Protein Family IF11228

Metagenome Isolate
158 Members
84 Samples
109 Scaffolds
226.04 Avg Length

🧬 Representative Sequence

ID
iso_pr_bacteria|2648501322|2649446735|
Length
253 aa
Sequence
MRIAIAGAGAVGRSIAGELLENGHEVLLVDKTPTAISVERVPRAEWLLADACEITSLDEAALQRCNVVIAATGDDKVNLVVSLLAKTEYAVPRVVARVNNPKNEWLFNESWGVDVAVSTPRLMSALVEEAVSVGDLVRLLRFSHGDANLVELTLPPESELAGTRVGEVRWPEDTSLVTIIRGTRVLAPTVEDHLEAGDELLFVAAQSREEQLEALLSGRGDGVGAGGVVRPGGGVRGARAPGPPSSXXAPPPP

📊 Sample Types

Isolate 31.0%
Metagenome 69.0%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 35.4%
Termitidae 21.5%
Kalotermitidae 15.2%
Formicidae 6.3%
Tenebrionidae 5.1%
Cambaridae 3.8%
Rhinotermitidae 3.8%
Elmidae 1.3%
Curculionidae 1.3%
Reduviidae 1.3%
Siricidae 1.3%
Termopsidae 1.3%
Thomisidae 1.3%
Hodotermitidae 1.3%

