Protein Family IF11258

Metagenome Isolate
183 Members
127 Samples
103 Scaffolds
207.52 Avg Length

🧬 Representative Sequence

ID
iso_pr_bacteria|2663763384|2666812845|
Length
235 aa
Sequence
MEKLTKVTGVAVPLRRSSVDTDQIIPAVFLKRVAKTGFEDALFYAWRRDPEFILNQSRYANPRVLVAGPDFGIGSSREHAVWALRDYGFRVVISSKFADIFYGNTAKNGVLAAIMPQESVEEIWETLEANPGMSMSVDLKTRTATCGELTLPFQVDDYTCWRLMNGFDDIDLTLQHEADITAYEAERAQRFPFKPVTLPVMREPEQPVSSARPVDDSDWPGPIDSVDGDVSGGIA

📊 Sample Types

Isolate 43.7%
Metagenome 56.3%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 33.9%
Apidae 14.4%
Termitidae 11.0%
Kalotermitidae 7.6%
Scarabaeidae 5.1%
Formicidae 5.1%
Culicidae 4.2%
Cambaridae 3.4%
Tenebrionidae 2.5%
Hydrophilidae 2.5%
Armadillidiidae 2.5%
Rhinotermitidae 1.7%
Curculionidae 0.8%
Ixodidae 0.8%
Thomisidae 0.8%
Hodotermitidae 0.8%
Cerambycidae 0.8%
Termopsidae 0.8%
Pyralidae 0.8%

🌳 Taxonomy

Archaea 0
Bacteria 179
Eukaryota 0
Viruses 0
Unclassified 4

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 8118075156 Actinosynnema pretiosum DSM 44131 Isolate Unclassified
2 2836973655 Gryllotalpicola protaetiae 2DFW10M-5 Isolate Scarabaeidae
3 2684622918 Bifidobacterium asteroides Bi_198 Isolate Unclassified
4 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
5 3300012828 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E0 MG Metagenome
6 3300012852 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG Metagenome
7 3300056790 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) Metagenome Tenebrionidae
8 3300056856 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) Metagenome Tenebrionidae
9 8024981139 Bifidobacterium asteroides ESL0170 Isolate Apidae
10 8024984606 Bifidobacterium asteroides ESL0199 Isolate Apidae
11 8069511479 Arthrobacter ipsi IA7 Isolate Curculionidae
12 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
13 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
14 8110340172 Bifidobacterium choladohabitans B14384H11 Isolate Apidae
15 2821316722 Unclassified Actinobacteria Lab288P1bin78 Isolate Unclassified
16 2848356102 Xylanimonas allomyrinae 2JSPR-7 Isolate Scarabaeidae
17 2862075925 Corynebacterium lactis S064 Isolate Ixodidae
18 2519899775 Bifidobacterium asteroides PRL2011 Isolate Apidae
19 2597490239 Bifidobacterium bohemicum DSM 22767 Isolate Unclassified
20 2663763384 Bifidobacterium bombi DSM 19703 Isolate Apidae
21 2681812870 Oerskovia enterophila DFA-19 Isolate Unclassified
22 3300000333 Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony Metagenome Apidae
23 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
24 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
25 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
26 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
27 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
28 2820845766 Unclassified Actinobacteria Lab288P3bin96 Isolate Unclassified
29 2820849606 Unclassified Actinobacteria Lab288P3bin39 Isolate Unclassified
30 2820926697 Unclassified Actinobacteria Emb289P3bin125 Isolate Unclassified
31 2824199081 Bifidobacterium commune DSM 28792 Isolate Unclassified
32 2837204985 Lysinimonas sp. 2DFWR-13 Isolate Scarabaeidae
33 2865982043 Bifidobacterium aemilianum XV10 Isolate Apidae
34 2873586004 Sanguibacter sp. HDW7 Isolate Hydrophilidae
35 2915166107 Leucobacter sp. cx-87 Isolate Cambaridae
36 2505679068 Isoptericola variabilis 225 Isolate Unclassified
37 2513237174 Bifidobacterium asteroides ATCC 25910 Isolate Apidae
38 3300012818 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E0 MG Metagenome
