Protein Family IF11256

Metagenome Isolate
201 Members
143 Samples
103 Scaffolds
240.45 Avg Length

🧬 Representative Sequence

ID
iso_pr_bacteria|2663763384|2666812181|
Length
287 aa
Sequence
MAVCAVAVPPLPDDLSCLRSEESFSRRTVNVQETYSKWVDNREMTKPIEASIVVVDDEPSIRDLLVASLHFSGFEVATAASGSEAIEVIEKVQPDLIILDVMLPDIDGFTVTRRIRQEGIEAPVLFLTARDDTQDKVMGLTVGGDDYVTKPFSLEEVVARIRAILRRTHEQEDNNPVISVGDLEINEDSHDVTRAGQPVDLSPTEYKLLRYLMDNEGRVLSKAQILDHVWQYDWGGDAAIVESYISYLRKKVDGVTVRGADGNMHKVAPLIETKRGIGYMIREPKKA

📊 Sample Types

Isolate 48.8%
Metagenome 51.2%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 24.1%
Apidae 14.3%
Termitidae 11.3%
Anthocoridae 7.5%
Scarabaeidae 6.8%
Culicidae 5.3%
Tenebrionidae 5.3%
Cambaridae 4.5%
Kalotermitidae 3.8%
Formicidae 3.0%
Dytiscidae 2.3%
Elmidae 2.3%
Armadillidiidae 2.3%
Cerambycidae 1.5%
Hydrophilidae 1.5%
Curculionidae 1.5%
Drosophilidae 0.8%
Cimicidae 0.8%
Pyralidae 0.8%
Chironomidae 0.8%

🌳 Taxonomy

Archaea 0
Bacteria 179
Eukaryota 0
Viruses 0
Unclassified 22

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2861945162 Microbacterium sp. AR7-10 Isolate Culicidae
2 2873617540 Leucobacter insecticola HDW9B Isolate Dytiscidae
3 2883683260 Protaetiibacter larvae KACC 19322 Isolate Scarabaeidae
4 2894900265 Leucobacter sp. OLTLW20 Isolate Anthocoridae
5 2894929448 Leucobacter sp. OAMSW11 Isolate Anthocoridae
6 2898589227 Actinomadura macrotermitis RB68 Isolate Termitidae
7 2915168811 Leucobacter sp. cx-169 Isolate Cambaridae
8 2568526170 Bifidobacterium sp. A11 Isolate Apidae
9 2600255079 Bifidobacterium bombi DSM 19703 Isolate Apidae
10 2684622919 Bifidobacterium asteroides Bi_199 Isolate Unclassified
11 2731957681 Xylanimicrobium pachnodae JCM 13526, NBRC 107786 Isolate Scarabaeidae
12 2818991320 Klugiella xanthotipulae DSM 18031 Isolate Unclassified
13 8024986378 Bifidobacterium asteroides ESL0198 Isolate Apidae
14 8032009961 Bifidobacterium indicum ESL0197 Isolate Apidae
15 3002678670 Agromyces sp. G127AT Isolate Unclassified
16 3300002501 Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 Metagenome Termitidae
17 3300007129 Ant gut microbial communities from Cephalotes atratus, Brazil Metagenome Formicidae
18 3300012805 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG Metagenome
19 3300012814 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG Metagenome
20 3300012815 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E1 MG Metagenome
21 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
22 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
23 8110341875 Bifidobacterium polysaccharolyticum W8117 Isolate Apidae
24 2847305884 Microbacterium protaetiae DFW100M-13 Isolate Scarabaeidae
25 2864773010 Tsukamurella ocularis S00022 Isolate Elmidae
26 2894981435 Leucobacter sp. OLDS2 Isolate Anthocoridae
27 2084038013 Anoplophora glabripennis gut microbial communities from Worchester, Massachusetts, USA - Larvae Metagenome Cerambycidae
28 2547132042 Pseudonocardia sp. P2 Isolate Formicidae
29 2772190761 Rhodococcus rhodnii NRRL B-16535 Isolate Unclassified
30 2808606957 Bifidobacterium sp. ESL0447 Isolate Unclassified
31 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
32 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
33 3300012831 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG Metagenome Culicidae