🌳 Taxonomy

Archaea 0
Bacteria 141
Eukaryota 0
Viruses 0
Unclassified 17

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820867525 Unclassified Actinobacteria Lab288P3bin128 Isolate Unclassified
2 2912749649 Streptomyces sp. GS7 Isolate Termitidae
3 3006461590 Streptomyces sp. RB5 Isolate Termitidae
4 3006667155 Streptomyces sp. SID9727 Isolate
5 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
6 8062747827 Yimella sp. cx-51 Isolate Cambaridae
7 2515154106 Streptomyces sp. FxanaD5 Isolate Unclassified
8 2718217924 Pseudonocardia sp. HH130630-07 Isolate Formicidae
9 2772190761 Rhodococcus rhodnii NRRL B-16535 Isolate Unclassified
10 2820838073 Unclassified Actinobacteria Lab288P4bin27 Isolate Unclassified
11 2820842553 Unclassified Actinobacteria Lab288P4bin104 Isolate Unclassified
12 2820876581 Unclassified Actinobacteria Lab288P1bin83 Isolate Unclassified
13 2820929059 Unclassified Actinobacteria Emb289P3bin110 Isolate Unclassified
14 2862784999 Streptomyces sp. M41 Isolate Unclassified
15 2909412500 Yimella sp. cx-573 Isolate Cambaridae
16 2931425734 Nocardioides sp. J2M5 Isolate
17 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
18 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
19 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
20 2820882373 Unclassified Actinobacteria Lab288P1bin45 Isolate Unclassified
21 2856652821 Actinomadura rubteroloni RB29 Isolate Unclassified
22 2864899338 Mycobacteroides chelonae S00154 Isolate Elmidae
23 2873196663 Streptomyces capitiformicae 1H-SSA4 Isolate Formicidae
24 2908241010 Streptomyces sp. HF10 Isolate Termitidae
25 2912817845 Streptomyces griseus SID164 Isolate
26 3006468911 Streptomyces sp. RB17 Isolate Termitidae
27 3300012852 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG Metagenome
28 3300056790 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) Metagenome Tenebrionidae
29 3300056856 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) Metagenome Tenebrionidae
30 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
31 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
32 2515154100 Streptomyces sp. MspMP-M5 Isolate Unclassified
33 2515154104 Streptomyces sp. KhCrAH-244 Isolate Unclassified
34 2821316722 Unclassified Actinobacteria Lab288P1bin78 Isolate Unclassified
35 2896955351 Streptomyces sp. GF20 Isolate Termitidae
36 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
37 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
38 647000328 Streptomyces sp. ACT-1 XylebKG-1 Isolate Curculionidae
39 8053361298 Streptomyces formicae 1H-GS9 Isolate Unclassified
40 8073544309 Actinomadura sp. RB99 Isolate Termitidae
41 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
42 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
43 2545824723 Rhodococcus rhodnii LMG 5362 Isolate Reduviidae
44 2547132081 Streptomyces sp. S4 Isolate Formicidae
45 2820911766 Unclassified Actinobacteria Emb289P3bin96 Isolate Unclassified
46 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
47 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
48 8067071256 Microbispora camponoti 2C-HV3 Isolate Formicidae
49 2820849606 Unclassified Actinobacteria Lab288P3bin39 Isolate Unclassified
50 2820889385 Unclassified Actinobacteria Lab288P1bin133 Isolate Unclassified
51 2820922474 Unclassified Actinobacteria Emb289P3bin154 Isolate Unclassified
52 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
53 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
54 8062637095 Yimella sp. cx-51 Isolate Cambaridae
55 8077783556 Streptomyces sp. PLM4 Isolate Formicidae
56 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
57 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
58 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
59 2523533511 Streptomyces sp. Sv. ACTE SirexAA-E Isolate Siricidae
60 2820857933 Unclassified Actinobacteria Lab288P3bin173 Isolate Unclassified
61 2820863028 Unclassified Actinobacteria Lab288P3bin164 Isolate Unclassified
62 2820899690 Unclassified Actinobacteria Emb289P4bin9 Isolate Unclassified
63 2852016966 Micromonospora polyrhachis DSM 45886 Isolate Unclassified
64 2898589227 Actinomadura macrotermitis RB68 Isolate Termitidae
65 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
66 3300012805 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG Metagenome
67 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
68 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
69 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
70 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
71 2630969010 Friedmanniella luteola DSM 21741 Isolate Thomisidae
72 2648501322 Streptomyces sp. SA3_actF Isolate Unclassified
73 2820814774 Unclassified Actinobacteria Nt197P3bin39 Isolate Unclassified
74 2820935937 Unclassified Actinobacteria Emb289P1bin40 Isolate Unclassified
75 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
76 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
77 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
78 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
79 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
80 3300057007 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) Metagenome Tenebrionidae
81 8046957834 Streptomyces coacervatus JCM 17138 Isolate Unclassified