39 3300012834 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG Metagenome
40 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
41 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
42 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
43 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
44 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
45 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
46 2820816657 Unclassified Actinobacteria Nt197P3bin38 Isolate Unclassified
47 2820901319 Unclassified Actinobacteria Emb289P4bin58 Isolate Unclassified
48 2820935937 Unclassified Actinobacteria Emb289P1bin40 Isolate Unclassified
49 2820944107 Unclassified Actinobacteria Cu122P5bin14 Isolate Unclassified
50 2856882415 Pseudonocardia sp. Ae406_Ps2 Isolate Formicidae
51 2873558832 Propioniciclava coleopterorum HDW11 Isolate Hydrophilidae
52 2873589062 Phycicoccus sp. HDW14 Isolate Hydrophilidae
53 2504756063 Isoptericola variabilis J5 Isolate Unclassified
54 2597490194 Bifidobacterium coryneforme LMG 18911 Isolate Apidae
55 2630969010 Friedmanniella luteola DSM 21741 Isolate Thomisidae
56 2671180601 Bifidobacterium asteroides DSM 20089 Isolate Unclassified
57 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
58 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
59 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
60 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
61 3300056857 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) Metagenome Tenebrionidae
62 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
63 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
64 2820825283 Unclassified Actinobacteria Nt197P3bin111 Isolate Unclassified
65 2820829137 Unclassified Actinobacteria Nc150P5bin2 Isolate Unclassified
66 2820894511 Unclassified Actinobacteria Lab288P1bin103 Isolate Unclassified
67 2820911766 Unclassified Actinobacteria Emb289P3bin96 Isolate Unclassified
68 2883361506 Luteimicrobium xylanilyticum HY-24 Isolate Cerambycidae
69 2660238275 Bifidobacterium indicum DSM 20214 Isolate Unclassified
70 2684622916 Bifidobacterium asteroides Bi_170 Isolate Unclassified
71 2684622917 Bifidobacterium coryneforme Bi_197 Isolate Unclassified
72 2693429521 Bifidobacterium coryneforme DSM 20216 Isolate Unclassified
73 2816332114 Microbacterium saperdae DSM 20169 Isolate Unclassified
74 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
75 3300012825 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG Metagenome
76 3300012848 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG Metagenome Armadillidiidae
77 3300012861 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG Metagenome Culicidae
78 8024982947 Bifidobacterium asteroides ESL0200 Isolate Apidae
79 8110341875 Bifidobacterium polysaccharolyticum W8117 Isolate Apidae
80 2820803007 Unclassified Actinobacteria Th196P3bin61 Isolate Unclassified
81 2820842553 Unclassified Actinobacteria Lab288P4bin104 Isolate Unclassified
82 2820929059 Unclassified Actinobacteria Emb289P3bin110 Isolate Unclassified
83 2821314491 Unclassified Actinobacteria Lab288P4bin49 Isolate Unclassified
84 2847305884 Microbacterium protaetiae DFW100M-13 Isolate Scarabaeidae
85 2856960404 Pseudonocardia sp. Ae706_Ps2 Isolate Formicidae
86 2856973192 Pseudonocardia sp. Ae331_Ps2 Isolate Formicidae
87 2859970369 Pseudonocardia sp. Ae717_Ps2 Isolate Formicidae
88 2909412500 Yimella sp. cx-573 Isolate Cambaridae
89 2931425734 Nocardioides sp. J2M5 Isolate