34 3300012835 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG Metagenome Culicidae
35 3300012837 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG Metagenome Armadillidiidae
36 3300012850 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E0 MG Metagenome Culicidae
37 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
38 2820825283 Unclassified Actinobacteria Nt197P3bin111 Isolate Unclassified
39 2873620646 Leucobacter coleopterorum HDW9A Isolate Dytiscidae
40 2883361506 Luteimicrobium xylanilyticum HY-24 Isolate Cerambycidae
41 2894935787 Leucobacter sp. OLJS4 Isolate Anthocoridae
42 2909881144 Kocuria sp. cx-455 Isolate Cambaridae
43 2915160415 Leucobacter sp. cx-328 Isolate Cambaridae
44 2918394494 Microbacterium imperiale DSM 20530 Isolate Unclassified
45 2660238275 Bifidobacterium indicum DSM 20214 Isolate Unclassified
46 2684622916 Bifidobacterium asteroides Bi_170 Isolate Unclassified
47 2684622917 Bifidobacterium coryneforme Bi_197 Isolate Unclassified
48 2693429521 Bifidobacterium coryneforme DSM 20216 Isolate Unclassified
49 2788500098 Bombiscardovia coagulans DSM 22924 Isolate Apidae
50 2816332114 Microbacterium saperdae DSM 20169 Isolate Unclassified
51 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
52 8012935351 Brevibacterium epidermidis UD i117 Isolate Unclassified
53 8024982947 Bifidobacterium asteroides ESL0200 Isolate Apidae
54 8067071256 Microbispora camponoti 2C-HV3 Isolate Formicidae
55 3300005721 Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 Metagenome Apidae
56 3300012825 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG Metagenome
57 3300012845 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG Metagenome Culicidae
58 3300012848 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG Metagenome Armadillidiidae
59 3300012861 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG Metagenome Culicidae
60 2820818506 Unclassified Actinobacteria Nt197P3bin3 Isolate Unclassified
61 2820845766 Unclassified Actinobacteria Lab288P3bin96 Isolate Unclassified
62 2824199081 Bifidobacterium commune DSM 28792 Isolate Unclassified
63 2837204985 Lysinimonas sp. 2DFWR-13 Isolate Scarabaeidae
64 2865982043 Bifidobacterium aemilianum XV10 Isolate Apidae
65 2873586004 Sanguibacter sp. HDW7 Isolate Hydrophilidae
66 2894944011 Leucobacter sp. OLAS13 Isolate Anthocoridae
67 2915166107 Leucobacter sp. cx-87 Isolate Cambaridae
68 2505679068 Isoptericola variabilis 225 Isolate Unclassified
69 2513237174 Bifidobacterium asteroides ATCC 25910 Isolate Apidae
70 2645727657 Bifidobacterium actinocoloniiforme DSM 22766 Isolate Unclassified
71 2767802234 Cytobacillus kochii BDGP4 Isolate Drosophilidae
72 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
73 646564587 Tsukamurella paurometabola 33, DSM 20162 Isolate Cimicidae
74 8077775691 Tsukamurella sp. PLM1 Isolate Formicidae
75 3300012818 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E0 MG Metagenome
76 3300012834 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG Metagenome
77 3300012857 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG Metagenome Culicidae
78 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
79 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
80 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
81 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
82 2820867525 Unclassified Actinobacteria Lab288P3bin128 Isolate Unclassified