82 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
83 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
84 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0562377_0089 3300056842 Bacteria 334543
2 Ga0562374_0370 3300057007 Unclassified 82894
3 Ga0466729_152417 3300042621 Bacteria 2435
4 Ga0466707_183290 3300042601 Bacteria 1346
5 Ga0466713_024393 3300042602 Bacteria 57144
6 Ga0466729_261188 3300042621 Bacteria 8846
7 Ga0466730_009923 3300042625 Unclassified 39383
8 Ga0466730_075687 3300042625 Bacteria 1555
9 Ga0466703_164152 3300042636 Bacteria 18213
10 Ga0466704_166380 3300042643 Bacteria 6160
11 Ga0466708_139236 3300042652 Bacteria 8356
12 Ga0160430_100023 3300012852 Bacteria 213821
13 Ga0466696_502927 3300042596 Bacteria 1771
14 Ga0466705_169625 3300042612 Unclassified 11247
15 Ga0466729_040130 3300042621 Bacteria 5784
16 Ga0466713_069100 3300042602 Bacteria 3317
17 Ga0466722_188090 3300042609 Bacteria 1858
18 Ga0466704_021875 3300042643 Unclassified 21856
19 Ga0466704_304310 3300042643 Bacteria 2176
20 Ga0466692_170631 3300042591 Bacteria 3279
21 Ga0123357_10302749 3300009784 Bacteria 1612
22 Ga0123356_10016040 3300010049 Bacteria 7160
23 Ga0123354_10061568 3300010882 Unclassified 5537
24 Ga0466705_017252 3300042612 Unclassified 4895
25 Ga0562379_0272 3300056790 Bacteria 134461
26 Ga0466707_301133 3300042601 Bacteria 7676
27 Ga0466713_063930 3300042602 Bacteria 28203
28 Ga0466719_106946 3300042606 Bacteria 1218
29 Ga0466730_018111 3300042625 Bacteria 4137
30 Ga0466730_075424 3300042625 Bacteria 1906
31 Ga0466703_264351 3300042636 Bacteria 8984
32 Ga0466727_304120 3300042655 Bacteria 5740
33 Ga0123353_10214238 3300010167 Unclassified 3018
34 Ga0466705_002181 3300042612 Unclassified 4802
35 Ga0562375_1890 3300056856 Bacteria 25702
36 Ga0466711_147473 3300042615 Bacteria 1226
37 Ga0466715_098191 3300042616 Bacteria 12625
38 Ga0466723_268134 3300042618 Bacteria 19029
39 Ga0466706_273489 3300042599 Bacteria 4563
40 Ga0466713_001459 3300042602 Bacteria 7529
41 Ga0466713_125635 3300042602 Bacteria 4115
42 Ga0466697_031950 3300042611 Bacteria 2150
43 Ga0466730_029550 3300042625 Bacteria 4865
44 Ga0466730_055295 3300042625 Bacteria 36218
45 Ga0466730_074357 3300042625 Bacteria 1812
46 Ga0466703_302535 3300042636 Bacteria 6381
47 Ga0123355_10004847 3300009826 Unclassified 19583
48 Ga0123355_10186008 3300009826 Bacteria 3071
49 Ga0123356_10006286 3300010049 Bacteria 11998
50 Ga0123353_10000509 3300010167 Unclassified 48119
51 Ga0466711_498719 3300042615 Bacteria 1406
52 Ga0466723_183121 3300042618 Bacteria 4627
53 Ga0466723_270859 3300042618 Bacteria 11896
54 Ga0466728_009467 3300042620 Bacteria 1557
55 Ga0466703_151404 3300042636 Bacteria 56967
56 Ga0466703_255624 3300042636 Bacteria 18014
57 Ga0466727_235674 3300042655 Bacteria 2548
58 Ga0466690_242197 3300042590 Bacteria 1693
59 Ga0466696_266100 3300042596 Bacteria 1082
60 Ga0123353_10059060 3300010167 Unclassified 6149
61 Ga0160464_108962 3300012805 Bacteria 932
62 JGI24702J35022_10110690 3300002462 Bacteria 1510
63 Ga0466705_201718 3300042612 Bacteria 8539
64 Ga0562379_0008 3300056790 Bacteria 1928858
65 Ga0466723_090953 3300042618 Bacteria 11513
66 Ga0466728_333527 3300042620 Bacteria 2222
67 Ga0466707_252828 3300042601 Bacteria 1691
68 Ga0466707_345014 3300042601 Bacteria 1217
69 Ga0466713_032693 3300042602 Bacteria 139937
70 Ga0466713_063595 3300042602 Bacteria 12877
71 Ga0466719_126830 3300042606 Bacteria 53853
72 Ga0466730_003239 3300042625 Bacteria 3158
73 Ga0466703_221626 3300042636 Bacteria 46159
74 Ga0466704_291838 3300042643 Unclassified 4697
75 Ga0466692_033185 3300042591 Bacteria 2718
76 Ga0123357_10099996 3300009784 Bacteria 3743
77 Ga0123356_10008883 3300010049 Bacteria 9948
78 Ga0123356_10043527 3300010049 Unclassified 4181
79 Ga0123353_10600946 3300010167 Bacteria 1572
80 Ga0123353_10859317 3300010167 Unclassified 1242
81 Ga0123354_10002139 3300010882 Unclassified 25596
82 Ga0466705_040116 3300042612 Bacteria 10801
83 Ga0466705_103407 3300042612 Bacteria 5901
84 Ga0562375_0353 3300056856 Unclassified 106047
85 Ga0466710_325646 3300042613 Bacteria 2072
86 Ga0466728_104022 3300042620 Bacteria 1604
87 Ga0466707_001631 3300042601 Bacteria 3788
88 Ga0466707_331174 3300042601 Bacteria 2520
89 Ga0466703_421407 3300042636 Bacteria 1810
90 Ga0466708_332784 3300042652 Bacteria 2455
91 Ga0466691_224303 3300042593 Bacteria 5121
92 Ga0466696_231464 3300042596 Bacteria 3821
93 Ga0466696_234279 3300042596 Bacteria 1854
94 Ga0123357_10018658 3300009784 Bacteria 9227
95 Ga0123356_10002495 3300010049 Unclassified 19650
96 Ga0123354_10332687 3300010882 Bacteria 1382
97 Ga0466697_129720 3300042611 Bacteria 7814
98 Ga0466705_326546 3300042612 Bacteria 5538
99 Ga0466715_219611 3300042616 Bacteria 102424
100 Ga0466723_306432 3300042618 Bacteria 2277
101 Ga0466728_212762 3300042620 Bacteria 4057
102 Ga0466706_009900 3300042599 Bacteria 12432
103 Ga0466713_120315 3300042602 Bacteria 1784
104 Ga0466730_069639 3300042625 Bacteria 1055
105 Ga0466704_606659 3300042643 Bacteria 1410
106 Ga0466691_121707 3300042593 Bacteria 1631
107 Ga0123356_10023737 3300010049 Bacteria 5770
108 Ga0123356_10609688 3300010049 Bacteria 1257
109 JGI24705J35276_12220509 3300002504 Bacteria 2272

