ga0103264_10137615 180
293 3300007190 Ga0103267_1000117 Ga0103267_10001178 180
294 3300007190 Ga0103267_1000450 Ga0103267_10004506 180
295 3300007192 Ga0103268_1000925 Ga0103268_10009252 180
296 3300007192 Ga0103268_1001471 Ga0103268_10014713 180
297 3300007192 Ga0103268_1005849 Ga0103268_10058494 180
298 3300007192 Ga0103268_1049146 Ga0103268_10491461 180
299 3300009784 Ga0123357_10000005 Ga0123357_10000005295 180
300 3300009784 Ga0123357_10001915 Ga0123357_1000191515 180
301 3300009784 Ga0123357_10018066 Ga0123357_1001806617 180
302 3300009784 Ga0123357_10219977 Ga0123357_102199774 180
303 3300009784 Ga0123357_10668122 Ga0123357_106681222 180
304 3300009826 Ga0123355_10317937 Ga0123355_103179372 180
305 3300010049 Ga0123356_10005609 Ga0123356_1000560915 180
306 3300010049 Ga0123356_10811307 Ga0123356_108113073 180
307 3300010049 Ga0123356_10979075 Ga0123356_109790752 180
308 3300010167 Ga0123353_10000519 Ga0123353_1000051915 180
309 3300010167 Ga0123353_10008266 Ga0123353_1000826610 180
310 3300010167 Ga0123353_10389727 Ga0123353_103897274 180
311 3300010882 Ga0123354_10002414 Ga0123354_1000241415 180
312 3300010882 Ga0123354_10038081 Ga0123354_1003808111 180
313 3300010882 Ga0123354_10116493 Ga0123354_101164935 180
314 3300012798 Ga0160454_100702 Ga0160454_10070211 180
315 3300012805 Ga0160464_100135 Ga0160464_10013515 180
316 3300012806 Ga0160442_100028 Ga0160442_100028154 180
317 3300012813 Ga0160470_102347 Ga0160470_1023473 180
318 3300012825 Ga0160441_100201 Ga0160441_10020148 180
319 3300012832 Ga0160458_100594 Ga0160458_1005944 180
320 3300012835 Ga0160446_103994 Ga0160446_1039942 180
321 3300012837 Ga0160455_100048 Ga0160455_100048159 180
322 3300012845 Ga0160460_112876 Ga0160460_1128762 180
323 3300012849 Ga0160447_107843 Ga0160447_1078431 180
324 3300012849 Ga0160447_119094 Ga0160447_1190943 180
325 3300012850 Ga0160434_119020 Ga0160434_1190202 180
326 3300012852 Ga0160430_109942 Ga0160430_1099423 180
327 3300012857 Ga0160435_1001779 Ga0160435_10017799 180
328 3300038395 Ga0415639_012149 Ga0415639_012149_25227_25769 180
329 3300042582 Ga0466657_390228 Ga0466657_390228_874_1416 180
330 3300042598 Ga0466701_066530 Ga0466701_066530_2039_2581 180
331 3300042599 Ga0466706_231592 Ga0466706_231592_2980_3522 180
332 3300042603 Ga0466714_006309 Ga0466714_006309_485_1027 180
333 3300042612 Ga0466705_144704 Ga0466705_144704_6169_6711 180
334 3300042613 Ga0466710_211598 Ga0466710_211598_6328_6870 180
335 3300042616 Ga0466715_193807 Ga0466715_193807_10482_11024 180
336 3300042623 Ga0466734_076859 Ga0466734_076859_18284_18826 180
337 3300042623 Ga0466734_085482 Ga0466734_085482_1076_1618 180
338 3300042625 Ga0466730_040457 Ga0466730_040457_616_1158 180
339 3300042654 Ga0466725_183948 Ga0466725_183948_1111_1653 180
340 iso_pr_bacteria 2513237114 2513781128 180
341 iso_pr_bacteria 2820432912 2820435483 180
342 iso_pr_bacteria 2820530790 2820532450 180
343 iso_pr_bacteria 2831380896 2831381270 180
344 iso_pr_bacteria 2832039703 2832040221 180
345 iso_pr_bacteria 8024031916 8024034855 180
346 iso_pr_bacteria 8065340634 8065341005 180
347 3300002931 CVPL010W_10002681 CVPL010W_1000268121 181
348 3300007052 Ga0102736_1000002 Ga0102736_1000002164 181
349 3300007068 Ga0103265_1026679 Ga0103265_10266792 181
350 3300007083 Ga0103261_1000039 Ga0103261_100003945 181
351 3300007095 Ga0102739_1000001 Ga0102739_100000149 181
352 3300007129 Ga0102734_1000029 Ga0102734_100002956 181
353 3300007139 Ga0103260_1000020 Ga0103260_100002054 181