83 2841168549 Agromyces protaetiae FW100M-8 Isolate Scarabaeidae
84 2864918810 Tsukamurella ocularis S00175 Isolate Elmidae
85 2873614151 Leucobacter viscericola HDW9C Isolate Dytiscidae
86 2879643867 Bifidobacterium sp. wkB344 Isolate Apidae
87 2884351759 Cellulosimicrobium sp. BI34T Isolate Pyralidae
88 2894897082 Leucobacter sp. OLCS4 Isolate Anthocoridae
89 2894974975 Leucobacter sp. OLIS6 Isolate Anthocoridae
90 2684622920 Bifidobacterium asteroides Bi_200 Isolate Unclassified
91 3300012809 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E11 MG Metagenome
92 3300012858 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG Metagenome Armadillidiidae
93 8118075156 Actinosynnema pretiosum DSM 44131 Isolate Unclassified
94 2820897376 Unclassified Actinobacteria Lab288P1bin101 Isolate Unclassified
95 2836973655 Gryllotalpicola protaetiae 2DFW10M-5 Isolate Scarabaeidae
96 2856652821 Actinomadura rubteroloni RB29 Isolate Unclassified
97 2894926108 Leucobacter sp. OLES1 Isolate Anthocoridae
98 2912817845 Streptomyces griseus SID164 Isolate
99 2918390780 Glutamicibacter protophormiae DSM 20168 Isolate Unclassified
100 2684622918 Bifidobacterium asteroides Bi_198 Isolate Unclassified
101 3300056790 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) Metagenome Tenebrionidae
102 3300056856 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) Metagenome Tenebrionidae
103 8024981139 Bifidobacterium asteroides ESL0170 Isolate Apidae
104 8024984606 Bifidobacterium asteroides ESL0199 Isolate Apidae
105 8069511479 Arthrobacter ipsi IA7 Isolate Curculionidae
106 3300012828 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E0 MG Metagenome
107 3300012852 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG Metagenome
108 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
109 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
110 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
111 2864964650 Tsukamurella ocularis S00236 Isolate Elmidae
112 2873589062 Phycicoccus sp. HDW14 Isolate Hydrophilidae
113 2884613238 Agromyces intestinalis KACC 19306 Isolate Scarabaeidae
114 2915157839 Leucobacter sp. cx-42 Isolate Cambaridae
115 2504756063 Isoptericola variabilis J5 Isolate Unclassified
116 2597490194 Bifidobacterium coryneforme LMG 18911 Isolate Apidae
117 2671180601 Bifidobacterium asteroides DSM 20089 Isolate Unclassified
118 2734481968 Xylanimicrobium pachnodae JCM 13526, NBRC 107786 Isolate Scarabaeidae
119 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
120 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
121 3300056564 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) Metagenome Tenebrionidae
122 3300056814 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) Metagenome Tenebrionidae
123 3300056857 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) Metagenome Tenebrionidae
124 3300057007 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) Metagenome Tenebrionidae
125 8046957834 Streptomyces coacervatus JCM 17138 Isolate Unclassified
126 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
127 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
128 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
129 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
130 8110340172 Bifidobacterium choladohabitans B14384H11 Isolate Apidae