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042601 Ga0466707_345014 Ga0466707_345014_548_1162 204
2 3300042643 Ga0466704_166380 Ga0466704_166380_3907_4557 216
3 3300042613 Ga0466710_325646 Ga0466710_325646_571_1227 218
4 3300042618 Ga0466723_268134 Ga0466723_268134_1294_1950 218
5 3300042620 Ga0466728_104022 Ga0466728_104022_666_1322 218
6 3300042625 Ga0466730_003239 Ga0466730_003239_2209_2865 218
7 3300042625 Ga0466730_075687 Ga0466730_075687_504_1160 218
8 3300042652 Ga0466708_332784 Ga0466708_332784_1037_1693 218
9 iso_pr_bacteria 2772190761 2772884512 218
10 iso_pr_bacteria 2820876581 2820877370 218
11 iso_pr_bacteria 2820911766 2820913808 218
12 3300010049 Ga0123356_10043527 Ga0123356_100435274 219
13 3300042606 Ga0466719_106946 Ga0466719_106946_350_1009 219
14 3300042611 Ga0466697_129720 Ga0466697_129720_6230_6889 219
15 3300042618 Ga0466723_090953 Ga0466723_090953_69_728 219
16 3300042618 Ga0466723_270859 Ga0466723_270859_6288_6947 219
17 3300042618 Ga0466723_306432 Ga0466723_306432_588_1247 219
18 3300042636 Ga0466703_221626 Ga0466703_221626_30795_31454 219
19 iso_pr_bacteria 2718217924 2719371304 219
20 iso_pr_bacteria 2821316722 2821319035 219
21 iso_pr_bacteria 2856652821 2856657980 219
22 iso_pr_bacteria 2864899338 2864901111 219
23 iso_pr_bacteria 2898589227 2898595556 219
24 iso_pr_bacteria 8073544309 8073548597 219
25 3300010049 Ga0123356_10006286 Ga0123356_100062867 220
26 3300042606 Ga0466719_126830 Ga0466719_126830_47390_48052 220
27 3300042616 Ga0466715_219611 Ga0466715_219611_2851_3513 220
28 3300042618 Ga0466723_183121 Ga0466723_183121_3575_4237 220
29 3300042620 Ga0466728_212762 Ga0466728_212762_3321_3983 220
30 3300042625 Ga0466730_074357 Ga0466730_074357_729_1391 220
31 3300042625 Ga0466730_075424 Ga0466730_075424_654_1316 220
32 3300002504 JGI24705J35276_12220509 JGI24705J35276_122205092 221
33 3300010049 Ga0123356_10016040 Ga0123356_100160408 221
34 3300042593 Ga0466691_121707 Ga0466691_121707_568_1233 221
35 3300042599 Ga0466706_009900 Ga0466706_009900_2155_2820 221
36 3300042602 Ga0466713_001459 Ga0466713_001459_3346_4011 221
37 3300042602 Ga0466713_120315 Ga0466713_120315_958_1623 221
38 3300042620 Ga0466728_009467 Ga0466728_009467_252_917 221
39 3300042625 Ga0466730_018111 Ga0466730_018111_2460_3125 221
40 iso_pr_bacteria 2515154106 2515601673 222
41 iso_pr_bacteria 2820935937 2820936085 222
42 iso_pr_bacteria 3006461590 3006468826 222
43 iso_pr_bacteria 8067071256 8067077327 222
44 3300009826 Ga0123355_10004847 Ga0123355_1000484717 223
45 3300010167 Ga0123353_10859317 Ga0123353_108593172 223
46 3300012805 Ga0160464_108962 Ga0160464_1089622 223
47 3300042599 Ga0466706_273489 Ga0466706_273489_3133_3804 223
48 3300042601 Ga0466707_252828 Ga0466707_252828_935_1606 223
49 3300042625 Ga0466730_009923 Ga0466730_009923_18512_19183 223
50 3300042625 Ga0466730_069639 Ga0466730_069639_297_968 223
51 3300042636 Ga0466703_151404 Ga0466703_151404_6666_7337 223
52 iso_pr_bacteria 2515154100 2515556163 223
53 iso_pr_bacteria 2820842553 2820844791 223
54 iso_pr_bacteria 2820849606 2820851736 223
55 iso_pr_bacteria 2820867525 2820869867 223
56 iso_pr_bacteria 2820929059 2820930383 223