90 2931430189 Tessaracoccus palaemonis J1M15 Isolate
91 2518645556 Nocardiopsis alba ATCC BAA-2165 Isolate Apidae
92 2547132042 Pseudonocardia sp. P2 Isolate Formicidae
93 2772190761 Rhodococcus rhodnii NRRL B-16535 Isolate Unclassified
94 2808606957 Bifidobacterium sp. ESL0447 Isolate Unclassified
95 3300012824 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG Metagenome Armadillidiidae
96 3300012831 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG Metagenome Culicidae
97 3300012849 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG Metagenome Culicidae
98 3300012850 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E0 MG Metagenome Culicidae
99 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
100 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
101 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
102 2820834831 Unclassified Actinobacteria Lab288P4bin79 Isolate Unclassified
103 2883683260 Protaetiibacter larvae KACC 19322 Isolate Scarabaeidae
104 2888667245 Corynebacterium diphtheriae FRC0190 Isolate Unclassified
105 2915168811 Leucobacter sp. cx-169 Isolate Cambaridae
106 2568526170 Bifidobacterium sp. A11 Isolate Apidae
107 2600255079 Bifidobacterium bombi DSM 19703 Isolate Apidae
108 2684622919 Bifidobacterium asteroides Bi_199 Isolate Unclassified
109 2731957681 Xylanimicrobium pachnodae JCM 13526, NBRC 107786 Isolate Scarabaeidae
110 2818991320 Klugiella xanthotipulae DSM 18031 Isolate Unclassified
111 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
112 3300012815 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E1 MG Metagenome
113 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
114 8024986378 Bifidobacterium asteroides ESL0198 Isolate Apidae
115 8032009961 Bifidobacterium indicum ESL0197 Isolate Apidae
116 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
117 2820867525 Unclassified Actinobacteria Lab288P3bin128 Isolate Unclassified
118 2856954254 Pseudonocardia sp. Ae505_Ps2 Isolate Formicidae
119 2879643867 Bifidobacterium sp. wkB344 Isolate Apidae
120 2884351759 Cellulosimicrobium sp. BI34T Isolate Pyralidae
121 2684622920 Bifidobacterium asteroides Bi_200 Isolate Unclassified
122 2802429577 Bifidobacterium indicum DSM 20214 Isolate Unclassified
123 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
124 3300012806 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E1 MG Metagenome
125 3300012812 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E11 MG Metagenome Culicidae
126 3300012858 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG Metagenome Armadillidiidae
127 8062747827 Yimella sp. cx-51 Isolate Cambaridae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466733_012365 3300042659 Bacteria 3681
2 Ga0562379_0657 3300056790 Bacteria 60108
3 Ga0123357_10493890 3300009784 Bacteria 1023
4 Ga0123356_10078988 3300010049 Bacteria 3107
5 Ga0123353_10293309 3300010167 Bacteria 2488
6 Ga0466730_011455 3300042625 Bacteria 1557
7 Ga0466703_410962 3300042636 Bacteria 2064
8 Ga0466704_230088 3300042643 Bacteria 3391
9 Ga0466723_019168 3300042618 Bacteria 39538
10 Ga0466719_570799 3300042606 Bacteria 1189
11 Ga0160441_100326 3300012825 Bacteria 42885
12 Ga0160447_123749 3300012849 Bacteria 922
13 Ga0466693_316369 3300042592 Bacteria 138024
14 HBC_ctgsDRAFT_1001065 3300000333 Unclassified 5992
15 JGI24705J35276_12225079 3300002504 Bacteria 2679
16 JGI24699J35502_10976833 3300002509 Bacteria 1257
17 Ga0466697_193707 3300042611 Bacteria 1426
18 Ga0123356_10068572 3300010049 Bacteria 3323