131 2848356102 Xylanimonas allomyrinae 2JSPR-7 Isolate Scarabaeidae
132 2865983822 Bifidobacterium xylocopae XV2 Isolate Apidae
133 2894932631 Leucobacter sp. OAMLP11 Isolate Anthocoridae
134 2894966443 Leucobacter sp. OLCALW19 Isolate Anthocoridae
135 2910090113 Kocuria sp. cx-116 Isolate Cambaridae
136 2519899775 Bifidobacterium asteroides PRL2011 Isolate Apidae
137 2524023214 Leucobacter chironomi DSM 19883 Isolate Chironomidae
138 2597490239 Bifidobacterium bohemicum DSM 22767 Isolate Unclassified
139 2663763384 Bifidobacterium bombi DSM 19703 Isolate Apidae
140 647000328 Streptomyces sp. ACT-1 XylebKG-1 Isolate Curculionidae
141 8067987626 Agromyces larvae CFWR-12 Isolate Unclassified
142 8073544309 Actinomadura sp. RB99 Isolate Termitidae
143 3300000333 Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony Metagenome Apidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0530661_000023 3300056564 Bacteria 193293
2 Ga0530661_000163 3300056564 Bacteria 58031
3 Ga0562379_0012 3300056790 Bacteria 1590196
4 Ga0562379_0776 3300056790 Unclassified 51944
5 Ga0562375_0153 3300056856 Unclassified 202576
6 Ga0160453_101731 3300012814 Unclassified 6665
7 Ga0160452_100998 3300012834 Bacteria 10463
8 Ga0160457_1000489 3300012858 Bacteria 17710
9 Ga0160457_1006037 3300012858 Bacteria 1811
10 Ga0160436_1000017 3300012861 Bacteria 112955
11 Ga0466711_194571 3300042615 Bacteria 1946
12 Ga0123356_10015330 3300010049 Bacteria 7350
13 Ga0123353_10390739 3300010167 Bacteria 2076
14 Ga0074278_100985 3300005721 Unclassified 3674
15 Ga0530661_002108 3300056564 Bacteria 8100
16 Ga0562379_0046 3300056790 Bacteria 565608
17 Ga0562375_4256 3300056856 Bacteria 11204
18 Ga0562376_0325 3300056857 Bacteria 94096
19 Ga0160436_1002712 3300012861 Unclassified 4422
20 Ga0466710_200624 3300042613 Bacteria 1050
21 Ga0466724_06827 3300042649 Bacteria 229782
22 AustNasuHG_c1000517 3300000089 Bacteria 13504
23 AustNasuHG_c1018305 3300000089 Bacteria 2314
24 HBC_ctgsDRAFT_1007058 3300000333 Unclassified 2640
25 Ga0074278_115102 3300005721 Unclassified 3929
26 Ga0466705_041459 3300042612 Bacteria 1245
27 Ga0466705_377749 3300042612 Bacteria 5499
28 Ga0562375_0868 3300056856 Unclassified 49783
29 Ga0562376_0508 3300056857 Bacteria 69785
30 Ga0562376_1986 3300056857 Unclassified 26457
31 Ga0562374_0087 3300057007 Bacteria 263849
32 Ga0160430_113714 3300012852 Bacteria 1272
33 Ga0466723_120188 3300042618 Bacteria 25242
34 Ga0123353_10030476 3300010167 Unclassified 8337
35 Ga0123354_10074997 3300010882 Unclassified 4840
36 Ga0160464_101718 3300012805 Unclassified 6140
37 Ga0160466_100013 3300012809 Bacteria 386401
38 Ga0466730_017522 3300042625 Bacteria 1379
39 Ga0562378_0013 3300056814 Bacteria 998154
40 Ga0562375_2013 3300056856 Bacteria 24400
41 Ga0562374_0036 3300057007 Bacteria 691317
42 Ga0160459_101861 3300012831 Bacteria 3927
43 Ga0160430_100027 3300012852 Bacteria 204805
44 Ga0160435_1000057 3300012857 Bacteria 79976
45 Ga0160435_1001787 3300012857 Unclassified 5314
46 Ga0466693_218291 3300042592 Bacteria 114325
47 Ga0466691_159898 3300042593 Bacteria 15397
48 Ga0466723_025146 3300042618 Bacteria 20521
49 Ga0466730_013775 3300042625 Bacteria 78685
50 Ga0466730_041849 3300042625 Bacteria 1407
51 Ga0466730_087940 3300042625 Bacteria 3286
52 Ga0466724_19822 3300042649 Bacteria 331658
53 Ga0466724_47439 3300042649 Bacteria 410820