57 iso_pr_bacteria 2912749649 2912755937 223
58 iso_pr_bacteria 2931425734 2931427837 223
59 3300010049 Ga0123356_10023737 Ga0123356_100237377 224
60 3300010167 Ga0123353_10214238 Ga0123353_102142383 224
61 3300010882 Ga0123354_10002139 Ga0123354_1000213917 224
62 3300042591 Ga0466692_170631 Ga0466692_170631_166_840 224
63 3300042611 Ga0466697_031950 Ga0466697_031950_1238_1912 224
64 iso_pr_bacteria 2820838073 2820838564 224
65 iso_pr_bacteria 2820899690 2820899918 224
66 iso_pr_bacteria 2908241010 2908246469 224
67 3300009784 Ga0123357_10018658 Ga0123357_100186589 225
68 3300009784 Ga0123357_10302749 Ga0123357_103027492 225
69 3300010049 Ga0123356_10008883 Ga0123356_1000888310 225
70 3300010882 Ga0123354_10061568 Ga0123354_100615687 225
71 3300010882 Ga0123354_10332687 Ga0123354_103326872 225
72 3300012852 Ga0160430_100023 Ga0160430_10002384 225
73 3300042602 Ga0466713_125635 Ga0466713_125635_69_746 225
74 3300042615 Ga0466711_147473 Ga0466711_147473_463_1140 225
75 3300042621 Ga0466729_040130 Ga0466729_040130_790_1467 225
76 3300042625 Ga0466730_029550 Ga0466730_029550_1673_2350 225
77 3300042625 Ga0466730_055295 Ga0466730_055295_31240_31917 225
78 3300042655 Ga0466727_304120 Ga0466727_304120_3719_4396 225
79 iso_pr_bacteria 2515154104 2515590367 225
80 iso_pr_bacteria 2523533511 2523592904 225
81 iso_pr_bacteria 2862784999 2862788662 225
82 iso_pr_bacteria 2873196663 2873198392 225
83 iso_pr_bacteria 2912817845 2912822659 225
84 iso_pr_bacteria 3006468911 3006477337 225
85 iso_pr_bacteria 3006667155 3006669647 225
86 iso_pr_bacteria 647000328 647325180 225
87 iso_pr_bacteria 8046957834 8046962905 225
88 3300009784 Ga0123357_10099996 Ga0123357_100999967 226
89 3300009826 Ga0123355_10186008 Ga0123355_101860082 226
90 3300042602 Ga0466713_032693 Ga0466713_032693_2059_2739 226
91 3300042643 Ga0466704_291838 Ga0466704_291838_148_828 226
92 iso_pr_bacteria 2820863028 2820864299 226
93 iso_pr_bacteria 2820889385 2820889611 226
94 iso_pr_bacteria 8053361298 8053363259 226
95 3300002462 JGI24702J35022_10110690 JGI24702J35022_101106902 227
96 3300010049 Ga0123356_10609688 Ga0123356_106096882 227
97 3300010167 Ga0123353_10000509 Ga0123353_1000050943 227
98 3300010167 Ga0123353_10600946 Ga0123353_106009462 227
99 3300042601 Ga0466707_001631 Ga0466707_001631_2866_3549 227
100 3300042601 Ga0466707_331174 Ga0466707_331174_809_1492 227
101 3300042602 Ga0466713_063595 Ga0466713_063595_12022_12705 227
102 3300042609 Ga0466722_188090 Ga0466722_188090_222_905 227
103 3300042612 Ga0466705_169625 Ga0466705_169625_3807_4490 227
104 3300042612 Ga0466705_326546 Ga0466705_326546_708_1391 227
105 3300042620 Ga0466728_333527 Ga0466728_333527_1486_2169 227
106 iso_pr_bacteria 2820857933 2820861928 227
107 iso_pr_bacteria 2820882373 2820883510 227
108 3300010167 Ga0123353_10059060 Ga0123353_100590603 228
109 3300042590 Ga0466690_242197 Ga0466690_242197_937_1623 228
110 3300042596 Ga0466696_234279 Ga0466696_234279_627_1313 228
111 3300042601 Ga0466707_301133 Ga0466707_301133_6812_7498 228
112 3300042612 Ga0466705_002181 Ga0466705_002181_391_1077 228
113 3300042612 Ga0466705_017252 Ga0466705_017252_446_1132 228
114 3300042612 Ga0466705_103407 Ga0466705_103407_1534_2220 228