19 Ga0123356_10426160 3300010049 Bacteria 1470
20 Ga0123356_10446394 3300010049 Bacteria 1441
21 Ga0123354_10060498 3300010882 Bacteria 5601
22 Ga0466705_460805 3300042612 Unclassified 1013
23 Ga0466723_132985 3300042618 Bacteria 1647
24 Ga0466713_021406 3300042602 Bacteria 25571
25 Ga0466722_016796 3300042609 Bacteria 3899
26 Ga0466722_096989 3300042609 Bacteria 12413
27 Ga0160440_102696 3300012815 Bacteria 1804
28 Ga0160459_100623 3300012831 Bacteria 12696
29 Ga0160447_101594 3300012849 Bacteria 8656
30 Ga0160430_115056 3300012852 Bacteria 1179
31 Ga0160436_1000032 3300012861 Bacteria 85402
32 Ga0466696_133766 3300042596 Bacteria 10093
33 HBC_ctgsDRAFT_1030447 3300000333 Unclassified 1326
34 Ga0123357_10000026 3300009784 Bacteria 128045
35 Ga0123357_10000206 3300009784 Bacteria 55440
36 Ga0466733_102585 3300042659 Bacteria 133807
37 Ga0123355_11209948 3300009826 Bacteria 770
38 Ga0123356_11110314 3300010049 Bacteria 959
39 Ga0160471_106963 3300012812 Bacteria 1392
40 Ga0466704_304461 3300042643 Bacteria 86696
41 Ga0466711_414168 3300042615 Bacteria 1053
42 Ga0466713_061740 3300042602 Bacteria 13358
43 Ga0466713_063438 3300042602 Bacteria 6645
44 Ga0466713_102416 3300042602 Bacteria 18060
45 Ga0466713_129388 3300042602 Bacteria 12811
46 Ga0466713_151451 3300042602 Bacteria 19289
47 Ga0160431_117631 3300012828 Bacteria 764
48 Ga0123357_10012362 3300009784 Bacteria 11011
49 Ga0123355_10371131 3300009826 Bacteria 1874
50 Ga0123356_10007197 3300010049 Bacteria 11134
51 Ga0123354_10033583 3300010882 Bacteria 8030
52 Ga0466704_374071 3300042643 Bacteria 11948
53 Ga0466704_375651 3300042643 Bacteria 8247
54 Ga0466724_46140 3300042649 Bacteria 630192
55 Ga0466723_102182 3300042618 Bacteria 14996
56 Ga0466707_080865 3300042601 Bacteria 320076
57 Ga0466713_027509 3300042602 Bacteria 2988
58 Ga0466713_080871 3300042602 Bacteria 2802
59 Ga0466713_152195 3300042602 Bacteria 13835
60 Ga0160443_100018 3300012848 Bacteria 423460
61 Ga0160457_1001308 3300012858 Bacteria 7145
62 Ga0466696_053399 3300042596 Bacteria 7447
63 HBC_ctgsDRAFT_1017532 3300000333 Unclassified 1744
64 Ga0466705_349855 3300042612 Bacteria 3448
65 Ga0466733_078683 3300042659 Bacteria 25677
66 Ga0123357_10118731 3300009784 Bacteria 3340
67 Ga0123353_10080024 3300010167 Bacteria 5255
68 Ga0123353_10146438 3300010167 Bacteria 3776
69 Ga0466715_591586 3300042616 Bacteria 26434
70 Ga0466707_128435 3300042601 Bacteria 11615
71 Ga0160469_103054 3300012824 Bacteria 2561
72 Ga0160452_100075 3300012834 Bacteria 131677
73 Ga0562379_0024 3300056790 Bacteria 850122
74 Ga0562375_0610 3300056856 Bacteria 68256
75 Ga0123355_10007341 3300009826 Bacteria 16504
76 Ga0466730_025568 3300042625 Bacteria 2115
77 Ga0466705_478343 3300042612 Bacteria 1847
78 Ga0466729_107251 3300042621 Bacteria 8641
79 Ga0160432_101244 3300012818 Bacteria 8948
80 Ga0160434_100564 3300012850 Bacteria 9323
81 Ga0466705_169726 3300042612 Bacteria 3475
82 Ga0562376_1701 3300056857 Bacteria 29631
83 Ga0123355_10947955 3300009826 Bacteria 925
84 Ga0123356_10299665 3300010049 Bacteria 1712
85 Ga0123354_10112599 3300010882 Bacteria 3581
86 Ga0466703_271360 3300042636 Bacteria 14472
87 Ga0466704_103760 3300042643 Bacteria 3543
88 Ga0466727_163659 3300042655 Bacteria 1157
89 Ga0466706_181400 3300042599 Bacteria 2468
90 Ga0466706_216103 3300042599 Bacteria 4950
91 Ga0160443_100254 3300012848 Bacteria 56034
92 Ga0160434_100008 3300012850 Bacteria 308347
93 JGI24699J35502_11134221 3300002509 Bacteria 67001
94 Ga0562375_0088 3300056856 Bacteria 286142