54 Ga0466707_061285 3300042601 Bacteria 45531
55 Ga0466713_092579 3300042602 Bacteria 53429
56 Ga0466719_159939 3300042606 Bacteria 5662
57 JGI24703J35330_11416265 3300002501 Unclassified 982
58 Ga0466697_168156 3300042611 Bacteria 11396
59 Ga0562375_0043 3300056856 Bacteria 520629
60 Ga0160446_100060 3300012835 Bacteria 113052
61 Ga0160457_1000032 3300012858 Bacteria 254159
62 Ga0466723_230249 3300042618 Bacteria 1964
63 Ga0466730_039654 3300042625 Bacteria 1068
64 Ga0466725_025427 3300042654 Bacteria 2561
65 AglaG_contig21039 2084038013 Bacteria 2380
66 Ga0102734_1032109 3300007129 Bacteria 1354
67 Ga0562379_0216 3300056790 Bacteria 161074
68 Ga0562374_0302 3300057007 Bacteria 93359
69 Ga0160441_100148 3300012825 Bacteria 76466
70 Ga0160431_103102 3300012828 Bacteria 3559
71 Ga0160459_100138 3300012831 Bacteria 47276
72 Ga0160452_100003 3300012834 Bacteria 748778
73 Ga0160443_100006 3300012848 Bacteria 647325
74 Ga0160435_1022327 3300012857 Unclassified 1104
75 Ga0466657_006791 3300042582 Bacteria 1051
76 Ga0466730_009850 3300042625 Bacteria 1280
77 Ga0530661_000171 3300056564 Unclassified 56377
78 Ga0562377_0076 3300056842 Bacteria 380477
79 Ga0562376_0363 3300056857 Unclassified 86837
80 Ga0160440_104884 3300012815 Unclassified 1251
81 Ga0160432_100308 3300012818 Bacteria 38724
82 Ga0160455_100377 3300012837 Bacteria 25435
83 Ga0160434_100056 3300012850 Bacteria 80790
84 Ga0160430_102689 3300012852 Unclassified 5449
85 Ga0160436_1000020 3300012861 Bacteria 107309
86 Ga0123353_10023221 3300010167 Bacteria 9385
87 Ga0123353_10039092 3300010167 Bacteria 7464
88 Ga0466730_025089 3300042625 Bacteria 2617
89 Ga0466730_030063 3300042625 Bacteria 2066
90 Ga0466724_11286 3300042649 Bacteria 22479
91 Ga0562378_0637 3300056814 Unclassified 52943
92 Ga0562376_0002 3300056857 Bacteria 3502070
93 Ga0562376_0082 3300056857 Bacteria 224736
94 Ga0562376_0090 3300056857 Bacteria 217989
95 Ga0562376_1612 3300056857 Bacteria 30744
96 Ga0562376_5435 3300056857 Bacteria 8278
97 Ga0160460_106384 3300012845 Bacteria 1618
98 Ga0466657_364432 3300042582 Bacteria 1887
99 Ga0466711_496353 3300042615 Bacteria 3943
100 Ga0466730_097062 3300042625 Bacteria 1402
101 AglaG_contig18733 2084038013 Unclassified 2900
102 JGI24703J35330_11306118 3300002501 Unclassified 854
103 Ga0072940_1139702 3300005200 Bacteria 899

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300012861 Ga0160436_1000020 Ga0160436_100002071 228
2 3300042649 Ga0466724_06827 Ga0466724_06827_181754_182497 228
3 3300056857 Ga0562376_0002 Ga0562376_0002_1406998_1407735 228
4 3300042654 Ga0466725_025427 Ga0466725_025427_21_710 229
5 3300056564 Ga0530661_002108 Ga0530661_002108_6108_6845 229
6 3300056842 Ga0562377_0076 Ga0562377_0076_318517_319254 229
7 2084038013 AglaG_contig18733 AglaG_01319370 230
8 3300042601 Ga0466707_061285 Ga0466707_061285_14586_15335 230
9 3300042649 Ga0466724_11286 Ga0466724_11286_11825_12517 230
10 iso_pr_bacteria 2816332114 2816397039 230
11 iso_pr_bacteria 2820845766 2820847439 230
12 iso_pr_bacteria 2820867525 2820868064 230
13 iso_pr_bacteria 2836973655 2836974510 230
14 iso_pr_bacteria 2837204985 2837205687 230
15 iso_pr_bacteria 2841168549 2841170246 230
16 iso_pr_bacteria 2847305884 2847306115 230
17 iso_pr_bacteria 2861945162 2861945349 230
18 iso_pr_bacteria 2883683260 2883684222 230