354 3300012812 Ga0160471_108544 Ga0160471_1085442 181
355 3300012813 Ga0160470_108444 Ga0160470_1084442 181
356 3300012820 Ga0160456_100416 Ga0160456_10041613 181
357 3300012832 Ga0160458_100003 Ga0160458_10000315 181
358 3300012841 Ga0160444_100021 Ga0160444_100021258 181
359 3300012852 Ga0160430_100531 Ga0160430_10053115 181
360 3300012854 Ga0160448_100555 Ga0160448_10055512 181
361 3300012854 Ga0160448_131554 Ga0160448_1315542 181
362 3300012857 Ga0160435_1013143 Ga0160435_10131431 181
363 3300012858 Ga0160457_1000003 Ga0160457_100000315 181
364 3300012861 Ga0160436_1000158 Ga0160436_100015828 181
365 3300042595 Ga0466695_379396 Ga0466695_379396_416_961 181
366 3300042597 Ga0466699_121087 Ga0466699_121087_820_1365 181
367 3300042598 Ga0466701_048756 Ga0466701_048756_6086_6631 181
368 3300042598 Ga0466701_083530 Ga0466701_083530_1207_1752 181
369 3300042611 Ga0466697_086601 Ga0466697_086601_364_909 181
370 3300042611 Ga0466697_090556 Ga0466697_090556_364_909 181
371 3300042612 Ga0466705_276363 Ga0466705_276363_5919_6464 181
372 3300042613 Ga0466710_276996 Ga0466710_276996_791_1336 181
373 3300042613 Ga0466710_458456 Ga0466710_458456_93_638 181
374 3300042622 Ga0466731_247532 Ga0466731_247532_435_980 181
375 3300042623 Ga0466734_083453 Ga0466734_083453_979_1524 181
376 3300005201 Ga0072941_1289878 Ga0072941_12898788 182
377 3300010882 Ga0123354_10026109 Ga0123354_100261099 182
378 3300038395 Ga0415639_084109 Ga0415639_084109_2791_3339 182
379 3300042594 Ga0466694_302740 Ga0466694_302740_1766_2314 182
380 3300042598 Ga0466701_093913 Ga0466701_093913_1127_1675 182
381 3300042649 Ga0466724_03072 Ga0466724_03072_14033_14581 182
382 iso_pr_bacteria 2864870719 2864871485 182
383 iso_pr_bacteria 2864960361 2864961129 182
384 3300042615 Ga0466711_226259 Ga0466711_226259_772_1329 185
385 3300042654 Ga0466725_025670 Ga0466725_025670_7077_7634 185
386 3300042582 Ga0466657_056362 Ga0466657_056362_6502_7062 186
387 3300042582 Ga0466657_295945 Ga0466657_295945_1161_1721 186
388 3300042596 Ga0466696_283703 Ga0466696_283703_8528_9088 186
389 3300042623 Ga0466734_034177 Ga0466734_034177_1112_1672 186
390 3300042624 Ga0466735_221921 Ga0466735_221921_9770_10330 186
391 3300042648 Ga0466709_217396 Ga0466709_217396_189559_190119 186
392 3300042654 Ga0466725_172464 Ga0466725_172464_2570_3130 186
393 3300042654 Ga0466725_366896 Ga0466725_366896_1735_2295 186
394 iso_pr_bacteria 2832037495 2832038585 186
395 3300002462 JGI24702J35022_10004800 JGI24702J35022_100048008 187
396 3300010049 Ga0123356_11324145 Ga0123356_113241452 188
397 iso_pr_bacteria 2820082748 2820083934 188
398 iso_pr_bacteria 2820093073 2820093239 188
399 3300010882 Ga0123354_10120119 Ga0123354_101201194 189
400 3300042582 Ga0466657_320365 Ga0466657_320365_161_793 190
401 3300010049 Ga0123356_10581044 Ga0123356_105810442 191
402 3300042623 Ga0466734_128631 Ga0466734_128631_108_752 192
403 3300010167 Ga0123353_10354942 Ga0123353_103549421 197
404 3300010049 Ga0123356_10098973 Ga0123356_100989732 199
405 iso_pr_bacteria 2718217749 2718707349 200
406 3300010049 Ga0123356_10020919 Ga0123356_100209198 201
407 3300042582 Ga0466657_093175 Ga0466657_093175_104_814 207
408 3300042550 Ga0466656_233770 Ga0466656_233770_1274_1996 211

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00281 Ribosomal_L5 Ribosomal protein L5 45 101 0.99
PF00673 Ribosomal_L5_C ribosomal L5P family C-terminus 105 197 0.99

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.83 0.87 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.