95 Ga0123353_10097543 3300010167 Bacteria 4737
96 Ga0123353_10666738 3300010167 Bacteria 1468
97 Ga0160442_100248 3300012806 Bacteria 37126
98 Ga0466723_115132 3300042618 Bacteria 2451
99 Ga0466728_345368 3300042620 Bacteria 2517
100 Ga0466713_082210 3300042602 Bacteria 22505
101 Ga0466717_135740 3300042604 Bacteria 2183
102 Ga0160432_100056 3300012818 Bacteria 138739
103 HBC_ctgsDRAFT_1015638 3300000333 Bacteria 1839

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042601 Ga0466707_080865 Ga0466707_080865_171536_172123 195
2 3300042601 Ga0466707_128435 Ga0466707_128435_10236_10823 195
3 3300042602 Ga0466713_063438 Ga0466713_063438_5309_5896 195
4 3300042602 Ga0466713_082210 Ga0466713_082210_1449_2036 195
5 3300042604 Ga0466717_135740 Ga0466717_135740_377_964 195
6 3300002504 JGI24705J35276_12225079 JGI24705J35276_122250793 196
7 3300009784 Ga0123357_10000026 Ga0123357_1000002671 196
8 3300009784 Ga0123357_10118731 Ga0123357_101187313 196
9 3300010049 Ga0123356_10299665 Ga0123356_102996652 196
10 3300010882 Ga0123354_10060498 Ga0123354_100604985 196
11 3300010882 Ga0123354_10112599 Ga0123354_101125993 196
12 3300042599 Ga0466706_216103 Ga0466706_216103_2222_2812 196
13 3300042659 Ga0466733_078683 Ga0466733_078683_24221_24811 196
14 3300056790 Ga0562379_0657 Ga0562379_0657_42845_43435 196
15 3300056857 Ga0562376_1701 Ga0562376_1701_13806_14396 196
16 iso_pr_bacteria 2547132042 2547184376 196
17 iso_pr_bacteria 2820829137 2820829837 196
18 iso_pr_bacteria 2821316722 2821317151 196
19 iso_pr_bacteria 2856882415 2856887449 196
20 iso_pr_bacteria 2856954254 2856954380 196
21 iso_pr_bacteria 2856960404 2856965435 196
22 iso_pr_bacteria 2856973192 2856973950 196
23 iso_pr_bacteria 2859970369 2859974557 196
24 iso_pr_bacteria 2862075925 2862076720 196
25 iso_pr_bacteria 2873589062 2873589789 196
26 iso_pr_bacteria 2888667245 2888668390 196
27 3300009826 Ga0123355_10371131 Ga0123355_103711312 197
28 3300010049 Ga0123356_10426160 Ga0123356_104261602 197
29 3300042602 Ga0466713_152195 Ga0466713_152195_810_1403 197
30 3300042611 Ga0466697_193707 Ga0466697_193707_570_1163 197
31 3300042612 Ga0466705_169726 Ga0466705_169726_1621_2214 197
32 3300042625 Ga0466730_011455 Ga0466730_011455_749_1342 197
33 iso_pr_bacteria 2772190761 2772882545 197
34 iso_pr_bacteria 2821314491 2821315669 197
35 3300010167 Ga0123353_10080024 Ga0123353_100800242 198
36 3300010167 Ga0123353_10666738 Ga0123353_106667381 198
37 3300010882 Ga0123354_10033583 Ga0123354_100335836 198
38 3300042621 Ga0466729_107251 Ga0466729_107251_7099_7695 198
39 iso_pr_bacteria 2816332114 2816398282 198
40 iso_pr_bacteria 2818991320 2819438332 198
41 iso_pr_bacteria 2820935937 2820936948 198
42 iso_pr_bacteria 2837204985 2837206976 198
43 iso_pr_bacteria 2883683260 2883685669 198
44 iso_pr_bacteria 2909412500 2909414000 198
45 iso_pr_bacteria 8062747827 8062749259 198
46 3300010049 Ga0123356_10068572 Ga0123356_100685723 199
47 3300010049 Ga0123356_10078988 Ga0123356_100789882 199
48 3300010049 Ga0123356_10446394 Ga0123356_104463942 199
49 3300012824 Ga0160469_103054 Ga0160469_1030542 199
50 3300012825 Ga0160441_100326 Ga0160441_10032621 199
51 3300012848 Ga0160443_100254 Ga0160443_10025453 199
52 3300012850 Ga0160434_100564 Ga0160434_1005649 199
53 3300012852 Ga0160430_115056 Ga0160430_1150561 199
54 3300012858 Ga0160457_1001308 Ga0160457_10013086 199
55 3300012861 Ga0160436_1000032 Ga0160436_100003228 199
56 3300042599 Ga0466706_181400 Ga0466706_181400_1537_2136 199