19 iso_pr_bacteria 2884613238 2884615956 230
20 iso_pr_bacteria 2918394494 2918397483 230
21 iso_pr_bacteria 3002678670 3002681093 230
22 iso_pr_bacteria 8067987626 8067989449 230
23 3300002501 JGI24703J35330_11306118 JGI24703J35330_113061181 231
24 3300010167 Ga0123353_10023221 Ga0123353_100232218 231
25 3300010167 Ga0123353_10030476 Ga0123353_100304764 231
26 3300012805 Ga0160464_101718 Ga0160464_1017184 231
27 3300012814 Ga0160453_101731 Ga0160453_1017314 231
28 3300012815 Ga0160440_104884 Ga0160440_1048842 231
29 3300012825 Ga0160441_100148 Ga0160441_10014839 231
30 3300012828 Ga0160431_103102 Ga0160431_1031022 231
31 3300012831 Ga0160459_101861 Ga0160459_1018614 231
32 3300012837 Ga0160455_100377 Ga0160455_1003774 231
33 3300012852 Ga0160430_100027 Ga0160430_100027185 231
34 3300012852 Ga0160430_102689 Ga0160430_1026894 231
35 3300012857 Ga0160435_1000057 Ga0160435_100005772 231
36 3300012857 Ga0160435_1001787 Ga0160435_10017874 231
37 3300012857 Ga0160435_1022327 Ga0160435_10223272 231
38 3300012858 Ga0160457_1000032 Ga0160457_100003291 231
39 3300012858 Ga0160457_1006037 Ga0160457_10060372 231
40 3300012861 Ga0160436_1000017 Ga0160436_100001777 231
41 3300012861 Ga0160436_1002712 Ga0160436_10027122 231
42 3300042618 Ga0466723_120188 Ga0466723_120188_1002_1697 231
43 3300042618 Ga0466723_230249 Ga0466723_230249_1002_1697 231
44 3300042625 Ga0466730_025089 Ga0466730_025089_1234_1929 231
45 3300042649 Ga0466724_47439 Ga0466724_47439_231936_232631 231
46 iso_pr_bacteria 2818991320 2819436805 231
47 iso_pr_bacteria 2873589062 2873592880 231
48 3300007129 Ga0102734_1032109 Ga0102734_10321092 232
49 3300042606 Ga0466719_159939 Ga0466719_159939_3912_4610 232
50 iso_pr_bacteria 2915166107 2915167740 232
51 iso_pr_bacteria 2915168811 2915169495 232
52 3300056857 Ga0562376_5435 Ga0562376_5435_590_1291 233
53 iso_pr_bacteria 2524023214 2524490032 233
54 iso_pr_bacteria 2873614151 2873615596 233
55 iso_pr_bacteria 2873617540 2873617650 233
56 iso_pr_bacteria 2873620646 2873623763 233
57 iso_pr_bacteria 2894897082 2894898355 233
58 iso_pr_bacteria 2894900265 2894902504 233
59 iso_pr_bacteria 2894926108 2894926986 233
60 iso_pr_bacteria 2894929448 2894932065 233
61 iso_pr_bacteria 2894932631 2894935010 233
62 iso_pr_bacteria 2894935787 2894936556 233
63 iso_pr_bacteria 2894944011 2894946860 233
64 iso_pr_bacteria 2894966443 2894969396 233
65 iso_pr_bacteria 2894974975 2894976753 233
66 iso_pr_bacteria 2894981435 2894984031 233
67 iso_pr_bacteria 2915157839 2915158891 233
68 iso_pr_bacteria 2915160415 2915161452 233
69 iso_pr_bacteria 8118075156 8118079089 233
70 3300042625 Ga0466730_041849 Ga0466730_041849_510_1214 234
71 3300056814 Ga0562378_0013 Ga0562378_0013_523740_524513 234
72 3300005200 Ga0072940_1139702 Ga0072940_11397021 235
73 3300042649 Ga0466724_19822 Ga0466724_19822_26715_27422 235
74 3300056564 Ga0530661_000163 Ga0530661_000163_21296_22003 235
75 3300056856 Ga0562375_4256 Ga0562375_4256_6579_7286 235
76 3300056857 Ga0562376_0082 Ga0562376_0082_176413_177159 235
77 iso_pr_bacteria 2547132042 2547178380 235
78 iso_pr_bacteria 2864773010 2864776612 235
79 iso_pr_bacteria 2864918810 2864919148 235
80 iso_pr_bacteria 2864964650 2864966840 235
81 iso_pr_bacteria 2918390780 2918392360 235
82 iso_pr_bacteria 646564587 646806441 235
83 iso_pr_bacteria 8077775691 8077779921 235