115 3300042636 Ga0466703_164152 Ga0466703_164152_9271_9957 228
116 3300042643 Ga0466704_304310 Ga0466704_304310_582_1268 228
117 3300042643 Ga0466704_606659 Ga0466704_606659_483_1169 228
118 3300042652 Ga0466708_139236 Ga0466708_139236_3950_4636 228
119 iso_pr_bacteria 2820922474 2820924118 228
120 3300010049 Ga0123356_10002495 Ga0123356_1000249514 229
121 3300042596 Ga0466696_502927 Ga0466696_502927_586_1275 229
122 3300042602 Ga0466713_024393 Ga0466713_024393_33136_33825 229
123 3300042612 Ga0466705_040116 Ga0466705_040116_3888_4577 229
124 3300042621 Ga0466729_152417 Ga0466729_152417_1652_2341 229
125 3300042636 Ga0466703_264351 Ga0466703_264351_7554_8243 229
126 3300042655 Ga0466727_235674 Ga0466727_235674_1128_1817 229
127 3300042591 Ga0466692_033185 Ga0466692_033185_1982_2674 230
128 3300042612 Ga0466705_201718 Ga0466705_201718_6691_7383 230
129 3300042643 Ga0466704_021875 Ga0466704_021875_20550_21242 230
130 iso_pr_bacteria 2545824723 2546568237 230
131 3300042593 Ga0466691_224303 Ga0466691_224303_3184_3879 231
132 3300042596 Ga0466696_231464 Ga0466696_231464_721_1419 232
133 3300042616 Ga0466715_098191 Ga0466715_098191_756_1454 232
134 iso_pr_bacteria 2820814774 2820816428 232
135 iso_pr_bacteria 2852016966 2852017996 232
136 iso_pr_bacteria 2909412500 2909413516 232
137 iso_pr_bacteria 8062637095 8062638858 232
138 iso_pr_bacteria 8062747827 8062750251 232
139 3300042596 Ga0466696_266100 Ga0466696_266100_190_936 233
140 3300042601 Ga0466707_183290 Ga0466707_183290_322_1026 234
141 3300042615 Ga0466711_498719 Ga0466711_498719_263_967 234
142 3300056842 Ga0562377_0089 Ga0562377_0089_34646_35380 234
143 3300057007 Ga0562374_0370 Ga0562374_0370_75577_76311 234
144 3300042621 Ga0466729_261188 Ga0466729_261188_2345_3058 237
145 iso_pr_bacteria 2547132081 2547294625 237
146 iso_pr_bacteria 2896955351 2896960486 237
147 iso_pr_bacteria 8077783556 8077788583 237
148 3300042636 Ga0466703_302535 Ga0466703_302535_943_1659 238
149 3300056790 Ga0562379_0272 Ga0562379_0272_109178_109894 238
150 3300056856 Ga0562375_0353 Ga0562375_0353_36807_37523 238
151 3300056856 Ga0562375_1890 Ga0562375_1890_4795_5511 238
152 iso_pr_bacteria 2630969010 2634124158 238
153 3300042602 Ga0466713_063930 Ga0466713_063930_7605_8327 240
154 3300042636 Ga0466703_255624 Ga0466703_255624_16198_16923 241
155 3300042636 Ga0466703_421407 Ga0466703_421407_882_1628 243
156 3300056790 Ga0562379_0008 Ga0562379_0008_1092298_1093032 244
157 3300042602 Ga0466713_069100 Ga0466713_069100_461_1219 252
158 iso_pr_bacteria 2648501322 2649446735 253

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF02080 TrkA_C TrkA-C domain 149 216 0.97
PF02254 TrkA_N TrkA-N domain 3 118 0.96
PF02558 ApbA Ketopantoate reductase PanE/ApbA 3 33 0.9
PF13460 NAD_binding_10 NAD(P)H-binding 7 77 0.84
PF03807 F420_oxidored NADP oxidoreductase coenzyme F420-dependent 2 84 0.76
PF13241 NAD_binding_7 Putative NAD(P)-binding 2 89 0.73

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF02254 GO:0006813 potassium ion transport BP

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.57 0.64 Medium

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.