57 3300042602 Ga0466713_027509 Ga0466713_027509_343_942 199
58 3300042643 Ga0466704_304461 Ga0466704_304461_3152_3751 199
59 3300042659 Ga0466733_012365 Ga0466733_012365_2984_3583 199
60 3300056856 Ga0562375_0610 Ga0562375_0610_21911_22510 199
61 iso_pr_bacteria 2630969010 2634123933 199
62 iso_pr_bacteria 2836973655 2836973772 199
63 iso_pr_bacteria 2931425734 2931427042 199
64 3300009784 Ga0123357_10493890 Ga0123357_104938901 200
65 3300010167 Ga0123353_10293309 Ga0123353_102933093 200
66 iso_pr_bacteria 2518645556 2518832269 200
67 iso_pr_bacteria 2820845766 2820848108 200
68 iso_pr_bacteria 2820894511 2820895231 200
69 iso_pr_bacteria 2820944107 2820945405 200
70 iso_pr_bacteria 2915166107 2915168060 200
71 iso_pr_bacteria 2915168811 2915170114 200
72 iso_pr_bacteria 8069511479 8069511736 200
73 iso_pr_bacteria 8118075156 8118078562 200
74 3300010167 Ga0123353_10097543 Ga0123353_100975434 201
75 3300012831 Ga0160459_100623 Ga0160459_10062312 201
76 3300042602 Ga0466713_021406 Ga0466713_021406_8962_9567 201
77 3300042602 Ga0466713_102416 Ga0466713_102416_11286_11891 201
78 3300042602 Ga0466713_129388 Ga0466713_129388_11115_11720 201
79 3300042602 Ga0466713_151451 Ga0466713_151451_545_1150 201
80 3300042612 Ga0466705_460805 Ga0466705_460805_205_810 201
81 3300042643 Ga0466704_103760 Ga0466704_103760_300_905 201
82 3300042659 Ga0466733_102585 Ga0466733_102585_88272_88877 201
83 3300056790 Ga0562379_0024 Ga0562379_0024_201065_201670 201
84 3300056856 Ga0562375_0088 Ga0562375_0088_54540_55145 201
85 iso_pr_bacteria 2820816657 2820816915 201
86 iso_pr_bacteria 2820834831 2820835462 201
87 iso_pr_bacteria 2820901319 2820903095 201
88 iso_pr_bacteria 2873558832 2873562107 201
89 iso_pr_bacteria 2931430189 2931431324 201
90 3300002509 JGI24699J35502_10976833 JGI24699J35502_109768331 202
91 3300009784 Ga0123357_10000206 Ga0123357_100002062 202
92 3300009826 Ga0123355_10007341 Ga0123355_1000734114 202
93 3300009826 Ga0123355_10947955 Ga0123355_109479551 202
94 3300009826 Ga0123355_11209948 Ga0123355_112099481 202
95 3300010049 Ga0123356_11110314 Ga0123356_111103141 202
96 3300012848 Ga0160443_100018 Ga0160443_100018181 202
97 3300042602 Ga0466713_061740 Ga0466713_061740_12116_12724 202
98 3300042643 Ga0466704_374071 Ga0466704_374071_7547_8155 202
99 3300002509 JGI24699J35502_11134221 JGI24699J35502_1113422130 203
100 3300042612 Ga0466705_478343 Ga0466705_478343_187_798 203
101 3300042625 Ga0466730_025568 Ga0466730_025568_525_1136 203
102 3300042636 Ga0466703_410962 Ga0466703_410962_448_1059 203
103 3300042649 Ga0466724_46140 Ga0466724_46140_105069_105680 203
104 iso_pr_bacteria 2847305884 2847308910 203
105 3300009784 Ga0123357_10012362 Ga0123357_100123624 204
106 3300042592 Ga0466693_316369 Ga0466693_316369_25090_25722 210
107 3300042602 Ga0466713_080871 Ga0466713_080871_1711_2346 211
108 3300042606 Ga0466719_570799 Ga0466719_570799_189_824 211
109 3300042609 Ga0466722_016796 Ga0466722_016796_2674_3309 211
110 3300042616 Ga0466715_591586 Ga0466715_591586_19280_19915 211
111 3300042618 Ga0466723_102182 Ga0466723_102182_8218_8853 211
112 3300042618 Ga0466723_115132 Ga0466723_115132_179_814 211
113 3300042618 Ga0466723_132985 Ga0466723_132985_921_1556 211
114 3300042636 Ga0466703_271360 Ga0466703_271360_9643_10278 211
115 3300042643 Ga0466704_375651 Ga0466704_375651_4500_5135 211
116 iso_pr_bacteria 2504756063 2504978795 211
117 iso_pr_bacteria 2505679068 2505953268 211
118 iso_pr_bacteria 2820803007 2820804018 211
119 iso_pr_bacteria 2820911766 2820913200 211