84 3300010167 Ga0123353_10039092 Ga0123353_100390926 236
85 3300010882 Ga0123354_10074997 Ga0123354_100749972 236
86 3300012848 Ga0160443_100006 Ga0160443_100006577 236
87 iso_pr_bacteria 2820897376 2820897641 236
88 3300012831 Ga0160459_100138 Ga0160459_10013833 237
89 3300042593 Ga0466691_159898 Ga0466691_159898_10811_11524 237
90 iso_pr_bacteria 2767802234 2769332694 237
91 iso_pr_bacteria 2909881144 2909882770 237
92 iso_pr_bacteria 2910090113 2910092165 237
93 iso_pr_bacteria 8069511479 8069514879 237
94 2084038013 AglaG_contig21039 AglaG_05387960 238
95 3300010049 Ga0123356_10015330 Ga0123356_100153305 238
96 3300042592 Ga0466693_218291 Ga0466693_218291_39247_39963 238
97 3300042625 Ga0466730_030063 Ga0466730_030063_1242_1961 239
98 3300042625 Ga0466730_087940 Ga0466730_087940_2256_2975 239
99 3300056790 Ga0562379_0012 Ga0562379_0012_382912_383631 239
100 3300056790 Ga0562379_0046 Ga0562379_0046_324522_325241 239
101 3300056790 Ga0562379_0216 Ga0562379_0216_132001_132720 239
102 3300056856 Ga0562375_0868 Ga0562375_0868_10032_10751 239
103 3300056857 Ga0562376_0090 Ga0562376_0090_177182_177901 239
104 3300056857 Ga0562376_0363 Ga0562376_0363_83210_83929 239
105 3300057007 Ga0562374_0087 Ga0562374_0087_82822_83541 239
106 3300057007 Ga0562374_0302 Ga0562374_0302_3785_4504 239
107 3300042612 Ga0466705_377749 Ga0466705_377749_3143_3865 240
108 3300042625 Ga0466730_017522 Ga0466730_017522_211_933 240
109 3300042625 Ga0466730_097062 Ga0466730_097062_345_1067 240
110 iso_pr_bacteria 2873586004 2873588519 240
111 iso_pr_bacteria 8067071256 8067075306 240
112 3300042618 Ga0466723_025146 Ga0466723_025146_11637_12362 241
113 iso_pr_bacteria 8046957834 8046967004 241
114 3300042582 Ga0466657_364432 Ga0466657_364432_1057_1785 242
115 3300056857 Ga0562376_0508 Ga0562376_0508_20293_21021 242
116 iso_pr_bacteria 2883361506 2883364456 242
117 iso_pr_bacteria 2898589227 2898591820 242
118 3300012809 Ga0160466_100013 Ga0160466_100013314 243
119 3300012834 Ga0160452_100998 Ga0160452_1009988 243
120 3300042602 Ga0466713_092579 Ga0466713_092579_13162_13893 243
121 3300042611 Ga0466697_168156 Ga0466697_168156_1502_2233 243
122 3300042615 Ga0466711_496353 Ga0466711_496353_453_1184 243
123 iso_pr_bacteria 2824199081 2824199154 243
124 iso_pr_bacteria 2856652821 2856654027 243
125 3300042615 Ga0466711_194571 Ga0466711_194571_827_1591 244
126 3300042625 Ga0466730_009850 Ga0466730_009850_384_1118 244
127 3300056564 Ga0530661_000023 Ga0530661_000023_110870_111604 244
128 iso_pr_bacteria 2731957681 2732700151 244
129 iso_pr_bacteria 2734481968 2734844073 244
130 iso_pr_bacteria 2847305884 2847308626 244
131 iso_pr_bacteria 2865982043 2865982166 244
132 iso_pr_bacteria 2883683260 2883683497 244
133 3300012852 Ga0160430_113714 Ga0160430_1137142 245
134 3300042582 Ga0466657_006791 Ga0466657_006791_215_952 245
135 3300042613 Ga0466710_200624 Ga0466710_200624_237_974 245
136 iso_pr_bacteria 2837204985 2837206568 245
137 iso_pr_bacteria 2884351759 2884353038 245
138 iso_pr_bacteria 8073544309 8073546416 245
139 3300012818 Ga0160432_100308 Ga0160432_10030810 246
140 3300012834 Ga0160452_100003 Ga0160452_100003461 246
141 3300012858 Ga0160457_1000489 Ga0160457_100048918 246
142 3300042625 Ga0466730_039654 Ga0466730_039654_189_929 246
143 iso_pr_bacteria 2820825283 2820827726 246
144 iso_pr_bacteria 8069511479 8069513126 246