120 3300010049 Ga0123356_10007197 Ga0123356_100071972 212
121 3300012850 Ga0160434_100008 Ga0160434_100008241 212
122 3300042596 Ga0466696_053399 Ga0466696_053399_3237_3875 212
123 3300042596 Ga0466696_133766 Ga0466696_133766_5715_6353 212
124 3300042612 Ga0466705_349855 Ga0466705_349855_655_1293 212
125 3300042615 Ga0466711_414168 Ga0466711_414168_140_778 212
126 3300042618 Ga0466723_019168 Ga0466723_019168_24279_24917 212
127 3300042620 Ga0466728_345368 Ga0466728_345368_1550_2188 212
128 3300042643 Ga0466704_230088 Ga0466704_230088_2035_2673 212
129 3300042655 Ga0466727_163659 Ga0466727_163659_371_1009 212
130 iso_pr_bacteria 2681812870 2682013318 212
131 iso_pr_bacteria 2820867525 2820869520 212
132 iso_pr_bacteria 2820929059 2820930263 212
133 iso_pr_bacteria 2883361506 2883363898 212
134 iso_pr_bacteria 2884351759 2884353593 212
135 3300010167 Ga0123353_10146438 Ga0123353_101464382 213
136 3300012806 Ga0160442_100248 Ga0160442_1002487 213
137 3300012812 Ga0160471_106963 Ga0160471_1069631 213
138 3300012815 Ga0160440_102696 Ga0160440_1026962 213
139 3300012834 Ga0160452_100075 Ga0160452_10007593 213
140 3300012849 Ga0160447_123749 Ga0160447_1237491 213
141 3300042609 Ga0466722_096989 Ga0466722_096989_787_1428 213
142 iso_pr_bacteria 2731957681 2732699998 213
143 iso_pr_bacteria 2820825283 2820826189 213
144 iso_pr_bacteria 2848356102 2848357723 213
145 iso_pr_bacteria 2873586004 2873588018 213
146 iso_pr_bacteria 2820842553 2820843228 214
147 iso_pr_bacteria 2820849606 2820849947 214
148 3300012818 Ga0160432_100056 Ga0160432_100056110 220
149 iso_pr_bacteria 2820926697 2820928449 221
150 3300012818 Ga0160432_101244 Ga0160432_1012448 222
151 3300012828 Ga0160431_117631 Ga0160431_1176311 222
152 3300012849 Ga0160447_101594 Ga0160447_1015942 222
153 iso_pr_bacteria 2597490239 2598798401 226
154 iso_pr_bacteria 2824199081 2824200074 226
155 iso_pr_bacteria 2513237174 2514074897 228
156 iso_pr_bacteria 2519899775 2520952274 228
157 iso_pr_bacteria 2568526170 2569120250 228
158 iso_pr_bacteria 2597490194 2598673812 228
159 iso_pr_bacteria 2660238275 2661719565 228
160 iso_pr_bacteria 2671180601 2673427850 228
161 iso_pr_bacteria 2684622916 2686082089 228
162 iso_pr_bacteria 2684622917 2686083801 228
163 iso_pr_bacteria 2684622918 2686085284 228
164 iso_pr_bacteria 2684622919 2686087053 228
165 iso_pr_bacteria 2684622920 2686088797 228
166 iso_pr_bacteria 2693429521 2693516797 228
167 iso_pr_bacteria 2802429577 2805813384 228
168 iso_pr_bacteria 2808606957 2811755523 228
169 iso_pr_bacteria 2865982043 2865983234 228
170 iso_pr_bacteria 2879643867 2879643964 228
171 iso_pr_bacteria 8024981139 8024981425 228
172 iso_pr_bacteria 8024982947 8024983204 228
173 iso_pr_bacteria 8024984606 8024984860 228
174 iso_pr_bacteria 8024986378 8024986680 228
175 iso_pr_bacteria 8032009961 8032010188 228
176 iso_pr_bacteria 8110340172 8110341594 228
177 iso_pr_bacteria 8110341875 8110343201 228
178 3300000333 HBC_ctgsDRAFT_1001065 HBC_ctgsDRAFT_10010652 229
179 3300000333 HBC_ctgsDRAFT_1015638 HBC_ctgsDRAFT_10156383 229
180 3300000333 HBC_ctgsDRAFT_1017532 HBC_ctgsDRAFT_10175322 229
181 3300000333 HBC_ctgsDRAFT_1030447 HBC_ctgsDRAFT_10304472 229
182 iso_pr_bacteria 2600255079 2600868315 235
183 iso_pr_bacteria 2663763384 2666812845 235

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00694 Aconitase_C Aconitase C-terminal domain 1 113 0.92

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.73 0.84 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.