145 3300002501 JGI24703J35330_11416265 JGI24703J35330_114162651 247
146 3300012835 Ga0160446_100060 Ga0160446_10006068 247
147 3300012845 Ga0160460_106384 Ga0160460_1063842 247
148 3300012850 Ga0160434_100056 Ga0160434_10005636 247
149 iso_pr_bacteria 2597490239 2598797746 247
150 3300010167 Ga0123353_10390739 Ga0123353_103907391 248
151 iso_pr_bacteria 2645727657 2646405507 248
152 iso_pr_bacteria 2865983822 2865983886 248
153 iso_pr_bacteria 2912817845 2912824600 248
154 iso_pr_bacteria 647000328 647324731 248
155 3300057007 Ga0562374_0036 Ga0562374_0036_534737_535486 249
156 iso_pr_bacteria 2504756063 2504978399 249
157 iso_pr_bacteria 2505679068 2505953747 249
158 iso_pr_bacteria 2788500098 2789514261 249
159 iso_pr_bacteria 2848356102 2848358366 249
160 3300000089 AustNasuHG_c1000517 AustNasuHG_100051710 251
161 3300000089 AustNasuHG_c1018305 AustNasuHG_10183052 251
162 3300042625 Ga0466730_013775 Ga0466730_013775_64244_64999 251
163 3300056856 Ga0562375_2013 Ga0562375_2013_8607_9362 251
164 iso_pr_bacteria 2597490194 2598674492 251
165 iso_pr_bacteria 2660238275 2661718955 251
166 iso_pr_bacteria 2684622917 2686084469 251
167 iso_pr_bacteria 2693429521 2693516675 251
168 iso_pr_bacteria 2820818506 2820819964 251
169 iso_pr_bacteria 8032009961 8032010861 251
170 3300000333 HBC_ctgsDRAFT_1007058 HBC_ctgsDRAFT_10070582 252
171 3300056564 Ga0530661_000171 Ga0530661_000171_47710_48468 252
172 3300056790 Ga0562379_0776 Ga0562379_0776_4516_5274 252
173 3300056814 Ga0562378_0637 Ga0562378_0637_21691_22449 252
174 3300056856 Ga0562375_0153 Ga0562375_0153_108723_109481 252
175 3300056857 Ga0562376_0325 Ga0562376_0325_29401_30159 252
176 3300056857 Ga0562376_1612 Ga0562376_1612_5395_6153 252
177 3300056857 Ga0562376_1986 Ga0562376_1986_16494_17252 252
178 iso_pr_bacteria 2513237174 2514075083 252
179 iso_pr_bacteria 2519899775 2520953070 252
180 iso_pr_bacteria 2568526170 2569119111 252
181 iso_pr_bacteria 2671180601 2673428017 252
182 iso_pr_bacteria 2684622916 2686082882 252
183 iso_pr_bacteria 2684622918 2686086127 252
184 iso_pr_bacteria 2684622919 2686087905 252
185 iso_pr_bacteria 2684622920 2686089552 252
186 iso_pr_bacteria 2808606957 2811756391 252
187 iso_pr_bacteria 2879643867 2879644490 252
188 iso_pr_bacteria 8012935351 8012936567 252
189 iso_pr_bacteria 8024981139 8024982231 252
190 iso_pr_bacteria 8024982947 8024983970 252
191 iso_pr_bacteria 8024984606 8024985724 252
192 iso_pr_bacteria 8024986378 8024987535 252
193 iso_pr_bacteria 8110340172 8110340286 252
194 iso_pr_bacteria 8110341875 8110343374 252
195 3300005721 Ga0074278_100985 Ga0074278_1009853 253
196 3300005721 Ga0074278_115102 Ga0074278_1151022 253
197 3300042612 Ga0466705_041459 Ga0466705_041459_36_803 255
198 3300056856 Ga0562375_0043 Ga0562375_0043_317676_318443 255
199 iso_pr_bacteria 2772190761 2772887527 256
200 iso_pr_bacteria 2600255079 2600868014 287
201 iso_pr_bacteria 2663763384 2666812181 287

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00072 Response_reg Response regulator receiver domain 52 162 0.99
PF00486 Trans_reg_C Transcriptional regulatory protein, C terminal 196 280 0.88

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF00072 GO:0000160 phosphorelay signal transduction system BP

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.51 0.58 Medium

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.